F419008

General Info

Members Datasets Scaffolds Average Seq Length
352 193 704 206

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10245251|Ga0105237_102452511
Length 221
Sequence MDSNRRYYSKEIYMKRHVALAILTLSAIAPLLAQAPKGWKMRVDRSTQASDPDAPGDIKFVTEGSGFHATNPQAAIYYNPANTASGTYTLKGTFTLMKPSGHNNYYGLVFGGSGLEGAQQSYLYFVIAQNGTWLIKSRNGDATATVAPKTPNDAVKKPGADGKSTNELEVRVGADKVDFVVNGAVVHSEPKTGALAKTDGIYGIRVNHLLEVQIDGLSVSK

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
126 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
127 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
128 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
129 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
130 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
131 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
132 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
133 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
134 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
135 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
136 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
137 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
138 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
139 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
140 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
141 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
144 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
148 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
149 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
150 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
151 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
152 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
153 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
154 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
155 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
156 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
157 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
158 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
159 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
160 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
161 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
162 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
163 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
164 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
165 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
166 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
167 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
168 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
169 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
170 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
171 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
172 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
173 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
174 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
175 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
176 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
177 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
178 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
179 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
180 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
188 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
189 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
190 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
191 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
192 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
193 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.42
Rhizosphere 98.58
Stem 0
Stem Tuber 0
Unclassified 31.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_10245251 3300009545 Bacteria 1793
