F420001

General Info

Members Datasets Scaffolds Average Seq Length
355 201 710 190

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100050334|Ga0070683_1000503342
Length 199
Sequence VTSDGVLPEDAGELAGEADSFGRLWTPHRLVYIKGENKPGHGEAGSECPFCFAPTRTDEAGLVIARGVLVYAVLNLYPYNAGHLMTVPYRHVADYDRLTAQESAELADFTQRSMRALRTAMAPHGFNIGLNQGVVAGAGIAAHLHQHVVPRWGGDTNFMPVVGHTRVLPQLLADTRDVIAAAWAAENAESAKTTHTAED

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
54 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
85 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
86 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
87 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
88 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
89 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
90 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
91 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
92 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
93 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
94 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
95 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
96 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
97 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
98 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
99 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
100 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
101 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
102 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
103 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
104 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
105 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
106 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
107 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
108 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
110 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
113 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
115 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
116 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
117 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
118 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
119 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
120 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
121 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
122 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
123 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
124 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
125 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
126 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
127 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
128 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
129 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
130 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
131 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
132 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
133 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
134 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
135 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
136 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
137 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
138 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
139 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
140 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
141 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
142 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
143 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
144 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
145 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
146 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
147 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
148 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
149 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
150 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
151 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
152 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
153 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
154 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
