F420034

General Info

Members Datasets Scaffolds Average Seq Length
355 205 710 136

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100995098|Ga0070713_1009950982
Length 156
Sequence MSDGSGSTQDAKPAQRAIVAGHGEFAAGLVSAVEVITGRGAQLIPVAVPGLCAEDIEKLIRERMLESGVKVIFTDLQAGSCTMAARKILRGVDDAVLIAGVNLPTLLDFVFAEQMPAVDAARHSAERGKIAITVVGAKGGAGVAPGGVGGGGVKQA

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
70 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
111 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
114 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
115 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
116 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
117 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
118 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
119 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
120 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
122 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
123 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
124 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
125 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
126 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
127 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
128 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
129 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
130 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
131 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
132 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
133 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
134 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
137 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
138 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
139 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
140 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
141 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
142 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
143 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
144 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
145 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
146 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
147 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
148 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
149 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
150 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
151 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
152 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
153 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
154 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
155 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
156 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
157 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
158 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
159 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
160 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
161 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
162 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
163 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
164 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
165 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
166 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
167 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
168 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
169 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
170 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
171 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
172 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
173 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
174 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
175 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
176 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
177 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
178 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
179 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
180 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
181 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
182 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
183 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
184 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
187 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
197 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
198 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
202 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
203 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
204 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
205 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.85
Rhizosphere 99.15
Stem 0
Stem Tuber 0
Unclassified 14.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100995098 3300005436 Bacteria 809
2 Ga0070658_10009375 3300005327 Bacteria 7866
3 Ga0070658_10745289 3300005327 Unclassified 851
4 Ga0070683_101177103 3300005329 Bacteria 737
5 Ga0070670_100624319 3300005331 Bacteria 965
6 Ga0070666_10465985 3300005335 Bacteria 914
7 Ga0070680_100002160 3300005336 Bacteria 14534
8 Ga0070680_100107617 3300005336 Bacteria 2319
9 Ga0070680_101086091 3300005336 Bacteria 691
10 Ga0070682_100336037 3300005337 Bacteria 1121
11 Ga0068868_100373887 3300005338 Bacteria 1225
12 Ga0070660_100003351 3300005339 Bacteria 11012
13 Ga0070660_100641893 3300005339 Unclassified 889
14 Ga0070660_100967001 3300005339 Bacteria 719
15 Ga0070689_100070411 3300005340 Bacteria 2731
16 Ga0070691_10301312 3300005341 Archaea 876
17 Ga0070661_100400817 3300005344 Bacteria 1085
18 Ga0070669_100002843 3300005353 Bacteria 12508
19 Ga0070675_100072507 3300005354 Bacteria 2859
20 Ga0070671_100387592 3300005355 Bacteria 1194
21 Ga0070671_101697116 3300005355 Unclassified 560
22 Ga0070674_101859473 3300005356 Bacteria 547
23 Ga0070673_100057014 3300005364 Bacteria 3085
24 Ga0070688_100001537 3300005365 Bacteria 11528
25 Ga0070659_100009318 3300005366 Bacteria 7210
26 Ga0070667_100056272 3300005367 Bacteria 3323
27 Ga0070709_10036117 3300005434 Bacteria 3008
28 Ga0070714_100005932 3300005435 Bacteria 9378
29 Ga0070714_100078321 3300005435 Bacteria 2872
30 Ga0070714_100599279 3300005435 Bacteria 1058
31 Ga0070714_101519706 3300005435 Bacteria 654
32 Ga0070713_100000365 3300005436 Bacteria 29146
33 Ga0070713_100052178 3300005436 Bacteria 3385
34 Ga0070713_100147092 3300005436 Bacteria 2092
35 Ga0070713_100239916 3300005436 Bacteria 1650
36 Ga0070713_100930461 3300005436 Unclassified 837
37 Ga0070710_10098649 3300005437 Bacteria 1736
38 Ga0070710_10181297 3300005437 Bacteria 1319
39 Ga0070710_10490903 3300005437 Bacteria 839
40 Ga0070710_10671967 3300005437 Bacteria 728
41 Ga0070711_100072603 3300005439 Bacteria 2428
42 Ga0070711_100090939 3300005439 Bacteria 2199
43 Ga0070711_100270931 3300005439 Bacteria 1339
44 Ga0070711_100273926 3300005439 Unclassified 1333
45 Ga0070694_101195151 3300005444 Bacteria 637
46 Ga0070663_100364509 3300005455 Unclassified 1173
47 Ga0070678_100309021 3300005456 Unclassified 1346
48 Ga0070662_100457779 3300005457 Bacteria 1060
49 Ga0070681_10000119 3300005458 Bacteria 59101
50 Ga0070681_10012713 3300005458 Bacteria 8355
51 Ga0070681_10220634 3300005458 Bacteria 1811
52 Ga0070681_11172172 3300005458 Bacteria 690
53 Ga0070698_100010365 3300005471 Bacteria 9952
54 Ga0070698_101143918 3300005471 Unclassified 727
55 Ga0070679_100000066 3300005530 Bacteria 78387
56 Ga0070679_100226461 3300005530 Bacteria 1830
57 Ga0070679_100539838 3300005530 Bacteria 1110
58 Ga0070679_100547342 3300005530 Bacteria 1101
59 Ga0070679_101638613 3300005530 Bacteria 591
60 Ga0070679_101680321 3300005530 Unclassified 583
61 Ga0068853_100048373 3300005539 Bacteria 3653
62 Ga0068853_100139595 3300005539 Bacteria 2175
63 Ga0070672_100073023 3300005543 Bacteria 2733
64 Ga0070672_100322658 3300005543 Bacteria 1313
65 Ga0070672_101022192 3300005543 Unclassified 733
