F418078

General Info

Members Datasets Scaffolds Average Seq Length
349 241 80 381

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2889016732|2889022057
Length 468
Sequence AFSSQQRRLHWSAFLDRNRTRNHRQTPFVTLHGGEKERNNKALPIILVESPHRFRSILTGGQKMNIKSLLLGSAAALIAVSGARAADAVTVAEPEPAEYVKICDVYGSGYFYIPGTETCLRIGGYVRYDIGVGDVGSFDGATSADVEDGGSNDTFYKNARFTLKTWTGQETELGTLKTYTETRWNFGNRNADLGALVDPDGAGPLPAANAVNPAFNKGTSLNFAWIQLGGLRVGKDESAFNTFIGYAGNVIQDTLVPYGDFDTNVVQYYFDAGNGFSAVISLEEGSGGGTDGVYGVGTIDSYVPHVVGGVKWTQGWGAITGVIAYDSNYEEVAGKVRLDVNVNDAISLFIIGGYGTDDNLTDPTYAFAAGGRGFYKQWDGNWAVWGGGTYKFNEKTSFNAQVSYDEGENLGIAANIAYDIVPGFTVTAEVDYVNAGSINEADGLNHNWTGITDGDDAIGGLLRFQRSF

Samples

Sample ID Description Type Environment
1 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
2 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
3 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
4 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
5 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
6 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
7 2512875024 Mesorhizobium loti R88b Isolate Nodule
8 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
9 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
10 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
11 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
12 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
13 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
14 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
15 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
16 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
17 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
18 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
19 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
20 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
21 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
22 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
23 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
24 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
25 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
26 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
27 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
28 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
29 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
30 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
31 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
32 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
33 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
34 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
35 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
36 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
37 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
38 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
39 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
40 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
41 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
42 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
43 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
44 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
45 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
46 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
47 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
48 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
49 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
50 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
51 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
52 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
53 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
54 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
55 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
56 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
57 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
58 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
59 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
60 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
61 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
62 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
63 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
64 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
65 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
66 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
67 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
68 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
69 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
70 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
71 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