155 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
158 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
159 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
160 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
161 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
162 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
178 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
190 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
193 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
194 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
195 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
196 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
197 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
198 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
199 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
200 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
201 2576861822 Frankia sp. CeD Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.59
Metatranscriptomes 1.13
Isolates 0.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0.28
Rhizoplane 7.32
Rhizosphere 88.17
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100050334 3300005329 Bacteria 3856
2 Ga0070658_10121014 3300005327 Bacteria 2175
3 Ga0070658_10240602 3300005327 Bacteria 1534
4 Ga0070658_10265410 3300005327 Bacteria 1459
5 Ga0070658_10317621 3300005327 Bacteria 1330
6 Ga0070658_10782562 3300005327 Bacteria 829
7 Ga0070680_100000522 3300005336 Bacteria 26208
8 Ga0070668_100639333 3300005347 Bacteria 934
9 Ga0070674_100095811 3300005356 Bacteria 2152
10 Ga0070709_10197207 3300005434 Bacteria 1424
11 Ga0070714_100000898 3300005435 Bacteria 21103
12 Ga0070714_100002007 3300005435 Bacteria 14885
13 Ga0070713_100037381 3300005436 Bacteria 3925
14 Ga0070713_100384824 3300005436 Bacteria 1308
15 Ga0070713_100438554 3300005436 Bacteria 1225
16 Ga0070710_10010839 3300005437 Bacteria 4486
17 Ga0070711_100035883 3300005439 Bacteria 3319
18 Ga0070708_100450063 3300005445 Bacteria 1215
19 Ga0070708_100669051 3300005445 Bacteria 978
20 Ga0070681_10000013 3300005458 Bacteria 135004
21 Ga0070706_100008821 3300005467 Bacteria 9395
22 Ga0070706_100044706 3300005467 Bacteria 4091
23 Ga0070707_100001347 3300005468 Bacteria 24122
24 Ga0070707_100015657 3300005468 Bacteria 7118
25 Ga0070707_100255613 3300005468 Bacteria 1705
26 Ga0070698_100006398 3300005471 Bacteria 12784
27 Ga0070698_100375603 3300005471 Bacteria 1354
28 Ga0070679_100000006 3300005530 Bacteria 203959
29 Ga0070679_100533109 3300005530 Bacteria 1118
30 Ga0070684_100211477 3300005535 Bacteria 1768
31 Ga0070684_100268742 3300005535 Bacteria 1561
32 Ga0070697_100091320 3300005536 Bacteria 2518
33 Ga0070697_100686184 3300005536 Bacteria 903
34 Ga0068853_100170184 3300005539 Bacteria 1971
35 Ga0070695_100611599 3300005545 Bacteria 856
36 Ga0070696_100029775 3300005546 Bacteria 3735
37 Ga0070665_100354823 3300005548 Bacteria 1472
38 Ga0068855_100025042 3300005563 Bacteria 7142
39 Ga0068855_100037561 3300005563 Bacteria 5759
40 Ga0068855_100325793 3300005563 Bacteria 1697
41 Ga0068854_100004496 3300005578 Bacteria 8793
42 Ga0068856_100097519 3300005614 Bacteria 2929
43 Ga0068856_100142942 3300005614 Bacteria 2400
44 Ga0068856_100295512 3300005614 Bacteria 1637
45 Ga0068856_100731666 3300005614 Bacteria 1009
46 Ga0068852_101413390 3300005616 Bacteria 718
47 Ga0068864_100426871 3300005618 Bacteria 1264
48 Ga0068863_100649708 3300005841 Bacteria 1046
49 Ga0068858_100558818 3300005842 Bacteria 1108
50 Ga0081540_1001598 3300005983 Bacteria 19333
51 Ga0081540_1124814 3300005983 Bacteria 1061
52 Ga0070717_10106132 3300006028 Bacteria 2391
53 Ga0070717_10155154 3300006028 Bacteria 1983
54 Ga0070717_10250063 3300006028 Bacteria 1566
55 Ga0070717_10324465 3300006028 Bacteria 1372
56 Ga0070715_10000425 3300006163 Bacteria 10771
57 Ga0070716_100004610 3300006173 Bacteria 6608
58 Ga0070712_100020808 3300006175 Bacteria 4298
59 Ga0068871_100292796 3300006358 Bacteria 1427
60 Ga0075431_100460286 3300006847 Bacteria 1267
61 Ga0075433_10108528 3300006852 Bacteria 2462
62 Ga0075434_100072303 3300006871 Bacteria 3441
63 Ga0075435_100044328 3300007076 Bacteria 3562
64 Ga0075435_100067500 3300007076 Bacteria 2912
65 Ga0099794_10082460 3300007265 Bacteria 1587
66 Ga0105240_10054795 3300009093 Bacteria 4995
67 Ga0114129_10005485 3300009147 Bacteria 17929