66 Ga0070696_100002244 3300005546 Bacteria 12738
67 Ga0070693_100006308 3300005547 Bacteria 5747
68 Ga0070693_100405712 3300005547 Bacteria 946
69 Ga0070693_100730152 3300005547 Bacteria 728
70 Ga0070665_102376902 3300005548 Unclassified 532
71 Ga0070664_100074122 3300005564 Bacteria 2921
72 Ga0070664_100783735 3300005564 Bacteria 891
73 Ga0068857_100022509 3300005577 Bacteria 5546
74 Ga0068854_100875646 3300005578 Unclassified 788
75 Ga0068856_100973711 3300005614 Bacteria 867
76 Ga0070702_100839279 3300005615 Bacteria 714
77 Ga0068852_100026491 3300005616 Bacteria 4714
78 Ga0068852_100714298 3300005616 Bacteria 1013
79 Ga0068852_101137983 3300005616 Archaea 801
80 Ga0068859_100010154 3300005617 Bacteria 9482
81 Ga0068864_100410007 3300005618 Bacteria 1289
82 Ga0068870_10004708 3300005840 Bacteria 5896
83 Ga0068858_100572096 3300005842 Bacteria 1095
84 Ga0081539_10001111 3300005985 Bacteria 48779
85 Ga0070717_10005342 3300006028 Bacteria 9365
86 Ga0070717_11840392 3300006028 Unclassified 547
87 Ga0070716_100395755 3300006173 Unclassified 992
88 Ga0070712_100022496 3300006175 Bacteria 4154
89 Ga0070712_100051807 3300006175 Bacteria 2860
90 Ga0070712_100359984 3300006175 Bacteria 1193
91 Ga0068871_101569379 3300006358 Bacteria 623
92 Ga0075434_100010409 3300006871 Bacteria 8717
93 Ga0075434_101165049 3300006871 Bacteria 783
94 Ga0075429_100846522 3300006880 Unclassified 801
95 Ga0097620_100010154 3300006931 Bacteria 9482
96 Ga0075435_100504497 3300007076 Bacteria 1046
97 Ga0105245_11006046 3300009098 Bacteria 878
98 Ga0105248_10298122 3300009177 Bacteria 1815
99 Ga0157373_10021338 3300013100 Bacteria 4704
100 Ga0157373_11201753 3300013100 Bacteria 571
101 Ga0157371_10009393 3300013102 Bacteria 7701
102 Ga0157370_10275972 3300013104 Bacteria 1553
103 Ga0157369_10034675 3300013105 Bacteria 5536
104 Ga0157369_11382669 3300013105 Bacteria 717
105 Ga0157369_11551562 3300013105 Bacteria 674
106 Ga0157378_11623535 3300013297 Bacteria 693
107 Ga0163162_12880342 3300013306 Unclassified 554
108 Ga0163162_12971009 3300013306 Bacteria 545
109 Ga0157372_10003051 3300013307 Bacteria 18053
110 Ga0157372_10040174 3300013307 Bacteria 5165
111 Ga0157372_11686658 3300013307 Bacteria 729
112 Ga0157375_10193515 3300013308 Bacteria 2189
113 Ga0157380_10178020 3300014326 Unclassified 1866
114 Ga0157377_10242551 3300014745 Bacteria 1164
115 Ga0157376_10406903 3300014969 Bacteria 1317
116 Ga0182007_10039953 3300015262 Unclassified 1567
117 Ga0206356_11815505 3300020070 Bacteria 672
118 Ga0207692_10134092 3300025898 Bacteria 1402
119 Ga0207692_10232853 3300025898 Bacteria 1097
120 Ga0207692_10378299 3300025898 Bacteria 878
121 Ga0207692_10410922 3300025898 Bacteria 846
122 Ga0207699_10047210 3300025906 Bacteria 2524
123 Ga0207699_10642247 3300025906 Unclassified 775
124 Ga0207643_10010330 3300025908 Bacteria 5026
125 Ga0207705_10015020 3300025909 Bacteria 5567
126 Ga0207705_10093179 3300025909 Bacteria 2208
127 Ga0207705_10662240 3300025909 Bacteria 812
128 Ga0207705_10662573 3300025909 Unclassified 812
129 Ga0207707_10001516 3300025912 Bacteria 21421
130 Ga0207707_10021937 3300025912 Bacteria 5581
131 Ga0207707_10319440 3300025912 Unclassified 1341
132 Ga0207707_10991974 3300025912 Bacteria 690
133 Ga0207693_10004234 3300025915 Bacteria 12168
134 Ga0207693_10010340 3300025915 Bacteria 7575
135 Ga0207693_10068503 3300025915 Bacteria 2777
136 Ga0207663_10127726 3300025916 Bacteria 1752
137 Ga0207663_10245841 3300025916 Bacteria 1314
138 Ga0207660_10007775 3300025917 Bacteria 6940
139 Ga0207660_11354535 3300025917 Bacteria 577
140 Ga0207662_10010512 3300025918 Bacteria 5113
141 Ga0207657_10003620 3300025919 Bacteria 16467
142 Ga0207657_10719158 3300025919 Bacteria 775
143 Ga0207649_10344478 3300025920 Bacteria 1101
144 Ga0207649_11436008 3300025920 Bacteria 546
145 Ga0207652_10002383 3300025921 Bacteria 15874
146 Ga0207652_10072664 3300025921 Bacteria 2992
147 Ga0207652_10372575 3300025921 Bacteria 1289
148 Ga0207652_10435194 3300025921 Bacteria 1182
149 Ga0207652_10450819 3300025921 Bacteria 1160