72 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
73 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
74 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
75 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
76 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
77 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
78 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
79 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
80 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
81 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
82 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
83 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
84 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
85 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
86 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
87 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
88 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
89 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
90 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
91 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
92 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
93 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
94 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
95 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
96 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
97 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
98 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
99 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
100 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
101 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
102 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
103 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
104 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
105 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
106 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
107 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
108 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
109 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
110 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
111 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
112 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
113 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
114 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
115 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
116 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
117 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
118 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
119 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
120 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
121 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
122 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
123 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
124 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
125 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
126 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
127 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
128 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
129 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
130 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
131 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
132 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
133 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
134 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
135 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
136 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
137 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
138 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
139 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
140 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
141 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
142 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
143 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
144 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
145 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
146 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
147 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
148 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
149 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
150 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
151 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
152 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
153 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
154 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
155 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
156 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
157 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
158 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
159 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
160 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
161 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
162 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
163 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
164 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
165 3004167301 Mesorhizobium loti 582 Isolate Unclassified
166 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
167 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
168 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
169 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
170 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
171 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
172 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
173 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
174 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
175 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
176 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
177 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
178 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
179 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
180 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
181 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
182 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
183 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
184 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
186 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
188 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
193 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
194 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
195 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
196 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
232 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
233 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
234 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
235 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
236 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
237 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
238 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
239 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
240 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
241 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 6.3
Metatranscriptomes 16.62
Isolates 77.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.29
Nodule 67.91
Rhizoplane 0
Rhizosphere 20.63
Stem 0
Stem Tuber 0
Unclassified 9.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1001842 3300002705 Bacteria 8302
2 Ga0055542_1001231 3300003762 Bacteria 14230
3 Ga0075368_10008471 3300006042 Bacteria 3665
4 Ga0075370_10056866 3300006353 Bacteria 2223
5 Ga0105240_10447575 3300009093 Bacteria 1446
6 Ga0105237_10414244 3300009545 Bacteria 1352
7 Ga0105238_10186372 3300009551 Bacteria 2051
8 Ga0105239_10421073 3300010375 Bacteria 1513
9 Ga0209026_1000005 3300025250 Bacteria 731387
10 Ga0209026_1000215 3300025250 Bacteria 80382
11 Ga0209148_1000056 3300025254 Bacteria 363380
12 Ga0209759_1000577 3300025256 Bacteria 36392
13 Ga0209455_1000137 3300025272 Bacteria 142099
14 Ga0495648_0103830 3300046524 Bacteria 1562
15 Ga0501033_0017752 3300049570 Bacteria 5374
16 Ga0501034_0030350 3300049571 Bacteria 5495
17 Ga0501036_0105644 3300049572 Bacteria 2381
18 Ga0501038_0094081 3300049574 Bacteria 2505
19 Ga0501039_0074314 3300049575 Bacteria 2641
20 nmdc:mga06z11_3365_c1 3300050494 Bacteria 6189
21 nmdc:mga07m45_178018_c1 3300050496 Bacteria 1237
22 Ga0500610_0115463 3300053079 Bacteria 1376
23 Ga0587084_009485 3300059477 Bacteria 1258
24 Ga0587084_010447 3300059477 Bacteria 1217
25 Ga0587093_005086 3300059478 Bacteria 1373
26 Ga0587066_014058 3300059490 Bacteria 1223
27 Ga0587070_011105 3300059491 Bacteria 1340
28 Ga0587073_0015776 3300059492 Bacteria 1368
29 Ga0587073_0017570 3300059492 Bacteria 1323
30 Ga0587077_012342 3300059493 Bacteria 1364
31 Ga0587077_014655 3300059493 Bacteria 1293
32 Ga0587080_011925 3300059503 Bacteria 1306
33 Ga0587082_008777 3300059504 Bacteria 1419
34 Ga0587082_011232 3300059504 Bacteria 1306
35 Ga0587083_0015074 3300059505 Bacteria 1342
36 Ga0587083_0015350 3300059505 Bacteria 1335
37 Ga0587083_0016993 3300059505 Bacteria 1295
38 Ga0587085_004939 3300059506 Bacteria 1544
39 Ga0587085_007662 3300059506 Bacteria 1354
40 Ga0587086_006724 3300059507 Bacteria 1295