68 Ga0105241_10012272 3300009174 Bacteria 6287
69 Ga0105241_10148484 3300009174 Bacteria 1915
70 Ga0105241_11129383 3300009174 Bacteria 739
71 Ga0105248_11080010 3300009177 Bacteria 907
72 Ga0105237_11365514 3300009545 Bacteria 715
73 Ga0105238_10055972 3300009551 Bacteria 3957
74 Ga0105238_12365885 3300009551 Bacteria 567
75 Ga0105239_10062807 3300010375 Bacteria 4077
76 Ga0105239_10425733 3300010375 Bacteria 1504
77 Ga0157374_10100135 3300013296 Bacteria 2777
78 Ga0157372_10711747 3300013307 Bacteria 1168
79 Ga0163163_10435727 3300014325 Bacteria 1370
80 Ga0206354_10833926 3300020081 Bacteria 1404
81 Ga0206353_10591309 3300020082 Bacteria 950
82 Ga0206353_11104211 3300020082 Bacteria 1246
83 Ga0213875_10001382 3300021388 Bacteria 15926
84 Ga0213875_10023170 3300021388 Bacteria 2965
85 Ga0207692_10039593 3300025898 Bacteria 2320
86 Ga0207692_10063868 3300025898 Bacteria 1915
87 Ga0207692_10186626 3300025898 Bacteria 1211
88 Ga0207647_10010264 3300025904 Bacteria 6617
89 Ga0207647_10205228 3300025904 Bacteria 1139
90 Ga0207685_10000487 3300025905 Bacteria 6730
91 Ga0207685_10004710 3300025905 Bacteria 3506
92 Ga0207699_10001207 3300025906 Bacteria 12252
93 Ga0207705_10202284 3300025909 Bacteria 1505
94 Ga0207705_10289761 3300025909 Bacteria 1254
95 Ga0207684_10019684 3300025910 Bacteria 5773
96 Ga0207684_10045100 3300025910 Bacteria 3740
97 Ga0207684_10230064 3300025910 Bacteria 1600
98 Ga0207654_10074980 3300025911 Bacteria 2020
99 Ga0207654_10076304 3300025911 Bacteria 2006
100 Ga0207654_10610412 3300025911 Bacteria 779
101 Ga0207707_10000101 3300025912 Bacteria 85659
102 Ga0207695_10002744 3300025913 Bacteria 25682
103 Ga0207671_10000482 3300025914 Bacteria 54151
104 Ga0207693_10006108 3300025915 Bacteria 9982
105 Ga0207663_10065202 3300025916 Bacteria 2327
106 Ga0207660_10000205 3300025917 Bacteria 37703
107 Ga0207660_10101159 3300025917 Bacteria 2153
108 Ga0207660_10516491 3300025917 Bacteria 970
109 Ga0207652_10000012 3300025921 Bacteria 235382
110 Ga0207652_10388056 3300025921 Bacteria 1260
111 Ga0207646_10191782 3300025922 Bacteria 1846
112 Ga0207646_10275195 3300025922 Bacteria 1521
113 Ga0207694_10002496 3300025924 Bacteria 14960
114 Ga0207700_10020612 3300025928 Bacteria 4482
115 Ga0207700_10032604 3300025928 Bacteria 3718
116 Ga0207700_10036099 3300025928 Bacteria 3566
117 Ga0207700_10049388 3300025928 Bacteria 3129
118 Ga0207700_10055851 3300025928 Bacteria 2969
119 Ga0207700_10225548 3300025928 Bacteria 1591
120 Ga0207664_10001833 3300025929 Bacteria 14021
121 Ga0207664_10012873 3300025929 Bacteria 5994
122 Ga0207664_10038331 3300025929 Bacteria 3716
123 Ga0207664_10058865 3300025929 Bacteria 3058
124 Ga0207664_10070450 3300025929 Bacteria 2814
125 Ga0207669_10079152 3300025937 Bacteria 2097
126 Ga0207665_10006359 3300025939 Bacteria 7836
127 Ga0207661_10069990 3300025944 Bacteria 2863
128 Ga0207667_10056273 3300025949 Bacteria 4132
129 Ga0207667_10141875 3300025949 Bacteria 2474
130 Ga0207667_10277629 3300025949 Bacteria 1712
131 Ga0207640_10054021 3300025981 Bacteria 2624
132 Ga0207639_10082168 3300026041 Bacteria 2553
133 Ga0207678_10191859 3300026067 Bacteria 1746
134 Ga0207678_10327870 3300026067 Bacteria 1318
135 Ga0207702_10073740 3300026078 Bacteria 2944
136 Ga0207702_10095798 3300026078 Bacteria 2609
137 Ga0207702_10268953 3300026078 Bacteria 1607
138 Ga0207674_10419847 3300026116 Bacteria 1292
139 Ga0207683_10447753 3300026121 Bacteria 1190
140 Ga0207698_10022736 3300026142 Bacteria 4366
141 Ga0268266_10346749 3300028379 Bacteria 1395
142 Ga0307511_10004418 3300030521 Bacteria 14354
143 Ga0307518_10063799 3300031838 Bacteria 2674
144 Ga0307411_10064140 3300032005 Bacteria 2458
145 Ga0373958_0096792 3300034819 Bacteria 687
146 Ga0373959_0004038 3300034820 Bacteria 2351
147 Ga0373938_0027159 3300034957 Bacteria 1202
148 Ga0373926_0003950 3300035083 Bacteria 4841
149 Ga0373926_0078627 3300035083 Bacteria 1217
150 Ga0373934_0077807 3300035086 Bacteria 1330
151 Ga0373944_0032225 3300035089 Bacteria 1582
152 Ga0373949_0027427 3300035090 Bacteria 1339
153 Ga0373923_0158870 3300035111 Bacteria 1030
154 Ga0373932_0029256 3300035112 Bacteria 1519
155 Ga0373936_0012853 3300035113 Bacteria 3191
156 Ga0373953_0000303 3300035117 Bacteria 13248
157 Ga0373953_0024277 3300035117 Bacteria 2304
158 Ga0373954_0040598 3300035118 Bacteria 2168