150 Ga0207652_10477744 3300025921 Unclassified 1123
151 Ga0207652_10757012 3300025921 Bacteria 864
152 Ga0207652_10971214 3300025921 Bacteria 748
153 Ga0207652_11475842 3300025921 Bacteria 584
154 Ga0207694_10404966 3300025924 Bacteria 1135
155 Ga0207650_10953340 3300025925 Bacteria 729
156 Ga0207659_10011043 3300025926 Bacteria 5693
157 Ga0207700_10000601 3300025928 Bacteria 21049
158 Ga0207700_10011250 3300025928 Bacteria 5697
159 Ga0207700_10077548 3300025928 Bacteria 2581
160 Ga0207700_10682256 3300025928 Unclassified 917
161 Ga0207664_10055110 3300025929 Bacteria 3154
162 Ga0207664_10060871 3300025929 Bacteria 3010
163 Ga0207664_10150218 3300025929 Bacteria 1978
164 Ga0207644_10016146 3300025931 Bacteria 5023
165 Ga0207690_10449682 3300025932 Bacteria 1035
166 Ga0207706_10391411 3300025933 Bacteria 1206
167 Ga0207670_10062431 3300025936 Bacteria 2546
168 Ga0207669_10405503 3300025937 Bacteria 1069
169 Ga0207669_11549194 3300025937 Archaea 565
170 Ga0207665_10281325 3300025939 Bacteria 1238
171 Ga0207691_10086534 3300025940 Bacteria 2812
172 Ga0207691_10349195 3300025940 Bacteria 1266
173 Ga0207691_10536016 3300025940 Archaea 993
174 Ga0207691_10756938 3300025940 Bacteria 818
175 Ga0207691_10762752 3300025940 Unclassified 814
176 Ga0207711_10365291 3300025941 Bacteria 1338
177 Ga0207661_10776789 3300025944 Bacteria 882
178 Ga0207679_10022702 3300025945 Bacteria 4277
179 Ga0207679_10097178 3300025945 Bacteria 2293
180 Ga0207679_11235505 3300025945 Bacteria 686
181 Ga0207679_11272090 3300025945 Bacteria 675
182 Ga0207667_10040067 3300025949 Bacteria 4988
183 Ga0207667_11258231 3300025949 Bacteria 718
184 Ga0207651_10531272 3300025960 Bacteria 1020
185 Ga0207651_11286283 3300025960 Unclassified 657
186 Ga0207677_10498050 3300026023 Unclassified 1053
187 Ga0207677_11148962 3300026023 Unclassified 709
188 Ga0207703_10504425 3300026035 Bacteria 1136
189 Ga0207639_10233775 3300026041 Bacteria 1595
190 Ga0207639_11721240 3300026041 Unclassified 587
191 Ga0207648_10594455 3300026089 Bacteria 1019
192 Ga0207674_10042109 3300026116 Bacteria 4720
193 Ga0207683_10580525 3300026121 Bacteria 1037
194 Ga0207683_11004317 3300026121 Archaea 774
195 Ga0207698_10004902 3300026142 Bacteria 8208
196 Ga0307408_100356260 3300031548 Bacteria 1243
197 Ga0307408_100370241 3300031548 Bacteria 1222
198 Ga0307405_11700230 3300031731 Bacteria 559
199 Ga0307410_10066404 3300031852 Bacteria 2485
200 Ga0307410_10144424 3300031852 Bacteria 1764
201 Ga0307410_10745380 3300031852 Unclassified 829
202 Ga0307406_10311076 3300031901 Unclassified 1214
203 Ga0307406_10371273 3300031901 Bacteria 1125
204 Ga0307406_10493949 3300031901 Bacteria 991
205 Ga0307406_11184213 3300031901 Bacteria 663
206 Ga0307409_100017363 3300031995 Bacteria 4793
207 Ga0307416_100082932 3300032002 Bacteria 2718
208 Ga0307411_10523458 3300032005 Bacteria 1007
209 Ga0307411_11107959 3300032005 Bacteria 714
210 Ga0307415_100186435 3300032126 Bacteria 1633
211 Ga0307415_100925899 3300032126 Bacteria 805
212 Ga0307415_101017807 3300032126 Bacteria 771
213 Ga0307415_102038176 3300032126 Unclassified 559
214 Ga0373930_0157813 3300034816 Unclassified 572
215 Ga0373926_0000731 3300035083 Bacteria 9111
216 Ga0373934_0013031 3300035086 Bacteria 3140
217 Ga0373944_0013591 3300035089 Bacteria 2261
218 Ga0373923_0004376 3300035111 Bacteria 4681
219 Ga0373923_0057942 3300035111 Bacteria 1639
220 Ga0373936_0039903 3300035113 Bacteria 1879
221 Ga0373941_0266302 3300035115 Bacteria 674
222 Ga0373945_0011667 3300035116 Bacteria 2908
223 Ga0373953_0004240 3300035117 Unclassified 4552
224 Ga0373953_0112842 3300035117 Bacteria 1150
225 Ga0373954_0018872 3300035118 Bacteria 3107
226 Ga0373956_0119668 3300035119 Bacteria 1229
227 Ga0373957_0040474 3300035120 Bacteria 1752
228 Ga0373943_0024931 3300035170 Bacteria 2792
229 Ga0373943_0095241 3300035170 Bacteria 1548
230 Ga0373946_0121351 3300035171 Unclassified 1193
231 Ga0373955_0042205 3300035172 Bacteria 2448
232 Ga0373955_0564448 3300035172 Unclassified 696
233 Ga0373924_0298154 3300035410 Bacteria 716