41 Ga0587088_004705 3300059508 Bacteria 1748
42 Ga0587088_007318 3300059508 Bacteria 1521
43 Ga0587088_010063 3300059508 Bacteria 1377
44 Ga0587088_012259 3300059508 Bacteria 1294
45 Ga0587089_004188 3300059509 Bacteria 1578
46 Ga0587089_009707 3300059509 Bacteria 1187
47 Ga0587090_011346 3300059510 Bacteria 1251
48 Ga0587090_011579 3300059510 Bacteria 1243
49 Ga0587092_009457 3300059512 Bacteria 1312
50 Ga0587094_009101 3300059513 Bacteria 1260
51 Ga0587106_006517 3300059605 Bacteria 1380
52 Ga0587106_008917 3300059605 Bacteria 1262
53 Ga0587099_002796 3300059622 Bacteria 1405
54 Ga0587099_004740 3300059622 Bacteria 1193
55 Ga0587109_015207 3300059624 Bacteria 1302
56 Ga0587109_016901 3300059624 Bacteria 1255
57 Ga0587115_004786 3300059626 Bacteria 1495
58 Ga0587062_005968 3300059639 Bacteria 1366
59 Ga0587067_010064 3300059640 Bacteria 1425
60 Ga0587067_010887 3300059640 Bacteria 1389
61 Ga0587068_011731 3300059641 Bacteria 1327
62 Ga0587068_012514 3300059641 Bacteria 1295
63 Ga0587069_008381 3300059642 Bacteria 1306
64 Ga0587069_009262 3300059642 Bacteria 1267
65 Ga0587072_012418 3300059643 Bacteria 1407
66 Ga0587072_016971 3300059643 Bacteria 1252
67 Ga0587075_007322 3300059644 Bacteria 1382
68 Ga0587075_009322 3300059644 Bacteria 1276
69 Ga0587076_013252 3300059645 Bacteria 1247
70 Ga0587078_006409 3300059646 Bacteria 1279
71 Ga0587079_007016 3300059647 Bacteria 1669
72 Ga0587079_015424 3300059647 Bacteria 1297
73 Ga0587100_002248 3300059648 Bacteria 1223
74 Ga0587102_003306 3300059649 Bacteria 1305
75 Ga0587105_000518 3300059651 Bacteria 1624
76 Ga0587107_003008 3300059652 Bacteria 1591
77 Ga0587071_011185 3300060344 Bacteria 1510
78 Ga0587071_019666 3300060344 Bacteria 1224
79 Ga0587111_0011131 3300060346 Bacteria 1560
80 Ga0587111_0018710 3300060346 Bacteria 1306

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2588253730 2588515305 292
2 iso_pu_bacteria 2987673487 2987678927 305
3 3300059492 Ga0587073_0017570 Ga0587073_0017570_273_1262 318
4 iso_pu_bacteria 2876377896 2876383659 321
5 iso_pu_bacteria 2977828996 2977830720 322
6 iso_pu_bacteria 2869256925 2869257571 323
7 iso_pu_bacteria 2871459585 2871460745 325
8 iso_pu_bacteria 2965119406 2965125565 325
9 iso_pu_bacteria 3004239961 3004241265 327
10 iso_pu_bacteria 2906386501 2906391556 333
11 iso_pu_bacteria 2958122699 2958127840 335
12 iso_pu_bacteria 2882912400 2882918858 338
13 iso_pu_bacteria 2922185730 2922189778 338
14 3300059647 Ga0587079_015424 Ga0587079_015424_119_1273 341
15 iso_pu_bacteria 2881861095 2881866711 341
16 iso_pu_bacteria 2924784321 2924788194 341
17 iso_pu_bacteria 2924718760 2924719960 342
18 iso_pu_bacteria 2937868953 2937874523 342
19 iso_pu_bacteria 2977957713 2977965003 342
20 iso_pu_bacteria 2874131515 2874138329 343
21 iso_pu_bacteria 2906363423 2906367587 343
22 iso_pu_bacteria 2906370794 2906372751 343
23 iso_pu_bacteria 2965040258 2965043745 343
24 iso_pu_bacteria 2965089291 2965093377 343
25 iso_pu_bacteria 8004361976 8004364061 343
26 iso_pu_bacteria 2856334872 2856339214 345
27 iso_pu_bacteria 2857367948 2857375082 345
28 iso_pu_bacteria 2869271264 2869277672 345
29 iso_pu_bacteria 2958137437 2958141743 345
30 iso_pu_bacteria 2965062239 2965066195 345
31 iso_pu_bacteria 2977872689 2977876184 345
32 iso_pu_bacteria 2977935797 2977941685 345
33 iso_pu_bacteria 8004300914 8004303995 345
34 iso_pu_bacteria 2693429783 2694633801 346
35 iso_pu_bacteria 2693429784 2694639859 346
36 3300059477 Ga0587084_009485 Ga0587084_009485_16_1191 347
37 3300059491 Ga0587070_011105 Ga0587070_011105_82_1257 347
38 3300059493 Ga0587077_012342 Ga0587077_012342_68_1243 347
39 3300059505 Ga0587083_0015074 Ga0587083_0015074_100_1275 347
40 3300059506 Ga0587085_004939 Ga0587085_004939_302_1477 347
41 3300059508 Ga0587088_007318 Ga0587088_007318_27_1202 347
42 3300059510 Ga0587090_011346 Ga0587090_011346_15_1190 347
43 3300059622 Ga0587099_002796 Ga0587099_002796_68_1243 347
44 3300059624 Ga0587109_016901 Ga0587109_016901_13_1188 347
45 3300059644 Ga0587075_009322 Ga0587075_009322_20_1195 347
46 3300059647 Ga0587079_007016 Ga0587079_007016_427_1602 347
47 3300060346 Ga0587111_0011131 Ga0587111_0011131_68_1243 347
48 iso_pu_bacteria 2958100919 2958107248 347
49 3300049570 Ga0501033_0017752 Ga0501033_0017752_3833_5101 348
50 3300049571 Ga0501034_0030350 Ga0501034_0030350_3734_5002 348
51 3300049572 Ga0501036_0105644 Ga0501036_0105644_868_2136 348
52 3300049574 Ga0501038_0094081 Ga0501038_0094081_356_1624 348
53 3300049575 Ga0501039_0074314 Ga0501039_0074314_809_2077 348
54 3300059478 Ga0587093_005086 Ga0587093_005086_84_1268 350
55 3300059490 Ga0587066_014058 Ga0587066_014058_26_1210 350
56 3300059492 Ga0587073_0015776 Ga0587073_0015776_168_1352 350
57 3300059493 Ga0587077_014655 Ga0587077_014655_95_1279 350