159 Ga0373954_0336238 3300035118 Bacteria 746
160 Ga0373956_0068412 3300035119 Bacteria 1617
161 Ga0373956_0368254 3300035119 Bacteria 685
162 Ga0373957_0009344 3300035120 Bacteria 3207
163 Ga0373957_0022212 3300035120 Bacteria 2259
164 Ga0373960_0018404 3300035121 Bacteria 1821
165 Ga0373943_0215992 3300035170 Bacteria 1066
166 Ga0373946_0061748 3300035171 Bacteria 1596
167 Ga0373946_0281562 3300035171 Bacteria 818
168 Ga0373955_0002756 3300035172 Bacteria 7709
169 Ga0373955_0003214 3300035172 Bacteria 7161
170 Ga0373955_0519002 3300035172 Bacteria 728
171 Ga0373962_0021633 3300035242 Bacteria 1698
172 Ga0373924_0004026 3300035410 Bacteria 5106
173 Ga0373924_0045804 3300035410 Bacteria 1799
174 Ga0373931_0162961 3300035691 Bacteria 1308
175 Ga0373935_0005917 3300035692 Bacteria 7249
176 Ga0373935_0198147 3300035692 Bacteria 1386
177 Ga0373933_0000085 3300035724 Bacteria 59115
178 Ga0373933_0026530 3300035724 Bacteria 3327
179 Ga0373933_0062039 3300035724 Bacteria 2256
180 Ga0373947_0000050 3300035725 Bacteria 59812
181 Ga0373937_0000197 3300036401 Bacteria 59124
182 Ga0373937_0011918 3300036401 Bacteria 7628
183 Ga0373937_0144302 3300036401 Bacteria 2228
184 Ga0372808_006257 3300036459 Bacteria 1599
185 Ga0373925_0199522 3300037068 Bacteria 1590
186 Ga0436364_0138040 3300037853 Bacteria 2624
187 Ga0436364_0303129 3300037853 Bacteria 102080
188 Ga0436364_0473490 3300037853 Bacteria 1100
189 Ga0436364_1061475 3300037853 Bacteria 18740
190 Ga0400485_22316 3300038735 Bacteria 100302
191 Ga0400486_11169 3300038742 Bacteria 23690
192 Ga0400489_12074 3300039093 Bacteria 1030
193 Ga0451853_0370065 3300041512 Bacteria 700
194 Ga0439449_0020850 3300042007 Bacteria 2455
195 Ga0466972_0002797 3300044658 Bacteria 8642
196 Ga0466966_0045381 3300044684 Bacteria 2810
197 Ga0466966_0160178 3300044684 Bacteria 1370
198 Ga0466961_0038978 3300044693 Bacteria 3047
199 Ga0466961_0045531 3300044693 Bacteria 2807
200 Ga0466961_0276855 3300044693 Bacteria 1027
201 Ga0466963_0101659 3300044694 Bacteria 1968
202 Ga0466971_0396485 3300044719 Bacteria 672
203 Ga0466970_0032403 3300044765 Bacteria 2761
204 Ga0466970_0149910 3300044765 Bacteria 1287
205 Ga0466970_0183741 3300044765 Bacteria 1160
206 Ga0466967_0056240 3300045976 Bacteria 3468
207 Ga0466967_0314400 3300045976 Bacteria 1509
208 Ga0495592_0000157 3300046454 Bacteria 59697
209 Ga0495592_0003869 3300046454 Bacteria 10831
210 Ga0495592_0021807 3300046454 Bacteria 4873
211 Ga0495592_0450566 3300046454 Bacteria 806
212 Ga0495629_0001951 3300046459 Bacteria 16079
213 Ga0495629_0106959 3300046459 Bacteria 1951
214 Ga0495651_0000115 3300046462 Bacteria 59129
215 Ga0495651_0000652 3300046462 Bacteria 26840
216 Ga0495651_0010823 3300046462 Bacteria 7013
217 Ga0495653_0017670 3300046463 Bacteria 5799
218 Ga0495653_0024309 3300046463 Bacteria 4884
219 Ga0495653_0129714 3300046463 Bacteria 1786
220 Ga0495582_0036736 3300046473 Bacteria 2694
221 Ga0495582_0186523 3300046473 Bacteria 1182
222 Ga0495662_0104185 3300046476 Bacteria 1388
223 Ga0495664_0006347 3300046477 Bacteria 6532
224 Ga0495664_0036974 3300046477 Bacteria 2880
225 Ga0495608_0000157 3300046511 Bacteria 48714
226 Ga0495608_0003802 3300046511 Bacteria 10852
227 Ga0495608_0010142 3300046511 Bacteria 6571
228 Ga0495618_0022505 3300046514 Bacteria 3892
229 Ga0495618_0097359 3300046514 Bacteria 1882
230 Ga0495628_0001288 3300046516 Bacteria 22971
231 Ga0495628_0003495 3300046516 Bacteria 14062
232 Ga0495628_0135468 3300046516 Bacteria 1882
233 Ga0495628_0346138 3300046516 Bacteria 1093
234 Ga0495630_0021616 3300046517 Bacteria 4750
235 Ga0495630_0154868 3300046517 Bacteria 1744
236 Ga0495630_0533298 3300046517 Bacteria 900
237 Ga0495644_0222474 3300046523 Bacteria 730
238 Ga0495666_0043686 3300046526 Bacteria 2164
239 Ga0495652_0001786 3300046529 Bacteria 22989
240 Ga0495652_0012524 3300046529 Bacteria 7647
241 Ga0495652_0016738 3300046529 Bacteria 6552
242 Ga0495652_0040809 3300046529 Bacteria 4010
243 Ga0495652_0209190 3300046529 Bacteria 1474
244 Ga0495652_0285173 3300046529 Bacteria 1207
245 Ga0495652_0503817 3300046529 Bacteria 839
246 Ga0495665_0343531 3300046531 Bacteria 760
247 Ga0495640_0014577 3300046533 Bacteria 5942
248 Ga0495640_0039477 3300046533 Bacteria 3311
249 Ga0495640_0379955 3300046533 Bacteria 869
250 Ga0495587_0000123 3300046536 Bacteria 59101