2 JGI25406J46586_10096764 3300003203 Unclassified 884
3 Ga0070658_10003305 3300005327 Bacteria 13299
4 Ga0070658_10136364 3300005327 Bacteria 2048
5 Ga0070676_10034504 3300005328 Bacteria 2905
6 Ga0070683_100008576 3300005329 Bacteria 8689
7 Ga0070683_100243264 3300005329 Unclassified 1711
8 Ga0070683_100366425 3300005329 Unclassified 1372
9 Ga0070683_100848203 3300005329 Unclassified 876
10 Ga0070690_100291068 3300005330 Unclassified 1168
11 Ga0070670_100669322 3300005331 Bacteria 932
12 Ga0070666_10122348 3300005335 Bacteria 1805
13 Ga0068868_100005070 3300005338 Bacteria 9248
14 Ga0068868_100110266 3300005338 Unclassified 2235
15 Ga0070660_100014691 3300005339 Bacteria 5648
16 Ga0070691_10030782 3300005341 Bacteria 2514
17 Ga0070669_100143251 3300005353 Bacteria 1844
18 Ga0070669_100810772 3300005353 Unclassified 796
19 Ga0070675_100004379 3300005354 Bacteria 10773
20 Ga0070671_100198366 3300005355 Unclassified 1702
21 Ga0070673_100474072 3300005364 Unclassified 1129
22 Ga0070688_100127175 3300005365 Unclassified 1714
23 Ga0070688_100207065 3300005365 Bacteria 1375
24 Ga0070667_100629895 3300005367 Unclassified 989
25 Ga0070714_100161569 3300005435 Unclassified 2027
26 Ga0070714_100176763 3300005435 Bacteria 1940
27 Ga0070713_100036784 3300005436 Bacteria 3954
28 Ga0070701_10095849 3300005438 Bacteria 1635
29 Ga0070705_100008373 3300005440 Bacteria 5121
30 Ga0070694_100040072 3300005444 Bacteria 3121
31 Ga0070694_100099868 3300005444 Bacteria 2052
32 Ga0070678_100655090 3300005456 Unclassified 942
33 Ga0070678_101102924 3300005456 Unclassified 733
34 Ga0070681_10322007 3300005458 Unclassified 1455
35 Ga0068867_100115913 3300005459 Bacteria 2064
36 Ga0068867_100116835 3300005459 Bacteria 2056
37 Ga0068867_100614834 3300005459 Unclassified 949
38 Ga0070706_100613544 3300005467 Unclassified 1011
39 Ga0070707_100282813 3300005468 Bacteria 1612
40 Ga0070707_100660377 3300005468 Bacteria 1008
41 Ga0070699_100175298 3300005518 Unclassified 1901
42 Ga0070699_100213377 3300005518 Bacteria 1719
43 Ga0070684_100065456 3300005535 Bacteria 3190
44 Ga0068853_100292326 3300005539 Bacteria 1504
45 Ga0068853_100323481 3300005539 Unclassified 1430
46 Ga0068853_101076803 3300005539 Unclassified 775
47 Ga0070686_100124538 3300005544 Unclassified 1774
48 Ga0070695_100052217 3300005545 Bacteria 2626
49 Ga0070696_100572177 3300005546 Unclassified 908
50 Ga0070665_100002821 3300005548 Bacteria 18813
51 Ga0070665_100253449 3300005548 Unclassified 1761
52 Ga0070665_100460286 3300005548 Bacteria 1282
53 Ga0070704_100043820 3300005549 Bacteria 3104
54 Ga0068855_100122652 3300005563 Bacteria 2973
55 Ga0068855_100254566 3300005563 Bacteria 1958
56 Ga0068855_100270892 3300005563 Unclassified 1888
57 Ga0068854_100356501 3300005578 Unclassified 1199
58 Ga0070702_100014186 3300005615 Bacteria 4039
59 Ga0068852_100580480 3300005616 Bacteria 1124
60 Ga0068859_100348268 3300005617 Bacteria 1576
61 Ga0068859_101348389 3300005617 Unclassified 786
62 Ga0068864_100025067 3300005618 Bacteria 5020
63 Ga0068866_10012127 3300005718 Bacteria 3751
64 Ga0068861_100051608 3300005719 Bacteria 3122
65 Ga0068861_100392752 3300005719 Bacteria 1229
66 Ga0068863_100005298 3300005841 Bacteria 12732
67 Ga0068863_100085376 3300005841 Unclassified 2991
68 Ga0068863_100249769 3300005841 Bacteria 1713
69 Ga0068858_100045426 3300005842 Unclassified 4071
70 Ga0068858_100083902 3300005842 Unclassified 2963
71 Ga0068858_100084299 3300005842 Unclassified 2956
72 Ga0068858_100835911 3300005842 Unclassified 899
73 Ga0068858_100934056 3300005842 Bacteria 849
74 Ga0068860_100159295 3300005843 Unclassified 2176
75 Ga0068860_100529342 3300005843 Bacteria 1179
76 Ga0068860_101064099 3300005843 Bacteria 828
77 Ga0068862_100167712 3300005844 Unclassified 1964
78 Ga0081539_10013793 3300005985 Bacteria 6052
79 Ga0070717_10299806 3300006028 Bacteria 1429