58 3300059503 Ga0587080_011925 Ga0587080_011925_16_1200 350
59 3300059504 Ga0587082_011232 Ga0587082_011232_17_1201 350
60 3300059505 Ga0587083_0016993 Ga0587083_0016993_17_1201 350
61 3300059506 Ga0587085_007662 Ga0587085_007662_154_1338 350
62 3300059507 Ga0587086_006724 Ga0587086_006724_17_1201 350
63 3300059508 Ga0587088_010063 Ga0587088_010063_177_1361 350
64 3300059509 Ga0587089_004188 Ga0587089_004188_17_1201 350
65 3300059510 Ga0587090_011579 Ga0587090_011579_16_1200 350
66 3300059605 Ga0587106_006517 Ga0587106_006517_16_1200 350
67 3300059639 Ga0587062_005968 Ga0587062_005968_168_1352 350
68 3300059640 Ga0587067_010887 Ga0587067_010887_162_1346 350
69 3300059641 Ga0587068_012514 Ga0587068_012514_17_1201 350
70 3300059642 Ga0587069_008381 Ga0587069_008381_17_1201 350
71 3300059644 Ga0587075_007322 Ga0587075_007322_182_1366 350
72 3300059645 Ga0587076_013252 Ga0587076_013252_17_1201 350
73 3300059648 Ga0587100_002248 Ga0587100_002248_26_1210 350
74 3300059651 Ga0587105_000518 Ga0587105_000518_236_1420 350
75 3300059652 Ga0587107_003008 Ga0587107_003008_17_1201 350
76 3300060344 Ga0587071_011185 Ga0587071_011185_222_1406 350
77 3300060346 Ga0587111_0018710 Ga0587111_0018710_16_1200 350
78 3300053079 Ga0500610_0115463 Ga0500610_0115463_136_1359 351
79 iso_pu_bacteria 2513237164 2514033395 351
80 iso_pu_bacteria 2922151315 2922155246 351
81 iso_pu_bacteria 2857349434 2857357247 352
82 iso_pu_bacteria 2977942078 2977949406 352
83 iso_pu_bacteria 2987636660 2987644638 352
84 iso_pu_bacteria 3004203850 3004210900 352
85 3300003762 Ga0055542_1001231 Ga0055542_100123113 354
86 3300025254 Ga0209148_1000056 Ga0209148_1000056131 354
87 3300025272 Ga0209455_1000137 Ga0209455_100013726 354
88 iso_pu_bacteria 2509276018 2509370120 355
89 iso_pu_bacteria 2510065059 2510319080 355
90 iso_pu_bacteria 2512875016 2512929723 355
91 iso_pu_bacteria 2869264136 2869264707 355
92 iso_pu_bacteria 2876363079 2876366714 355
93 iso_pu_bacteria 2903448605 2903452890 355
94 iso_pu_bacteria 2903521522 2903524581 355
95 iso_pu_bacteria 2903528002 2903531176 355
96 iso_pu_bacteria 2963644680 2963649508 355
97 iso_pu_bacteria 2965102966 2965109515 355
98 iso_pu_bacteria 2968083720 2968084671 355
99 iso_pu_bacteria 2977950692 2977957468 355
100 iso_pu_bacteria 3004195979 3004200966 355
101 iso_pu_bacteria 637000159 637079467 355
102 iso_pu_bacteria 8004695233 8004701723 355
103 iso_pu_bacteria 2847670302 2847671918 356
104 iso_pu_bacteria 2756170246 2756678130 357
105 iso_pu_bacteria 2871488783 2871494032 357
106 iso_pu_bacteria 2878753008 2878756608 357
107 iso_pu_bacteria 2881845957 2881847256 357
108 iso_pu_bacteria 2885318864 2885322606 357
109 iso_pu_bacteria 2903492973 2903502464 357
110 iso_pu_bacteria 2961170736 2961172898 357
111 iso_pu_bacteria 2967996073 2967998108 357
112 iso_pu_bacteria 2968003550 2968008760 357
113 iso_pu_bacteria 2970503327 2970505492 357
114 iso_pu_bacteria 2977821940 2977825788 357
115 iso_pu_bacteria 2979808191 2979810213 357
116 iso_pu_bacteria 8004374579 8004378196 357
117 3300059622 Ga0587099_004740 Ga0587099_004740_44_1180 358
118 iso_pu_bacteria 2512875024 2512964488 359
119 iso_pu_bacteria 2938014810 2938018278 359
120 iso_pu_bacteria 2876369609 2876369999 360
121 iso_pu_bacteria 2885312484 2885316309 360
122 iso_pu_bacteria 2687453392 2688600229 361
123 iso_pu_bacteria 2856328259 2856328529 361
124 iso_pu_bacteria 2874162495 2874165725 361
125 iso_pu_bacteria 2876399893 2876400521 361
126 iso_pu_bacteria 2906408224 2906414233 361
127 iso_pu_bacteria 2922172374 2922172954 361
128 iso_pu_bacteria 2922178524 2922180647 361
129 iso_pu_bacteria 2924748358 2924751569 361
130 iso_pu_bacteria 2958158011 2958161883 361
131 iso_pu_bacteria 2961136820 2961142454 361
132 iso_pu_bacteria 2965025482 2965026150 361
133 iso_pu_bacteria 3000135777 3000141929 361
134 iso_pu_bacteria 649633066 649874701 361
135 iso_pu_bacteria 2874139085 2874143664 362
136 iso_pu_bacteria 2878738818 2878738929 362
137 iso_pu_bacteria 2888350351 2888350962 362
138 iso_pu_bacteria 2924776078 2924776291 362
139 iso_pu_bacteria 2958144490 2958149121 362
140 iso_pu_bacteria 2979742915 2979748024 362
141 iso_pu_bacteria 2996348954 2996356630 362
142 iso_pu_bacteria 3004275668 3004282933 362
143 iso_pu_bacteria 2512875024 2512964491 363
144 iso_pu_bacteria 2513237090 2513608359 363
145 iso_pu_bacteria 2881161766 2881162916 363
146 iso_pu_bacteria 2881853255 2881858524 363
147 iso_pu_bacteria 2904659560 2904665892 363
148 iso_pu_bacteria 2961114664 2961121236 363
149 iso_pu_bacteria 2968110612 2968117388 363
150 3300010375 Ga0105239_10421073 Ga0105239_104210731 364
151 3300059509 Ga0587089_009707 Ga0587089_009707_21_1163 364
152 3300059624 Ga0587109_015207 Ga0587109_015207_114_1256 364