251 Ga0495587_0089344 3300046536 Bacteria 1781
252 Ga0495587_0176756 3300046536 Bacteria 1211
253 Ga0495645_0103645 3300046543 Bacteria 2021
254 Ga0495645_0266679 3300046543 Bacteria 1131
255 Ga0495667_0000107 3300046559 Bacteria 60366
256 Ga0495667_0001101 3300046559 Bacteria 17563
257 Ga0495667_0001144 3300046559 Bacteria 17295
258 Ga0495667_0056895 3300046559 Bacteria 2571
259 Ga0495667_0172868 3300046559 Bacteria 1388
260 Ga0495635_0016512 3300046663 Bacteria 5157
261 Ga0495635_0039025 3300046663 Bacteria 3287
262 Ga0495657_0000169 3300046675 Bacteria 59112
263 Ga0495657_0010061 3300046675 Bacteria 7130
264 Ga0495657_0013679 3300046675 Bacteria 5977
265 Ga0495599_0000129 3300046678 Bacteria 48682
266 Ga0495599_0026023 3300046678 Bacteria 3665
267 Ga0495599_0158304 3300046678 Bacteria 1400
268 Ga0495623_0001867 3300046679 Bacteria 14124
269 Ga0495623_0026096 3300046679 Bacteria 3763
270 Ga0495623_0430371 3300046679 Bacteria 706
271 Ga0495646_0051634 3300046680 Bacteria 2487
272 Ga0495646_0088998 3300046680 Bacteria 1787
273 Ga0495647_0009248 3300046681 Bacteria 3332
274 Ga0495658_0066276 3300046683 Bacteria 2085
275 Ga0495624_0046845 3300046690 Bacteria 2748
276 Ga0495600_0002001 3300046809 Bacteria 11462
277 Ga0495600_0007391 3300046809 Bacteria 6720
278 Ga0495600_0146790 3300046809 Bacteria 1528
279 Ga0495604_0000161 3300047317 Bacteria 59093
280 Ga0495604_0023649 3300047317 Bacteria 4903
281 Ga0495604_0505488 3300047317 Bacteria 783
282 Ga0495674_0006238 3300047319 Bacteria 11437
283 Ga0495674_0071690 3300047319 Bacteria 2989
284 Ga0495676_0137789 3300047321 Bacteria 1752
285 Ga0495680_0026272 3300047322 Bacteria 4803
286 Ga0495680_0043713 3300047322 Bacteria 3545
287 Ga0495675_0002198 3300047444 Bacteria 11629
288 Ga0495675_0010382 3300047444 Bacteria 5820
289 Ga0495675_0077023 3300047444 Bacteria 2101
290 Ga0495593_0008660 3300047673 Bacteria 5914
291 Ga0495602_0000182 3300048088 Bacteria 59124
292 Ga0495602_0032842 3300048088 Bacteria 4880
293 Ga0495614_0047553 3300048089 Bacteria 1840
294 Ga0496102_0002211 3300048905 Bacteria 16707
295 Ga0496102_0071122 3300048905 Bacteria 3194
296 Ga0496103_0099054 3300048906 Bacteria 1844
297 Ga0496103_0238406 3300048906 Bacteria 1170
298 Ga0496103_0393583 3300048906 Bacteria 890
299 Ga0496104_0000697 3300048907 Bacteria 28910
300 Ga0496104_0020892 3300048907 Bacteria 6004
301 Ga0496104_0499436 3300048907 Bacteria 1128
302 Ga0496105_0002128 3300048908 Bacteria 14351
303 Ga0496105_0041550 3300048908 Bacteria 3790
304 Ga0496106_0034406 3300048909 Bacteria 3783
305 Ga0496107_0108949 3300048910 Bacteria 2034
306 Ga0496108_0076270 3300048911 Bacteria 2833
307 Ga0496108_0084743 3300048911 Bacteria 2690
308 Ga0496109_0034530 3300048912 Bacteria 4556
309 Ga0496109_0069528 3300048912 Bacteria 3229
310 Ga0496110_0062807 3300048913 Bacteria 3281
311 Ga0496110_0108297 3300048913 Bacteria 2495
312 Ga0496111_0234810 3300048914 Bacteria 1362
313 Ga0496112_0029145 3300048915 Bacteria 5336
314 Ga0496112_0092050 3300048915 Bacteria 3001
315 Ga0496113_0007486 3300048916 Bacteria 7031
316 Ga0496113_0111482 3300048916 Bacteria 2130
317 Ga0496114_0024584 3300048917 Bacteria 4918
318 Ga0496114_0183459 3300048917 Bacteria 1828
319 Ga0496115_0060892 3300048918 Bacteria 3042
320 Ga0496126_0572844 3300048929 Bacteria 893
321 Ga0501031_0005527 3300049568 Bacteria 8232
322 Ga0501032_0015841 3300049569 Bacteria 5315
323 Ga0501033_0103076 3300049570 Bacteria 2081
324 Ga0501034_0087926 3300049571 Bacteria 3106
325 Ga0501038_0023168 3300049574 Bacteria 5555
326 Ga0501039_0242437 3300049575 Bacteria 1417
327 Ga0501043_0297331 3300049579 Bacteria 1234
328 Ga0501047_0005218 3300049581 Bacteria 12196
329 Ga0501048_0000032 3300049582 Bacteria 65543
330 Ga0501067_0455927 3300049583 Bacteria 714
331 Ga0501070_0037132 3300049586 Bacteria 4067
332 Ga0501070_0370402 3300049586 Bacteria 1161
333 Ga0501081_0014216 3300049743 Bacteria 5249
334 Ga0501035_0009100 3300049822 Bacteria 9234
335 Ga0501044_0016159 3300049823 Bacteria 8023
336 nmdc:mga05p37_48861_c1 3300050507 Bacteria 5203
337 nmdc:mga0n895_221133_c1 3300050512 Bacteria 1923
338 nmdc:mga0rr50_101306_c1 3300050513 Bacteria 2264
339 nmdc:mga0rr50_153577_c1 3300050513 Bacteria 1863
340 nmdc:mga0rr50_89483_c1 3300050513 Bacteria 2394
341 nmdc:mga08x19_171064_c1 3300050514 Bacteria 1480
342 nmdc:mga08x19_63405_c1 3300050514 Bacteria 2398