234 Ga0373935_0008971 3300035692 Bacteria 5983
235 Ga0373935_0199066 3300035692 Bacteria 1383
236 Ga0373927_0010703 3300035695 Bacteria 6111
237 Ga0373927_0619502 3300035695 Unclassified 715
238 Ga0373933_0008609 3300035724 Bacteria 5565
239 Ga0373933_0170060 3300035724 Bacteria 1386
240 Ga0373947_0002620 3300035725 Bacteria 10799
241 Ga0373937_0008633 3300036401 Bacteria 8852
242 Ga0373937_0093255 3300036401 Bacteria 2791
243 Ga0373937_0853945 3300036401 Bacteria 859
244 Ga0373937_0992508 3300036401 Bacteria 788
245 Ga0373925_0002987 3300037068 Bacteria 13332
246 Ga0373925_0070236 3300037068 Unclassified 2647
247 Ga0373925_0134938 3300037068 Bacteria 1928
248 Ga0373925_1422970 3300037068 Unclassified 568
249 Ga0466966_0089775 3300044684 Bacteria 1909
250 Ga0466967_0043886 3300045976 Bacteria 3874
251 Ga0466967_0112080 3300045976 Bacteria 2508
252 Ga0495592_0024160 3300046454 Bacteria 4620
253 Ga0495592_0066816 3300046454 Unclassified 2630
254 Ga0495603_0002982 3300046455 Bacteria 10011
255 Ga0495629_0014112 3300046459 Bacteria 5755
256 Ga0495629_0066215 3300046459 Bacteria 2521
257 Ga0495651_0012210 3300046462 Bacteria 6615
258 Ga0495653_0017133 3300046463 Bacteria 5893
259 Ga0495653_0019406 3300046463 Bacteria 5513
260 Ga0495580_0005679 3300046472 Bacteria 10261
261 Ga0495580_0028551 3300046472 Bacteria 4055
262 Ga0495580_0331467 3300046472 Unclassified 1033
263 Ga0495582_0005504 3300046473 Bacteria 7053
264 Ga0495582_0021050 3300046473 Bacteria 3571
265 Ga0495639_0000704 3300046475 Bacteria 15302
266 Ga0495639_0056059 3300046475 Bacteria 1798
267 Ga0495664_0018129 3300046477 Bacteria 4027
268 Ga0495664_0392859 3300046477 Bacteria 833
269 Ga0495594_0116229 3300046499 Bacteria 1510
270 Ga0495608_0013916 3300046511 Bacteria 5583
271 Ga0495608_0029791 3300046511 Unclassified 3699
272 Ga0495618_0106210 3300046514 Bacteria 1798
273 Ga0495628_0005937 3300046516 Bacteria 10685
274 Ga0495628_0097241 3300046516 Bacteria 2274
275 Ga0495630_0018256 3300046517 Bacteria 5151
276 Ga0495630_0134362 3300046517 Bacteria 1879
277 Ga0495630_0233554 3300046517 Bacteria 1405
278 Ga0495631_0248221 3300046518 Bacteria 759
279 Ga0495666_0226342 3300046526 Bacteria 855
280 Ga0495652_0014836 3300046529 Bacteria 6985
281 Ga0495652_0058304 3300046529 Bacteria 3269
282 Ga0495665_0001067 3300046531 Bacteria 14571
283 Ga0495665_0009112 3300046531 Bacteria 5379
284 Ga0495665_0193488 3300046531 Bacteria 1055
285 Ga0495640_0121824 3300046533 Bacteria 1695
286 Ga0495640_0192098 3300046533 Bacteria 1297
287 Ga0495587_0007410 3300046536 Bacteria 7106
288 Ga0495587_0010356 3300046536 Bacteria 5939
289 Ga0495645_0015144 3300046543 Bacteria 5482
290 Ga0495645_0040476 3300046543 Bacteria 3399
291 Ga0495645_0634869 3300046543 Bacteria 654
292 Ga0495622_0111379 3300046557 Bacteria 1253
293 Ga0495667_0006744 3300046559 Bacteria 7791
294 Ga0495634_0432310 3300046642 Bacteria 778
295 Ga0495635_0004505 3300046663 Bacteria 9651
296 Ga0495635_0725108 3300046663 Unclassified 643
297 Ga0495659_0073384 3300046664 Bacteria 1286
298 Ga0495588_0001415 3300046674 Bacteria 10249
299 Ga0495657_0015202 3300046675 Bacteria 5636
300 Ga0495599_0010839 3300046678 Bacteria 5585
301 Ga0495599_0013143 3300046678 Bacteria 5116
302 Ga0495623_0002993 3300046679 Bacteria 11115
303 Ga0495646_0051771 3300046680 Unclassified 2483
304 Ga0495646_0223831 3300046680 Unclassified 1016
305 Ga0495658_0001668 3300046683 Bacteria 11553
306 Ga0495613_0005287 3300046689 Bacteria 9700
307 Ga0495613_0137953 3300046689 Bacteria 1744
308 Ga0495613_0827863 3300046689 Unclassified 603
309 Ga0495624_0341898 3300046690 Bacteria 900
310 Ga0495600_0003030 3300046809 Bacteria 9812
311 Ga0495600_0040340 3300046809 Bacteria 3040
312 Ga0495600_0145211 3300046809 Bacteria 1538
313 Ga0495581_0000809 3300047315 Bacteria 16635
314 Ga0495581_0151274 3300047315 Bacteria 1355
315 Ga0495581_0758601 3300047315 Bacteria 558
316 Ga0495604_0005420 3300047317 Bacteria 10117
317 Ga0495604_0075674 3300047317 Bacteria 2534
318 Ga0495674_0006248 3300047319 Bacteria 11431