80 Ga0070716_100130485 3300006173 Unclassified 1588
81 Ga0097621_100012891 3300006237 Bacteria 6212
82 Ga0097621_100054075 3300006237 Bacteria 3273
83 Ga0097621_100110632 3300006237 Unclassified 2321
84 Ga0097621_100203707 3300006237 Unclassified 1719
85 Ga0097621_100214678 3300006237 Bacteria 1674
86 Ga0068871_100010705 3300006358 Bacteria 6707
87 Ga0068871_100029199 3300006358 Bacteria 4329
88 Ga0068871_100113738 3300006358 Bacteria 2279
89 Ga0068871_100180259 3300006358 Bacteria 1815
90 Ga0068871_100405445 3300006358 Unclassified 1215
91 Ga0075433_10062884 3300006852 Bacteria 3251
92 Ga0075434_100005979 3300006871 Bacteria 11138
93 Ga0075434_100011566 3300006871 Bacteria 8331
94 Ga0075434_100369839 3300006871 Bacteria 1454
95 Ga0068865_100078515 3300006881 Unclassified 2361
96 Ga0068865_100818017 3300006881 Bacteria 805
97 Ga0075436_100045964 3300006914 Unclassified 3012
98 Ga0097620_100348257 3300006931 Bacteria 1576
99 Ga0097620_101348466 3300006931 Unclassified 786
100 Ga0075435_100000904 3300007076 Bacteria 18681
101 Ga0075435_100144220 3300007076 Bacteria 1999
102 Ga0105240_10001208 3300009093 Bacteria 45048
103 Ga0105240_10058088 3300009093 Bacteria 4830
104 Ga0105240_10060885 3300009093 Bacteria 4705
105 Ga0105240_10072133 3300009093 Bacteria 4269
106 Ga0105240_10118615 3300009093 Unclassified 3188
107 Ga0105240_10227715 3300009093 Bacteria 2168
108 Ga0105240_10353458 3300009093 Bacteria 1666
109 Ga0105240_11037723 3300009093 Unclassified 875
110 Ga0111539_10002920 3300009094 Bacteria 22673
111 Ga0105245_10006323 3300009098 Bacteria 10422
112 Ga0105245_10018265 3300009098 Bacteria 6132
113 Ga0105247_10068660 3300009101 Bacteria 2210
114 Ga0114129_10052605 3300009147 Bacteria 5716
115 Ga0105243_10011944 3300009148 Bacteria 6565
116 Ga0105243_10144458 3300009148 Unclassified 2034
117 Ga0105243_10576955 3300009148 Bacteria 1079
118 Ga0105241_10038482 3300009174 Bacteria 3605
119 Ga0105241_10111924 3300009174 Unclassified 2186
120 Ga0105241_10343888 3300009174 Unclassified 1293
121 Ga0105242_10010996 3300009176 Bacteria 6953
122 Ga0105242_10244531 3300009176 Bacteria 1614
123 Ga0105242_10374510 3300009176 Unclassified 1322
124 Ga0105242_10461789 3300009176 Unclassified 1199
125 Ga0105248_10005851 3300009177 Bacteria 13514
126 Ga0105248_10025445 3300009177 Bacteria 6581
127 Ga0105248_10066990 3300009177 Unclassified 4031
128 Ga0105248_10151726 3300009177 Bacteria 2614
129 Ga0105248_10240361 3300009177 Unclassified 2038
130 Ga0105248_10300156 3300009177 Bacteria 1809
131 Ga0105248_11005035 3300009177 Bacteria 942
132 Ga0105237_10018340 3300009545 Bacteria 7243
133 Ga0105238_10001376 3300009551 Bacteria 24368
134 Ga0105238_10008176 3300009551 Bacteria 10464
135 Ga0105238_10201781 3300009551 Bacteria 1964
136 Ga0105238_10383463 3300009551 Bacteria 1397
137 Ga0105249_10461831 3300009553 Bacteria 1310
138 Ga0105249_10598899 3300009553 Bacteria 1157
139 Ga0105239_10335782 3300010375 Unclassified 1705
140 Ga0105239_10478998 3300010375 Bacteria 1414
141 Ga0105246_10269694 3300011119 Bacteria 1360
142 Ga0157373_10349304 3300013100 Unclassified 1055
143 Ga0157370_10004779 3300013104 Bacteria 15409
144 Ga0157369_10033890 3300013105 Bacteria 5608
145 Ga0157369_10172285 3300013105 Bacteria 2280
146 Ga0157374_10094465 3300013296 Bacteria 2858
147 Ga0157374_10096579 3300013296 Bacteria 2826
148 Ga0157374_10259203 3300013296 Bacteria 1712
149 Ga0157378_10025693 3300013297 Bacteria 5187
150 Ga0157378_10099884 3300013297 Bacteria 2648
151 Ga0163162_10002688 3300013306 Bacteria 16860
152 Ga0163162_10195988 3300013306 Unclassified 2149
153 Ga0163162_10508419 3300013306 Bacteria 1335
154 Ga0157372_10428468 3300013307 Unclassified 1542
155 Ga0157375_10018508 3300013308 Bacteria 6319
156 Ga0157375_10546233 3300013308 Unclassified 1321
157 Ga0157375_10979484 3300013308 Bacteria 986