343 nmdc:mga0a205_179146_c1 3300050515 Bacteria 2014
344 nmdc:mga0a205_458931_c1 3300050515 Bacteria 1134
345 Ga0495601_0057868 3300053077 Bacteria 2455
346 Ga0495601_0114159 3300053077 Bacteria 1751
347 Ga0495601_0146122 3300053077 Bacteria 1543
348 Ga0495601_0157712 3300053077 Bacteria 1482
349 Ga0495595_0016630 3300053084 Bacteria 3152
350 Ga0495595_0050788 3300053084 Bacteria 1921
351 Ga0495619_0071282 3300053085 Bacteria 2325
352 Ga0495619_0147075 3300053085 Bacteria 1625
353 Ga0495619_0391474 3300053085 Bacteria 960
354 Ga0500573_0037774 3300053140 Bacteria 2791
355 2579748054 2576861822 Bacteria 5004595
356 Ga0070683_100050334
357 Ga0070658_10121014
358 Ga0070658_10240602
359 Ga0070658_10265410
360 Ga0070658_10317621
361 Ga0070658_10782562
362 Ga0070680_100000522
363 Ga0070668_100639333
364 Ga0070674_100095811
365 Ga0070709_10197207
366 Ga0070714_100000898
367 Ga0070714_100002007
368 Ga0070713_100037381
369 Ga0070713_100384824
370 Ga0070713_100438554
371 Ga0070710_10010839
372 Ga0070711_100035883
373 Ga0070708_100450063
374 Ga0070708_100669051
375 Ga0070681_10000013
376 Ga0070706_100008821
377 Ga0070706_100044706
378 Ga0070707_100001347
379 Ga0070707_100015657
380 Ga0070707_100255613
381 Ga0070698_100006398
382 Ga0070698_100375603
383 Ga0070679_100000006
384 Ga0070679_100533109
385 Ga0070684_100211477
386 Ga0070684_100268742
387 Ga0070697_100091320
388 Ga0070697_100686184
389 Ga0068853_100170184
390 Ga0070695_100611599
391 Ga0070696_100029775
392 Ga0070665_100354823
393 Ga0068855_100025042
394 Ga0068855_100037561
395 Ga0068855_100325793
396 Ga0068854_100004496
397 Ga0068856_100097519
398 Ga0068856_100142942
399 Ga0068856_100295512
400 Ga0068856_100731666
401 Ga0068852_101413390
402 Ga0068864_100426871
403 Ga0068863_100649708
404 Ga0068858_100558818
405 Ga0081540_1001598
406 Ga0081540_1124814
407 Ga0070717_10106132
408 Ga0070717_10155154
409 Ga0070717_10250063
410 Ga0070717_10324465
411 Ga0070715_10000425
412 Ga0070716_100004610
413 Ga0070712_100020808
414 Ga0068871_100292796
415 Ga0075431_100460286
416 Ga0075433_10108528
417 Ga0075434_100072303
418 Ga0075435_100044328
419 Ga0075435_100067500
420 Ga0099794_10082460
421 Ga0105240_10054795
422 Ga0114129_10005485
423 Ga0105241_10012272
424 Ga0105241_10148484
425 Ga0105241_11129383
426 Ga0105248_11080010
427 Ga0105237_11365514
428 Ga0105238_10055972
429 Ga0105238_12365885
430 Ga0105239_10062807
431 Ga0105239_10425733
432 Ga0157374_10100135
433 Ga0157372_10711747
434 Ga0163163_10435727
435 Ga0206354_10833926
436 Ga0206353_10591309
437 Ga0206353_11104211
438 Ga0213875_10001382
439 Ga0213875_10023170
440 Ga0207692_10039593
441 Ga0207692_10063868
442 Ga0207692_10186626
443 Ga0207647_10010264
444 Ga0207647_10205228
445 Ga0207685_10000487
446 Ga0207685_10004710
447 Ga0207699_10001207
448 Ga0207705_10202284
449 Ga0207705_10289761
450 Ga0207684_10019684
451 Ga0207684_10045100
452 Ga0207684_10230064
453 Ga0207654_10074980
454 Ga0207654_10076304
455 Ga0207654_10610412
456 Ga0207707_10000101
457 Ga0207695_10002744
458 Ga0207671_10000482
459 Ga0207693_10006108
460 Ga0207663_10065202
461 Ga0207660_10000205
462 Ga0207660_10101159
463 Ga0207660_10516491
464 Ga0207652_10000012
465 Ga0207652_10388056
466 Ga0207646_10191782
467 Ga0207646_10275195
468 Ga0207694_10002496
469 Ga0207700_10020612
470 Ga0207700_10032604
471 Ga0207700_10036099
472 Ga0207700_10049388
473 Ga0207700_10055851
474 Ga0207700_10225548
475 Ga0207664_10001833
476 Ga0207664_10012873
477 Ga0207664_10038331
478 Ga0207664_10058865
479 Ga0207664_10070450
480 Ga0207669_10079152
481 Ga0207665_10006359
482 Ga0207661_10069990
483 Ga0207667_10056273
484 Ga0207667_10141875
485 Ga0207667_10277629
486 Ga0207640_10054021
487 Ga0207639_10082168
488 Ga0207678_10191859
489 Ga0207678_10327870
490 Ga0207702_10073740
491 Ga0207702_10095798
492 Ga0207702_10268953
493 Ga0207674_10419847
494 Ga0207683_10447753
495 Ga0207698_10022736
496 Ga0268266_10346749
497 Ga0307511_10004418
498 Ga0307518_10063799
499 Ga0307411_10064140
500 Ga0373958_0096792
501 Ga0373959_0004038
502 Ga0373938_0027159
503 Ga0373926_0003950
504 Ga0373926_0078627
505 Ga0373934_0077807
506 Ga0373944_0032225
507 Ga0373949_0027427
508 Ga0373923_0158870
509 Ga0373932_0029256
510 Ga0373936_0012853
511 Ga0373953_0000303
512 Ga0373953_0024277
513 Ga0373954_0040598
514 Ga0373954_0336238
515 Ga0373956_0068412