319 Ga0495674_0026894 3300047319 Bacteria 5262
320 Ga0495680_0027329 3300047322 Bacteria 4690
321 Ga0495680_0182286 3300047322 Bacteria 1515
322 Ga0495675_0007997 3300047444 Bacteria 6541
323 Ga0495675_0156772 3300047444 Bacteria 1404
324 Ga0495684_0005933 3300047471 Bacteria 9491
325 Ga0495684_0082616 3300047471 Bacteria 2437
326 Ga0495684_0091913 3300047471 Bacteria 2298
327 Ga0495593_0002738 3300047673 Bacteria 10610
328 Ga0495602_0003786 3300048088 Bacteria 15729
329 Ga0495602_0094817 3300048088 Bacteria 2465
330 Ga0495614_0000708 3300048089 Bacteria 14038
331 Ga0496104_0073425 3300048907 Bacteria 3255
332 Ga0496105_0092303 3300048908 Bacteria 2500
333 Ga0496114_0851259 3300048917 Unclassified 792
334 Ga0501298_072684 3300049521 Bacteria 745
335 Ga0501033_0005653 3300049570 Bacteria 9877
336 Ga0501034_0003782 3300049571 Bacteria 17079
337 Ga0501036_0271651 3300049572 Bacteria 1419
338 Ga0501037_0112235 3300049573 Bacteria 1963
339 Ga0501038_0260644 3300049574 Bacteria 1370
340 Ga0501039_0213586 3300049575 Bacteria 1517
341 Ga0501043_0042806 3300049579 Bacteria 3559
342 Ga0501047_0092897 3300049581 Bacteria 2896
343 Ga0501048_0416251 3300049582 Unclassified 961
344 Ga0501233_067386 3300049668 Unclassified 901
345 Ga0501221_196664 3300049704 Unclassified 559
346 Ga0501035_0034312 3300049822 Bacteria 4611
347 Ga0501044_0004890 3300049823 Bacteria 14973
348 nmdc:mga05p37_850572_c1 3300050507 Bacteria 991
349 nmdc:mga0n895_1310598_c1 3300050512 Bacteria 695
350 nmdc:mga0n895_23636_c1 3300050512 Bacteria 5780
351 Ga0495601_0019485 3300053077 Unclassified 4138
352 Ga0495601_0166955 3300053077 Bacteria 1438
353 Ga0495612_0006380 3300053078 Unclassified 4854
354 Ga0495595_0095236 3300053084 Unclassified 1432
355 Ga0495619_0012227 3300053085 Bacteria 5399
356 Ga0070713_100995098
357 Ga0070658_10009375
358 Ga0070658_10745289
359 Ga0070683_101177103
360 Ga0070670_100624319
361 Ga0070666_10465985
362 Ga0070680_100002160
363 Ga0070680_100107617
364 Ga0070680_101086091
365 Ga0070682_100336037
366 Ga0068868_100373887
367 Ga0070660_100003351
368 Ga0070660_100641893
369 Ga0070660_100967001
370 Ga0070689_100070411
371 Ga0070691_10301312
372 Ga0070661_100400817
373 Ga0070669_100002843
374 Ga0070675_100072507
375 Ga0070671_100387592
376 Ga0070671_101697116
377 Ga0070674_101859473
378 Ga0070673_100057014
379 Ga0070688_100001537
380 Ga0070659_100009318
381 Ga0070667_100056272
382 Ga0070709_10036117
383 Ga0070714_100005932
384 Ga0070714_100078321
385 Ga0070714_100599279
386 Ga0070714_101519706
387 Ga0070713_100000365
388 Ga0070713_100052178
389 Ga0070713_100147092
390 Ga0070713_100239916
391 Ga0070713_100930461
392 Ga0070710_10098649
393 Ga0070710_10181297
394 Ga0070710_10490903
395 Ga0070710_10671967
396 Ga0070711_100072603
397 Ga0070711_100090939
398 Ga0070711_100270931
399 Ga0070711_100273926
400 Ga0070694_101195151
401 Ga0070663_100364509
402 Ga0070678_100309021
403 Ga0070662_100457779
404 Ga0070681_10000119
405 Ga0070681_10012713
406 Ga0070681_10220634
407 Ga0070681_11172172
408 Ga0070698_100010365
409 Ga0070698_101143918
410 Ga0070679_100000066
411 Ga0070679_100226461
412 Ga0070679_100539838
413 Ga0070679_100547342
414 Ga0070679_101638613
415 Ga0070679_101680321
416 Ga0068853_100048373
417 Ga0068853_100139595
418 Ga0070672_100073023
419 Ga0070672_100322658
420 Ga0070672_101022192
421 Ga0070696_100002244
422 Ga0070693_100006308
423 Ga0070693_100405712
424 Ga0070693_100730152
425 Ga0070665_102376902
426 Ga0070664_100074122
427 Ga0070664_100783735
428 Ga0068857_100022509
429 Ga0068854_100875646
430 Ga0068856_100973711
431 Ga0070702_100839279
432 Ga0068852_100026491
433 Ga0068852_100714298
434 Ga0068852_101137983
435 Ga0068859_100010154
436 Ga0068864_100410007
437 Ga0068870_10004708
438 Ga0068858_100572096
439 Ga0081539_10001111
440 Ga0070717_10005342
441 Ga0070717_11840392
442 Ga0070716_100395755
443 Ga0070712_100022496
444 Ga0070712_100051807
445 Ga0070712_100359984
446 Ga0068871_101569379
447 Ga0075434_100010409
448 Ga0075434_101165049
449 Ga0075429_100846522
450 Ga0097620_100010154