158 Ga0163163_10034291 3300014325 Bacteria 4913
159 Ga0163163_10231988 3300014325 Unclassified 1895
160 Ga0163163_10298157 3300014325 Bacteria 1664
161 Ga0157380_10111874 3300014326 Bacteria 2296
162 Ga0157380_10363773 3300014326 Bacteria 1358
163 Ga0157377_10273759 3300014745 Bacteria 1104
164 Ga0157379_10009455 3300014968 Bacteria 8495
165 Ga0157379_10025264 3300014968 Bacteria 5275
166 Ga0157379_11082071 3300014968 Unclassified 767
167 Ga0157376_10189031 3300014969 Unclassified 1887
168 Ga0157376_10191222 3300014969 Bacteria 1877
169 Ga0157376_10335360 3300014969 Bacteria 1442
170 Ga0157376_10901151 3300014969 Unclassified 902
171 Ga0207685_10278743 3300025905 Bacteria 819
172 Ga0207645_10008506 3300025907 Bacteria 7158
173 Ga0207645_10125652 3300025907 Bacteria 1667
174 Ga0207643_10427278 3300025908 Bacteria 840
175 Ga0207707_10488844 3300025912 Unclassified 1051
176 Ga0207695_10018300 3300025913 Bacteria 8105
177 Ga0207695_10034833 3300025913 Bacteria 5469
178 Ga0207695_10047497 3300025913 Bacteria 4542
179 Ga0207695_10059203 3300025913 Bacteria 3973
180 Ga0207695_10090818 3300025913 Unclassified 3069
181 Ga0207695_10431023 3300025913 Bacteria 1202
182 Ga0207671_10024450 3300025914 Bacteria 4542
183 Ga0207657_10001567 3300025919 Bacteria 24544
184 Ga0207646_10128552 3300025922 Bacteria 2279
185 Ga0207681_10290318 3300025923 Unclassified 1291
186 Ga0207681_10631640 3300025923 Bacteria 887
187 Ga0207694_10013023 3300025924 Bacteria 6262
188 Ga0207694_10130108 3300025924 Bacteria 2017
189 Ga0207694_10456799 3300025924 Bacteria 1067
190 Ga0207659_10027147 3300025926 Bacteria 3872
191 Ga0207659_10148677 3300025926 Unclassified 1827
192 Ga0207687_10287077 3300025927 Bacteria 1321
193 Ga0207700_10016635 3300025928 Unclassified 4892
194 Ga0207700_10783361 3300025928 Bacteria 853
195 Ga0207664_10155107 3300025929 Unclassified 1949
196 Ga0207664_10850560 3300025929 Bacteria 820
197 Ga0207644_10380406 3300025931 Archaea 1151
198 Ga0207686_10036368 3300025934 Bacteria 2964
199 Ga0207709_10027298 3300025935 Bacteria 3287
200 Ga0207670_10070893 3300025936 Bacteria 2409
201 Ga0207704_10111213 3300025938 Bacteria 1852
202 Ga0207704_10211589 3300025938 Bacteria 1428
203 Ga0207665_10461606 3300025939 Bacteria 976
204 Ga0207711_10006262 3300025941 Bacteria 10039
205 Ga0207711_10061305 3300025941 Bacteria 3243
206 Ga0207711_10104045 3300025941 Unclassified 2515
207 Ga0207711_10290132 3300025941 Unclassified 1508
208 Ga0207667_10019529 3300025949 Bacteria 7561
209 Ga0207667_10689692 3300025949 Bacteria 1024
210 Ga0207651_10482216 3300025960 Bacteria 1069
211 Ga0207712_10484454 3300025961 Unclassified 1055
212 Ga0207712_10964980 3300025961 Unclassified 755
213 Ga0207668_10242158 3300025972 Bacteria 1460
214 Ga0207640_10137843 3300025981 Unclassified 1774
215 Ga0207677_10021546 3300026023 Unclassified 3940
216 Ga0207677_10042410 3300026023 Bacteria 3017
217 Ga0207677_10568130 3300026023 Unclassified 991
218 Ga0207703_10012268 3300026035 Bacteria 6682
219 Ga0207703_10045176 3300026035 Unclassified 3542
220 Ga0207639_10092057 3300026041 Bacteria 2429
221 Ga0207639_10188997 3300026041 Bacteria 1758
222 Ga0207639_10363865 3300026041 Unclassified 1295
223 Ga0207708_10015583 3300026075 Bacteria 5700
224 Ga0207708_10396974 3300026075 Bacteria 1140
225 Ga0207641_10030716 3300026088 Unclassified 4451
226 Ga0207641_10298059 3300026088 Bacteria 1522
227 Ga0207648_10037857 3300026089 Bacteria 4246
228 Ga0207648_10038406 3300026089 Bacteria 4212
229 Ga0207648_10528485 3300026089 Unclassified 1081
230 Ga0207648_10629078 3300026089 Unclassified 991
231 Ga0207648_10819427 3300026089 Unclassified 867
232 Ga0207676_10013078 3300026095 Bacteria 5958
233 Ga0207675_100017448 3300026118 Bacteria 6701
234 Ga0207683_10604688 3300026121 Unclassified 1015
235 Ga0207698_10587507 3300026142 Bacteria 1096