516 Ga0373956_0368254
517 Ga0373957_0009344
518 Ga0373957_0022212
519 Ga0373960_0018404
520 Ga0373943_0215992
521 Ga0373946_0061748
522 Ga0373946_0281562
523 Ga0373955_0002756
524 Ga0373955_0003214
525 Ga0373955_0519002
526 Ga0373962_0021633
527 Ga0373924_0004026
528 Ga0373924_0045804
529 Ga0373931_0162961
530 Ga0373935_0005917
531 Ga0373935_0198147
532 Ga0373933_0000085
533 Ga0373933_0026530
534 Ga0373933_0062039
535 Ga0373947_0000050
536 Ga0373937_0000197
537 Ga0373937_0011918
538 Ga0373937_0144302
539 Ga0372808_006257
540 Ga0373925_0199522
541 Ga0436364_0138040
542 Ga0436364_0303129
543 Ga0436364_0473490
544 Ga0436364_1061475
545 Ga0400485_22316
546 Ga0400486_11169
547 Ga0400489_12074
548 Ga0451853_0370065
549 Ga0439449_0020850
550 Ga0466972_0002797
551 Ga0466966_0045381
552 Ga0466966_0160178
553 Ga0466961_0038978
554 Ga0466961_0045531
555 Ga0466961_0276855
556 Ga0466963_0101659
557 Ga0466971_0396485
558 Ga0466970_0032403
559 Ga0466970_0149910
560 Ga0466970_0183741
561 Ga0466967_0056240
562 Ga0466967_0314400
563 Ga0495592_0000157
564 Ga0495592_0003869
565 Ga0495592_0021807
566 Ga0495592_0450566
567 Ga0495629_0001951
568 Ga0495629_0106959
569 Ga0495651_0000115
570 Ga0495651_0000652
571 Ga0495651_0010823
572 Ga0495653_0017670
573 Ga0495653_0024309
574 Ga0495653_0129714
575 Ga0495582_0036736
576 Ga0495582_0186523
577 Ga0495662_0104185
578 Ga0495664_0006347
579 Ga0495664_0036974
580 Ga0495608_0000157
581 Ga0495608_0003802
582 Ga0495608_0010142
583 Ga0495618_0022505
584 Ga0495618_0097359
585 Ga0495628_0001288
586 Ga0495628_0003495
587 Ga0495628_0135468
588 Ga0495628_0346138
589 Ga0495630_0021616
590 Ga0495630_0154868
591 Ga0495630_0533298
592 Ga0495644_0222474
593 Ga0495666_0043686
594 Ga0495652_0001786
595 Ga0495652_0012524
596 Ga0495652_0016738
597 Ga0495652_0040809
598 Ga0495652_0209190
599 Ga0495652_0285173
600 Ga0495652_0503817
601 Ga0495665_0343531
602 Ga0495640_0014577
603 Ga0495640_0039477
604 Ga0495640_0379955
605 Ga0495587_0000123
606 Ga0495587_0089344
607 Ga0495587_0176756
608 Ga0495645_0103645
609 Ga0495645_0266679
610 Ga0495667_0000107
611 Ga0495667_0001101
612 Ga0495667_0001144
613 Ga0495667_0056895
614 Ga0495667_0172868
615 Ga0495635_0016512
616 Ga0495635_0039025
617 Ga0495657_0000169
618 Ga0495657_0010061
619 Ga0495657_0013679
620 Ga0495599_0000129
621 Ga0495599_0026023
622 Ga0495599_0158304
623 Ga0495623_0001867
624 Ga0495623_0026096
625 Ga0495623_0430371
626 Ga0495646_0051634
627 Ga0495646_0088998
628 Ga0495647_0009248
629 Ga0495658_0066276
630 Ga0495624_0046845
631 Ga0495600_0002001
632 Ga0495600_0007391
633 Ga0495600_0146790
634 Ga0495604_0000161
635 Ga0495604_0023649
636 Ga0495604_0505488
637 Ga0495674_0006238
638 Ga0495674_0071690
639 Ga0495676_0137789
640 Ga0495680_0026272
641 Ga0495680_0043713
642 Ga0495675_0002198
643 Ga0495675_0010382
644 Ga0495675_0077023
645 Ga0495593_0008660
646 Ga0495602_0000182
647 Ga0495602_0032842
648 Ga0495614_0047553
649 Ga0496102_0002211
650 Ga0496102_0071122
651 Ga0496103_0099054
652 Ga0496103_0238406
653 Ga0496103_0393583
654 Ga0496104_0000697
655 Ga0496104_0020892
656 Ga0496104_0499436
657 Ga0496105_0002128
658 Ga0496105_0041550
659 Ga0496106_0034406
660 Ga0496107_0108949
661 Ga0496108_0076270
662 Ga0496108_0084743
663 Ga0496109_0034530
664 Ga0496109_0069528
665 Ga0496110_0062807
666 Ga0496110_0108297
667 Ga0496111_0234810
668 Ga0496112_0029145
669 Ga0496112_0092050
670 Ga0496113_0007486
671 Ga0496113_0111482
672 Ga0496114_0024584
673 Ga0496114_0183459
674 Ga0496115_0060892
675 Ga0496126_0572844
676 Ga0501031_0005527
677 Ga0501032_0015841
678 Ga0501033_0103076
679 Ga0501034_0087926
680 Ga0501038_0023168
681 Ga0501039_0242437
682 Ga0501043_0297331
683 Ga0501047_0005218
684 Ga0501048_0000032
685 Ga0501067_0455927
686 Ga0501070_0037132
687 Ga0501070_0370402
688 Ga0501081_0014216
689 Ga0501035_0009100
690 Ga0501044_0016159
691 nmdc:mga05p37_48861_c1
692 nmdc:mga0n895_221133_c1
693 nmdc:mga0rr50_101306_c1
694 nmdc:mga0rr50_153577_c1
695 nmdc:mga0rr50_89483_c1
696 nmdc:mga08x19_171064_c1
697 nmdc:mga08x19_63405_c1
698 nmdc:mga0a205_179146_c1
699 nmdc:mga0a205_458931_c1
700 Ga0495601_0057868
701 Ga0495601_0114159
702 Ga0495601_0146122
703 Ga0495601_0157712
704 Ga0495595_0016630
705 Ga0495595_0050788
706 Ga0495619_0071282
707 Ga0495619_0147075
708 Ga0495619_0391474
709 Ga0500573_0037774
710 2579748054