451 Ga0075435_100504497
452 Ga0105245_11006046
453 Ga0105248_10298122
454 Ga0157373_10021338
455 Ga0157373_11201753
456 Ga0157371_10009393
457 Ga0157370_10275972
458 Ga0157369_10034675
459 Ga0157369_11382669
460 Ga0157369_11551562
461 Ga0157378_11623535
462 Ga0163162_12880342
463 Ga0163162_12971009
464 Ga0157372_10003051
465 Ga0157372_10040174
466 Ga0157372_11686658
467 Ga0157375_10193515
468 Ga0157380_10178020
469 Ga0157377_10242551
470 Ga0157376_10406903
471 Ga0182007_10039953
472 Ga0206356_11815505
473 Ga0207692_10134092
474 Ga0207692_10232853
475 Ga0207692_10378299
476 Ga0207692_10410922
477 Ga0207699_10047210
478 Ga0207699_10642247
479 Ga0207643_10010330
480 Ga0207705_10015020
481 Ga0207705_10093179
482 Ga0207705_10662240
483 Ga0207705_10662573
484 Ga0207707_10001516
485 Ga0207707_10021937
486 Ga0207707_10319440
487 Ga0207707_10991974
488 Ga0207693_10004234
489 Ga0207693_10010340
490 Ga0207693_10068503
491 Ga0207663_10127726
492 Ga0207663_10245841
493 Ga0207660_10007775
494 Ga0207660_11354535
495 Ga0207662_10010512
496 Ga0207657_10003620
497 Ga0207657_10719158
498 Ga0207649_10344478
499 Ga0207649_11436008
500 Ga0207652_10002383
501 Ga0207652_10072664
502 Ga0207652_10372575
503 Ga0207652_10435194
504 Ga0207652_10450819
505 Ga0207652_10477744
506 Ga0207652_10757012
507 Ga0207652_10971214
508 Ga0207652_11475842
509 Ga0207694_10404966
510 Ga0207650_10953340
511 Ga0207659_10011043
512 Ga0207700_10000601
513 Ga0207700_10011250
514 Ga0207700_10077548
515 Ga0207700_10682256
516 Ga0207664_10055110
517 Ga0207664_10060871
518 Ga0207664_10150218
519 Ga0207644_10016146
520 Ga0207690_10449682
521 Ga0207706_10391411
522 Ga0207670_10062431
523 Ga0207669_10405503
524 Ga0207669_11549194
525 Ga0207665_10281325
526 Ga0207691_10086534
527 Ga0207691_10349195
528 Ga0207691_10536016
529 Ga0207691_10756938
530 Ga0207691_10762752
531 Ga0207711_10365291
532 Ga0207661_10776789
533 Ga0207679_10022702
534 Ga0207679_10097178
535 Ga0207679_11235505
536 Ga0207679_11272090
537 Ga0207667_10040067
538 Ga0207667_11258231
539 Ga0207651_10531272
540 Ga0207651_11286283
541 Ga0207677_10498050
542 Ga0207677_11148962
543 Ga0207703_10504425
544 Ga0207639_10233775
545 Ga0207639_11721240
546 Ga0207648_10594455
547 Ga0207674_10042109
548 Ga0207683_10580525
549 Ga0207683_11004317
550 Ga0207698_10004902
551 Ga0307408_100356260
552 Ga0307408_100370241
553 Ga0307405_11700230
554 Ga0307410_10066404
555 Ga0307410_10144424
556 Ga0307410_10745380
557 Ga0307406_10311076
558 Ga0307406_10371273
559 Ga0307406_10493949
560 Ga0307406_11184213
561 Ga0307409_100017363
562 Ga0307416_100082932
563 Ga0307411_10523458
564 Ga0307411_11107959
565 Ga0307415_100186435
566 Ga0307415_100925899
567 Ga0307415_101017807
568 Ga0307415_102038176
569 Ga0373930_0157813
570 Ga0373926_0000731
571 Ga0373934_0013031
572 Ga0373944_0013591
573 Ga0373923_0004376
574 Ga0373923_0057942
575 Ga0373936_0039903
576 Ga0373941_0266302
577 Ga0373945_0011667
578 Ga0373953_0004240
579 Ga0373953_0112842
580 Ga0373954_0018872
581 Ga0373956_0119668
582 Ga0373957_0040474
583 Ga0373943_0024931
584 Ga0373943_0095241
585 Ga0373946_0121351
586 Ga0373955_0042205
587 Ga0373955_0564448
588 Ga0373924_0298154
589 Ga0373935_0008971
590 Ga0373935_0199066
591 Ga0373927_0010703
592 Ga0373927_0619502
593 Ga0373933_0008609
594 Ga0373933_0170060
595 Ga0373947_0002620
596 Ga0373937_0008633
597 Ga0373937_0093255
598 Ga0373937_0853945
599 Ga0373937_0992508
600 Ga0373925_0002987
601 Ga0373925_0070236
602 Ga0373925_0134938
603 Ga0373925_1422970
604 Ga0466966_0089775
605 Ga0466967_0043886
606 Ga0466967_0112080
607 Ga0495592_0024160
608 Ga0495592_0066816
609 Ga0495603_0002982
610 Ga0495629_0014112
611 Ga0495629_0066215
612 Ga0495651_0012210
613 Ga0495653_0017133
614 Ga0495653_0019406
615 Ga0495580_0005679
616 Ga0495580_0028551
617 Ga0495580_0331467
618 Ga0495582_0005504
619 Ga0495582_0021050
620 Ga0495639_0000704
621 Ga0495639_0056059
622 Ga0495664_0018129
623 Ga0495664_0392859
624 Ga0495594_0116229
625 Ga0495608_0013916
626 Ga0495608_0029791
627 Ga0495618_0106210
628 Ga0495628_0005937