236 Ga0207428_10058381 3300027907 Bacteria 3062
237 Ga0268266_10172885 3300028379 Bacteria 1961
238 Ga0268266_10712411 3300028379 Unclassified 968
239 Ga0268265_10871363 3300028380 Unclassified 882
240 Ga0268264_10808360 3300028381 Bacteria 937
241 Ga0268264_11120024 3300028381 Bacteria 796
242 Ga0265318_10001273 3300028577 Bacteria 15193
243 Ga0265328_10106827 3300031239 Bacteria 1039
244 Ga0265325_10178473 3300031241 Bacteria 990
245 Ga0265316_10005175 3300031344 Bacteria 12766
246 Ga0265316_10045376 3300031344 Bacteria 3489
247 Ga0265316_10148305 3300031344 Bacteria 1758
248 Ga0265313_10180573 3300031595 Unclassified 887
249 Ga0265314_10025874 3300031711 Unclassified 4418
250 Ga0265342_10028257 3300031712 Bacteria 3498
251 Ga0373926_0104248 3300035083 Bacteria 1062
252 Ga0373923_0141218 3300035111 Bacteria 1089
253 Ga0373953_0096755 3300035117 Bacteria 1239
254 Ga0373954_0251162 3300035118 Bacteria 871
255 Ga0373956_0332747 3300035119 Unclassified 724
256 Ga0373957_0042123 3300035120 Bacteria 1722
257 Ga0373943_0031235 3300035170 Unclassified 2526
258 Ga0373943_0280496 3300035170 Bacteria 942
259 Ga0373946_0107391 3300035171 Bacteria 1259
260 Ga0373955_0300420 3300035172 Bacteria 968
261 Ga0373924_0183465 3300035410 Bacteria 921
262 Ga0373935_0145800 3300035692 Bacteria 1602
263 Ga0373935_0288448 3300035692 Bacteria 1157
264 Ga0373935_0502876 3300035692 Archaea 880
265 Ga0373927_0001012 3300035695 Bacteria 21427
266 Ga0373927_0182704 3300035695 Bacteria 1376
267 Ga0373947_0004163 3300035725 Bacteria 8498
268 Ga0373947_0410892 3300035725 Bacteria 914
269 Ga0373937_0908548 3300036401 Unclassified 829
270 Ga0373937_1056680 3300036401 Bacteria 761
271 Ga0373937_1063067 3300036401 Unclassified 758
272 Ga0373925_0000102 3300037068 Bacteria 92826
273 Ga0373925_0747580 3300037068 Unclassified 806
274 Ga0466963_0351755 3300044694 Bacteria 1038
275 Ga0466958_0452830 3300045836 Unclassified 831
276 Ga0495592_0316430 3300046454 Unclassified 1010
277 Ga0495592_0353399 3300046454 Bacteria 942
278 Ga0495580_0023837 3300046472 Bacteria 4488
279 Ga0495580_0091577 3300046472 Unclassified 2116
280 Ga0495582_0082441 3300046473 Bacteria 1787
281 Ga0495582_0288105 3300046473 Bacteria 943
282 Ga0495639_0188866 3300046475 Unclassified 1005
283 Ga0495639_0547517 3300046475 Unclassified 593
284 Ga0495664_0078477 3300046477 Bacteria 1978
285 Ga0495594_0315982 3300046499 Unclassified 890
286 Ga0495608_0106578 3300046511 Bacteria 1804
287 Ga0495618_0198048 3300046514 Bacteria 1272
288 Ga0495628_0300250 3300046516 Bacteria 1189
289 Ga0495630_0374584 3300046517 Unclassified 1090
290 Ga0495630_0587146 3300046517 Bacteria 854
291 Ga0495652_0064100 3300046529 Bacteria 3092
292 Ga0495652_0611097 3300046529 Unclassified 742
293 Ga0495665_0068801 3300046531 Bacteria 1867
294 Ga0495640_0064626 3300046533 Bacteria 2473
295 Ga0495640_0171312 3300046533 Bacteria 1387
296 Ga0495587_0066151 3300046536 Bacteria 2109
297 Ga0495645_0005920 3300046543 Bacteria 8448
298 Ga0495645_0007193 3300046543 Bacteria 7746
299 Ga0495667_0026432 3300046559 Bacteria 3912
300 Ga0495667_0086716 3300046559 Bacteria 2030
301 Ga0495667_0241384 3300046559 Bacteria 1151
302 Ga0495635_0169931 3300046663 Bacteria 1483
303 Ga0495635_0329564 3300046663 Archaea 1021
304 Ga0495635_0560839 3300046663 Unclassified 748
305 Ga0495599_0035064 3300046678 Bacteria 3150
306 Ga0495623_0001862 3300046679 Bacteria 14144
307 Ga0495623_0098485 3300046679 Bacteria 1784
308 Ga0495623_0174984 3300046679 Unclassified 1251
309 Ga0495623_0419458 3300046679 Unclassified 717
310 Ga0495646_0129319 3300046680 Bacteria 1423
311 Ga0495646_0257007 3300046680 Unclassified 934
312 Ga0495646_0351561 3300046680 Unclassified 772
313 Ga0495647_0085237 3300046681 Bacteria 1287
314 Ga0495658_0055174 3300046683 Bacteria 2263
315 Ga0495658_0127961 3300046683 Bacteria 1543