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01230

HIT

HIT domain

57

154

0.93

PF04677

CwfJ_C_1

Protein similar to CwfJ C-terminus 1

35

124

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6af2-assembly1.cif.gz_A crystal structure of n-terminus deletion mutant of mycobacterium avium diadenosine 5',5'''-p1,p4-tetraphosphate phosphorylase 0.8566 59 189
5cs2-assembly1.cif.gz_A-2 crystal structure of plasmodium falciparum diadenosine triphosphate hydrolase in complex with cyclomarin a 0.8483 62 187
1ems-assembly1.cif.gz_A crystal structure of the c. elegans nitfhit protein 0.8333 69 188
6af2-assembly1.cif.gz_C crystal structure of n-terminus deletion mutant of mycobacterium avium diadenosine 5',5'''-p1,p4-tetraphosphate phosphorylase 0.8264 53 189
6af2-assembly1.cif.gz_D-2 crystal structure of n-terminus deletion mutant of mycobacterium avium diadenosine 5',5'''-p1,p4-tetraphosphate phosphorylase 0.8254 53 189
ID Description Score Start End Superfamily
af_A0A140LH01_2_105_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8724 66 158 3.30.428.10
af_Q0IQH7_1_86_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8708 89 162 3.30.428.10
af_P49775_3_108_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8561 68 159 3.30.428.10
1emsB02 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.843 68 187 3.30.428.10
2fhiA00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8142 62 187 3.30.428.10
ID Description Score Start End GO Terms
AF-A0A140LH01-F1-model_v4 deleted 0.8673 62 159
AF-A0A434TNX9-F1-model_v4 HIT family protein 0.8636 68 162 GO:0003824
AF-A0A1D7VY78-F1-model_v4 HIT domain-containing protein 0.8619 71 162 GO:0003824
AF-A0A5B8XXU3-F1-model_v4 HIT domain-containing protein 0.8613 68 162 GO:0003677
GO:0005524
GO:0005829
GO:0016787
AF-A0A356AAD9-F1-model_v4 deleted 0.8599 52 162

Map