629 Ga0495628_0097241
630 Ga0495630_0018256
631 Ga0495630_0134362
632 Ga0495630_0233554
633 Ga0495631_0248221
634 Ga0495666_0226342
635 Ga0495652_0014836
636 Ga0495652_0058304
637 Ga0495665_0001067
638 Ga0495665_0009112
639 Ga0495665_0193488
640 Ga0495640_0121824
641 Ga0495640_0192098
642 Ga0495587_0007410
643 Ga0495587_0010356
644 Ga0495645_0015144
645 Ga0495645_0040476
646 Ga0495645_0634869
647 Ga0495622_0111379
648 Ga0495667_0006744
649 Ga0495634_0432310
650 Ga0495635_0004505
651 Ga0495635_0725108
652 Ga0495659_0073384
653 Ga0495588_0001415
654 Ga0495657_0015202
655 Ga0495599_0010839
656 Ga0495599_0013143
657 Ga0495623_0002993
658 Ga0495646_0051771
659 Ga0495646_0223831
660 Ga0495658_0001668
661 Ga0495613_0005287
662 Ga0495613_0137953
663 Ga0495613_0827863
664 Ga0495624_0341898
665 Ga0495600_0003030
666 Ga0495600_0040340
667 Ga0495600_0145211
668 Ga0495581_0000809
669 Ga0495581_0151274
670 Ga0495581_0758601
671 Ga0495604_0005420
672 Ga0495604_0075674
673 Ga0495674_0006248
674 Ga0495674_0026894
675 Ga0495680_0027329
676 Ga0495680_0182286
677 Ga0495675_0007997
678 Ga0495675_0156772
679 Ga0495684_0005933
680 Ga0495684_0082616
681 Ga0495684_0091913
682 Ga0495593_0002738
683 Ga0495602_0003786
684 Ga0495602_0094817
685 Ga0495614_0000708
686 Ga0496104_0073425
687 Ga0496105_0092303
688 Ga0496114_0851259
689 Ga0501298_072684
690 Ga0501033_0005653
691 Ga0501034_0003782
692 Ga0501036_0271651
693 Ga0501037_0112235
694 Ga0501038_0260644
695 Ga0501039_0213586
696 Ga0501043_0042806
697 Ga0501047_0092897
698 Ga0501048_0416251
699 Ga0501233_067386
700 Ga0501221_196664
701 Ga0501035_0034312
702 Ga0501044_0004890
703 nmdc:mga05p37_850572_c1
704 nmdc:mga0n895_1310598_c1
705 nmdc:mga0n895_23636_c1
706 Ga0495601_0019485
707 Ga0495601_0166955
708 Ga0495612_0006380
709 Ga0495595_0095236
710 Ga0495619_0012227

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03610

EIIA-man

PTS system fructose IIA component

16

126

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ipr-assembly1.cif.gz_A crystal structure of the enterococcus faecalis gluconate specific eiia phosphotransferase system component 0.8628 7 127
3gx1-assembly1.cif.gz_B crystal structure of a domain of lin1832 from listeria innocua 0.8338 3 122
4tkz-assembly3.cif.gz_F-3 crystal structure of phosphotransferase system component eiia from streptococcus agalactiae 0.8327 7 119
3mtq-assembly1.cif.gz_B crystal structure of a putative phosphoenolpyruvate-dependent sugar phosphotransferase system (pts) permease (kpn_04802) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.70 a resolution 0.8209 7 125
3lfh-assembly1.cif.gz_B crystal structure of manxa from thermoanaerobacter tengcongensis 0.8066 5 127
ID Description Score Start End Superfamily
3iprA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphotransferase system, mannose-type IIA component 0.8628 7 127 3.40.50.510
3lfhE00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphotransferase system, mannose-type IIA component 0.8542 7 127 3.40.50.510
4tkzD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphotransferase system, mannose-type IIA component 0.8384 7 119 3.40.50.510
af_P36881_1_135_3.40.50.510 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphotransferase system, mannose-type IIA component 0.8093 7 118 3.40.50.510
3mtqB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphotransferase system, mannose-type IIA component 0.8078 7 125 3.40.50.510
ID Description Score Start End GO Terms
AF-C1A8G0-F1-model_v4 Phosphotransferase system enzyme IIA component 0.9407 5 128 GO:0009401
GO:0016020
GO:0016740
AF-A0A838QBS1-F1-model_v4 PTS EIIA type-4 domain-containing protein 0.9376 5 130 GO:0009401
GO:0016020
GO:0016740
AF-A0A7V9ZFV2-F1-model_v4 PTS EIIA type-4 domain-containing protein 0.9343 2 129 GO:0009401
GO:0016020
GO:0016740
AF-A0A7W1SH27-F1-model_v4 PTS EIIA type-4 domain-containing protein 0.9316 4 130 GO:0009401
GO:0016020
GO:0016740
AF-X1QHW1-F1-model_v4 PTS EIIA type-4 domain-containing protein 0.9287 7 103 GO:0009401
GO:0016020
GO:0016740

Map