316 Ga0495613_0230125 3300046689 Bacteria 1299
317 Ga0495613_0572196 3300046689 Unclassified 754
318 Ga0495613_0791957 3300046689 Unclassified 619
319 Ga0495604_0127346 3300047317 Bacteria 1834
320 Ga0495604_0226097 3300047317 Unclassified 1286
321 Ga0495604_0286484 3300047317 Bacteria 1111
322 Ga0495674_0002466 3300047319 Bacteria 18064
323 Ga0495674_0063590 3300047319 Bacteria 3210
324 Ga0495674_0080714 3300047319 Bacteria 2791
325 Ga0495674_0557853 3300047319 Unclassified 911
326 Ga0495676_0295953 3300047321 Bacteria 1093
327 Ga0495680_0192029 3300047322 Bacteria 1469
328 Ga0495680_0556055 3300047322 Unclassified 772
329 Ga0495675_0213531 3300047444 Bacteria 1170
330 Ga0495684_0015085 3300047471 Bacteria 5950
331 Ga0495684_0027098 3300047471 Unclassified 4400
332 Ga0495602_0168241 3300048088 Bacteria 1704
333 Ga0495614_0147018 3300048089 Unclassified 1050
334 Ga0496105_0680618 3300048908 Bacteria 791
335 Ga0496106_0358254 3300048909 Bacteria 1172
336 Ga0496111_0544782 3300048914 Unclassified 852
337 Ga0496112_0822704 3300048915 Unclassified 853
338 Ga0496114_0074497 3300048917 Bacteria 2858
339 nmdc:mga05p37_492861_c1 3300050507 Bacteria 1408
340 nmdc:mga08y16_1135094_c1 3300050511 Unclassified 755
341 nmdc:mga08y16_8532_c1 3300050511 Bacteria 10734
342 nmdc:mga0n895_15_c1 3300050512 Bacteria 102361
343 nmdc:mga0n895_207928_c1 3300050512 Bacteria 1988
344 nmdc:mga0n895_920997_c1 3300050512 Bacteria 859
345 nmdc:mga0rr50_15_c1 3300050513 Bacteria 189079
346 nmdc:mga08x19_131_c1 3300050514 Bacteria 66501
347 nmdc:mga08x19_146964_c1 3300050514 Bacteria 1595
348 nmdc:mga0a205_374100_c1 3300050515 Bacteria 1290
349 Ga0495601_0044108 3300053077 Bacteria 2803
350 Ga0495601_0197267 3300053077 Bacteria 1316
351 Ga0495619_0333360 3300053085 Bacteria 1050
352 Ga0501082_0000309 3300060353 Bacteria 43386
353 Ga0105237_10245251
354 JGI25406J46586_10096764
355 Ga0070658_10003305
356 Ga0070658_10136364
357 Ga0070676_10034504
358 Ga0070683_100008576
359 Ga0070683_100243264
360 Ga0070683_100366425
361 Ga0070683_100848203
362 Ga0070690_100291068
363 Ga0070670_100669322
364 Ga0070666_10122348
365 Ga0068868_100005070
366 Ga0068868_100110266
367 Ga0070660_100014691
368 Ga0070691_10030782
369 Ga0070669_100143251
370 Ga0070669_100810772
371 Ga0070675_100004379
372 Ga0070671_100198366
373 Ga0070673_100474072
374 Ga0070688_100127175
375 Ga0070688_100207065
376 Ga0070667_100629895
377 Ga0070714_100161569
378 Ga0070714_100176763
379 Ga0070713_100036784
380 Ga0070701_10095849
381 Ga0070705_100008373
382 Ga0070694_100040072
383 Ga0070694_100099868
384 Ga0070678_100655090
385 Ga0070678_101102924
386 Ga0070681_10322007
387 Ga0068867_100115913
388 Ga0068867_100116835
389 Ga0068867_100614834
390 Ga0070706_100613544
391 Ga0070707_100282813
392 Ga0070707_100660377
393 Ga0070699_100175298
394 Ga0070699_100213377
395 Ga0070684_100065456
396 Ga0068853_100292326
397 Ga0068853_100323481
398 Ga0068853_101076803
399 Ga0070686_100124538
400 Ga0070695_100052217
401 Ga0070696_100572177
402 Ga0070665_100002821
403 Ga0070665_100253449
404 Ga0070665_100460286
405 Ga0070704_100043820
406 Ga0068855_100122652
407 Ga0068855_100254566
408 Ga0068855_100270892
409 Ga0068854_100356501
410 Ga0070702_100014186
411 Ga0068852_100580480
412 Ga0068859_100348268
413 Ga0068859_101348389
414 Ga0068864_100025067
415 Ga0068866_10012127
416 Ga0068861_100051608
417 Ga0068861_100392752
418 Ga0068863_100005298
419 Ga0068863_100085376
420 Ga0068863_100249769
421 Ga0068858_100045426
422 Ga0068858_100083902
423 Ga0068858_100084299
424 Ga0068858_100835911
425 Ga0068858_100934056
426 Ga0068860_100159295
427 Ga0068860_100529342
428 Ga0068860_101064099
429 Ga0068862_100167712
430 Ga0081539_10013793
431 Ga0070717_10299806
432 Ga0070716_100130485
433 Ga0097621_100012891
434 Ga0097621_100054075
435 Ga0097621_100110632
436 Ga0097621_100203707
437 Ga0097621_100214678
438 Ga0068871_100010705
439 Ga0068871_100029199
440 Ga0068871_100113738
441 Ga0068871_100180259
442 Ga0068871_100405445
443 Ga0075433_10062884
444 Ga0075434_100005979
445 Ga0075434_100011566
446 Ga0075434_100369839
447 Ga0068865_100078515
448 Ga0068865_100818017
449 Ga0075436_100045964
450 Ga0097620_100348257
451 Ga0097620_101348466
452 Ga0075435_100000904
453 Ga0075435_100144220
454 Ga0105240_10001208
455 Ga0105240_10058088
456 Ga0105240_10060885
457 Ga0105240_10072133
458 Ga0105240_10118615
459 Ga0105240_10227715
460 Ga0105240_10353458
461 Ga0105240_11037723
462 Ga0111539_10002920
463 Ga0105245_10006323
464 Ga0105245_10018265
465 Ga0105247_10068660
466 Ga0114129_10052605
467 Ga0105243_10011944
468 Ga0105243_10144458
469 Ga0105243_10576955
470 Ga0105241_10038482
471 Ga0105241_10111924
472 Ga0105241_10343888
473 Ga0105242_10010996
474 Ga0105242_10244531
475 Ga0105242_10374510
476 Ga0105242_10461789
477 Ga0105248_10005851
478 Ga0105248_10025445
479 Ga0105248_10066990
480 Ga0105248_10151726
481 Ga0105248_10240361
482 Ga0105248_10300156
483 Ga0105248_11005035
484 Ga0105237_10018340
485 Ga0105238_10001376
486 Ga0105238_10008176
487 Ga0105238_10201781
488 Ga0105238_10383463
489 Ga0105249_10461831
490 Ga0105249_10598899
491 Ga0105239_10335782
492 Ga0105239_10478998
493 Ga0105246_10269694
494 Ga0157373_10349304
495 Ga0157370_10004779
496 Ga0157369_10033890
497 Ga0157369_10172285
498 Ga0157374_10094465
499 Ga0157374_10096579
500 Ga0157374_10259203
501 Ga0157378_10025693
502 Ga0157378_10099884
503 Ga0163162_10002688
504 Ga0163162_10195988
505 Ga0163162_10508419
506 Ga0157372_10428468
507 Ga0157375_10018508
508 Ga0157375_10546233
509 Ga0157375_10979484
510 Ga0163163_10034291
511 Ga0163163_10231988
512 Ga0163163_10298157
513 Ga0157380_10111874
514 Ga0157380_10363773
515 Ga0157377_10273759
516 Ga0157379_10009455
517 Ga0157379_10025264
518 Ga0157379_11082071
519 Ga0157376_10189031
520 Ga0157376_10191222
521 Ga0157376_10335360
522 Ga0157376_10901151
523 Ga0207685_10278743
524 Ga0207645_10008506
525 Ga0207645_10125652
526 Ga0207643_10427278
527 Ga0207707_10488844
528 Ga0207695_10018300
529 Ga0207695_10034833
530 Ga0207695_10047497
531 Ga0207695_10059203
532 Ga0207695_10090818
533 Ga0207695_10431023
534 Ga0207671_10024450
535 Ga0207657_10001567
536 Ga0207646_10128552
537 Ga0207681_10290318
538 Ga0207681_10631640
539 Ga0207694_10013023
540 Ga0207694_10130108
541 Ga0207694_10456799
542 Ga0207659_10027147
543 Ga0207659_10148677
544 Ga0207687_10287077
545 Ga0207700_10016635
546 Ga0207700_10783361
547 Ga0207664_10155107
548 Ga0207664_10850560
549 Ga0207644_10380406
550 Ga0207686_10036368
551 Ga0207709_10027298
552 Ga0207670_10070893
553 Ga0207704_10111213
554 Ga0207704_10211589
555 Ga0207665_10461606
556 Ga0207711_10006262
557 Ga0207711_10061305
558 Ga0207711_10104045
559 Ga0207711_10290132
560 Ga0207667_10019529
561 Ga0207667_10689692
562 Ga0207651_10482216
563 Ga0207712_10484454
564 Ga0207712_10964980
565 Ga0207668_10242158
566 Ga0207640_10137843
567 Ga0207677_10021546
568 Ga0207677_10042410
569 Ga0207677_10568130
570 Ga0207703_10012268
571 Ga0207703_10045176
572 Ga0207639_10092057
573 Ga0207639_10188997
574 Ga0207639_10363865
575 Ga0207708_10015583
576 Ga0207708_10396974
577 Ga0207641_10030716
578 Ga0207641_10298059
579 Ga0207648_10037857
580 Ga0207648_10038406
581 Ga0207648_10528485
582 Ga0207648_10629078
583 Ga0207648_10819427
584 Ga0207676_10013078
585 Ga0207675_100017448
586 Ga0207683_10604688
587 Ga0207698_10587507
588 Ga0207428_10058381
589 Ga0268266_10172885
590 Ga0268266_10712411
591 Ga0268265_10871363
592 Ga0268264_10808360
593 Ga0268264_11120024
594 Ga0265318_10001273
595 Ga0265328_10106827
596 Ga0265325_10178473
597 Ga0265316_10005175
598 Ga0265316_10045376
599 Ga0265316_10148305
600 Ga0265313_10180573
601 Ga0265314_10025874
602 Ga0265342_10028257
603 Ga0373926_0104248
604 Ga0373923_0141218
605 Ga0373953_0096755
606 Ga0373954_0251162
607 Ga0373956_0332747
608 Ga0373957_0042123
609 Ga0373943_0031235
610 Ga0373943_0280496
611 Ga0373946_0107391
612 Ga0373955_0300420
613 Ga0373924_0183465
614 Ga0373935_0145800
615 Ga0373935_0288448
616 Ga0373935_0502876
617 Ga0373927_0001012
618 Ga0373927_0182704
619 Ga0373947_0004163
620 Ga0373947_0410892
621 Ga0373937_0908548
622 Ga0373937_1056680
623 Ga0373937_1063067
624 Ga0373925_0000102
625 Ga0373925_0747580
626 Ga0466963_0351755
627 Ga0466958_0452830
628 Ga0495592_0316430
629 Ga0495592_0353399
630 Ga0495580_0023837
631 Ga0495580_0091577
632 Ga0495582_0082441
633 Ga0495582_0288105
634 Ga0495639_0188866
635 Ga0495639_0547517
636 Ga0495664_0078477
637 Ga0495594_0315982
638 Ga0495608_0106578
639 Ga0495618_0198048
640 Ga0495628_0300250
641 Ga0495630_0374584
642 Ga0495630_0587146
643 Ga0495652_0064100
644 Ga0495652_0611097
645 Ga0495665_0068801
646 Ga0495640_0064626
647 Ga0495640_0171312
648 Ga0495587_0066151
649 Ga0495645_0005920
650 Ga0495645_0007193
651 Ga0495667_0026432
652 Ga0495667_0086716
653 Ga0495667_0241384
654 Ga0495635_0169931
655 Ga0495635_0329564
656 Ga0495635_0560839
657 Ga0495599_0035064
658 Ga0495623_0001862
659 Ga0495623_0098485
660 Ga0495623_0174984
661 Ga0495623_0419458
662 Ga0495646_0129319
663 Ga0495646_0257007
664 Ga0495646_0351561
665 Ga0495647_0085237
666 Ga0495658_0055174
667 Ga0495658_0127961
668 Ga0495613_0230125
669 Ga0495613_0572196
670 Ga0495613_0791957
671 Ga0495604_0127346
672 Ga0495604_0226097
673 Ga0495604_0286484
674 Ga0495674_0002466
675 Ga0495674_0063590
676 Ga0495674_0080714
677 Ga0495674_0557853
678 Ga0495676_0295953
679 Ga0495680_0192029
680 Ga0495680_0556055
681 Ga0495675_0213531
682 Ga0495684_0015085
683 Ga0495684_0027098
684 Ga0495602_0168241
685 Ga0495614_0147018
686 Ga0496105_0680618
687 Ga0496106_0358254
688 Ga0496111_0544782
689 Ga0496112_0822704
690 Ga0496114_0074497
691 nmdc:mga05p37_492861_c1
692 nmdc:mga08y16_1135094_c1
693 nmdc:mga08y16_8532_c1
694 nmdc:mga0n895_15_c1
695 nmdc:mga0n895_207928_c1
696 nmdc:mga0n895_920997_c1
697 nmdc:mga0rr50_15_c1
698 nmdc:mga08x19_131_c1
699 nmdc:mga08x19_146964_c1
700 nmdc:mga0a205_374100_c1
701 Ga0495601_0044108
702 Ga0495601_0197267
703 Ga0495619_0333360
704 Ga0501082_0000309

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4b1m-assembly3.cif.gz_C carbohydrate binding module cbm66 from bacillus subtilis 0.6783 20 189
4b1m-assembly3.cif.gz_C carbohydrate binding module cbm66 from bacillus subtilis 0.6629 20 189
2uwc-assembly2.cif.gz_B crystal structure of nasturtium xyloglucan hydrolase isoform nxg2 0.6557 47 189
5xrk-assembly1.cif.gz_A-2 galectin-10/charcot-leyden crystal protein variant c57a crystal structure 0.6422 69 190
2uwc-assembly1.cif.gz_A crystal structure of nasturtium xyloglucan hydrolase isoform nxg2 0.6418 47 189
ID Description Score Start End Superfamily
af_Q10102_66_225_3.50.70.10 Alpha Beta;3-Layer(bba) Sandwich;Chalcone isomerase; 0.7237 132 161 3.50.70.10
4b1mC00 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.6783 20 189 2.60.120.560
4b1mC00 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.6629 20 189 2.60.120.560
2uwcB00 Mainly Beta;Sandwich;Jelly Rolls; 0.6557 47 189 2.60.120.200
af_P35443_731_958_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.6303 26 190 2.60.120.200
ID Description Score Start End GO Terms
AF-A0A1F2QZX5-F1-model_v4 3-keto-disaccharide hydrolase domain-containing protein 0.8896 27 190
AF-A0A7C7X854-F1-model_v4 3-keto-disaccharide hydrolase domain-containing protein 0.8665 57 190
AF-A0A2V7RIS3-F1-model_v4 3-keto-disaccharide hydrolase domain-containing protein 0.8616 45 189
AF-A0A838QID1-F1-model_v4 3-keto-disaccharide hydrolase domain-containing protein 0.855 60 190
AF-A0A432HV60-F1-model_v4 3-keto-disaccharide hydrolase domain-containing protein 0.8548 42 189

Map