153 3300059626 Ga0587115_004786 Ga0587115_004786_329_1471 364
154 iso_pu_bacteria 2791355123 2792749213 364
155 iso_pu_bacteria 2856364286 2856364743 364
156 iso_pu_bacteria 2869285874 2869289808 364
157 iso_pu_bacteria 2871429161 2871431929 364
158 iso_pu_bacteria 2874146452 2874155552 364
159 iso_pu_bacteria 2874155637 2874162409 364
160 iso_pu_bacteria 2874168670 2874175743 364
161 iso_pu_bacteria 2876413966 2876420897 364
162 iso_pu_bacteria 2878745973 2878748535 364
163 iso_pu_bacteria 2903492973 2903506157 364
164 iso_pu_bacteria 2906308376 2906312097 364
165 iso_pu_bacteria 2906321335 2906323835 364
166 iso_pu_bacteria 2937813078 2937818079 364
167 iso_pu_bacteria 2937848649 2937851106 364
168 iso_pu_bacteria 2958064165 2958066033 364
169 iso_pu_bacteria 2958130278 2958134180 364
170 iso_pu_bacteria 2958179912 2958183826 364
171 iso_pu_bacteria 2961077736 2961081792 364
172 iso_pu_bacteria 2977843712 2977851177 364
173 iso_pu_bacteria 3004334049 3004339299 364
174 iso_pu_bacteria 8004387939 8004391685 364
175 iso_pu_bacteria 8004714634 8004717054 364
176 3300025250 Ga0209026_1000215 Ga0209026_100021580 365
177 iso_pu_bacteria 2844009547 2844015544 365
178 iso_pu_bacteria 2878788777 2878793737 365
179 iso_pu_bacteria 2970489779 2970494846 365
180 iso_pu_bacteria 2970547951 2970548505 365
181 iso_pu_bacteria 3000135777 3000141949 365
182 iso_pu_bacteria 2856320880 2856326807 366
183 iso_pu_bacteria 2869278585 2869283640 366
184 iso_pu_bacteria 2874168670 2874171527 366
185 iso_pu_bacteria 2881147464 2881153770 366
186 iso_pu_bacteria 2885305155 2885311706 366
187 iso_pu_bacteria 2937877337 2937884251 366
188 iso_pu_bacteria 2937972304 2937979646 366
189 iso_pu_bacteria 2958034702 2958040152 366
190 iso_pu_bacteria 2958041894 2958054496 366
191 iso_pu_bacteria 2958084443 2958091562 366
192 iso_pu_bacteria 2958092219 2958095527 366
193 iso_pu_bacteria 2968016561 2968018993 366
194 iso_pu_bacteria 2970469710 2970470834 366
195 iso_pu_bacteria 2970593180 2970597935 366
196 iso_pu_bacteria 2977942078 2977945722 366
197 iso_pu_bacteria 3004167301 3004171008 366
198 iso_pu_bacteria 637000159 637079464 366
199 3300009093 Ga0105240_10447575 Ga0105240_104475751 367
200 iso_pu_bacteria 2508501123 2509115817 367
201 iso_pu_bacteria 2508501127 2509145814 367
202 iso_pu_bacteria 2847686936 2847688143 367
203 iso_pu_bacteria 2874102143 2874103413 367
204 iso_pu_bacteria 2881147464 2881153767 367
205 iso_pu_bacteria 2885342637 2885350330 367
206 iso_pu_bacteria 2906328253 2906331311 367
207 iso_pu_bacteria 2922151315 2922157780 367
208 iso_pu_bacteria 2958115193 2958116893 367
209 iso_pu_bacteria 2958122699 2958125767 367
210 iso_pu_bacteria 2965032056 2965037456 367
211 iso_pu_bacteria 2968097103 2968097633 367
212 iso_pu_bacteria 2977858184 2977861186 367
213 iso_pu_bacteria 2977864932 2977869462 367
214 iso_pu_bacteria 2977957713 2977962642 367
215 iso_pu_bacteria 2979779861 2979785631 367
216 iso_pu_bacteria 3004239961 3004245399 367
217 iso_pu_bacteria 637000159 637076463 367
218 iso_pu_bacteria 8004445564 8004451878 367
219 iso_pu_bacteria 8004703790 8004710775 367
220 iso_pu_bacteria 2874168670 2874175741 368
221 iso_pu_bacteria 2888337043 2888338870 368
222 iso_pu_bacteria 3004268573 3004273460 368
223 iso_pu_bacteria 8004640170 8004641295 368
224 3300006042 Ga0075368_10008471 Ga0075368_100084711 369
225 3300006353 Ga0075370_10056866 Ga0075370_100568663 369
226 3300050494 nmdc:mga06z11_3365_c1 nmdc:mga06z11_3365_c1_3592_4737 369
227 3300050496 nmdc:mga07m45_178018_c1 nmdc:mga07m45_178018_c1_75_1220 369
228 3300059508 Ga0587088_012259 Ga0587088_012259_92_1276 369
229 3300059643 Ga0587072_016971 Ga0587072_016971_50_1234 369
230 iso_pu_bacteria 2937848649 2937850781 369
231 iso_pu_bacteria 2977922695 2977926304 369
232 iso_pu_bacteria 2977986579 2977987265 369
233 iso_pu_bacteria 3004211236 3004214570 369
234 iso_pu_bacteria 3004218560 3004219252 369
235 iso_pu_bacteria 2874123672 2874127665 370
236 iso_pu_bacteria 2876369609 2876376193 370
237 3300059605 Ga0587106_008917 Ga0587106_008917_68_1246 371
238 iso_pu_bacteria 2847670302 2847671916 371
239 iso_pu_bacteria 2856320880 2856324327 371
240 iso_pu_bacteria 2856364286 2856364747 371
241 iso_pu_bacteria 2857349434 2857354981 371
242 iso_pu_bacteria 2869278585 2869281675 371
243 iso_pu_bacteria 2869285874 2869289804 371
244 iso_pu_bacteria 2871429161 2871431925 371
245 iso_pu_bacteria 2874139085 2874140660 371
246 iso_pu_bacteria 2874146452 2874155548 371
247 iso_pu_bacteria 2874155637 2874162405 371
248 iso_pu_bacteria 2876392853 2876399362 371
249 iso_pu_bacteria 2876413966 2876420893 371
250 iso_pu_bacteria 2878738818 2878742442 371
251 iso_pu_bacteria 2878745973 2878748531 371
252 iso_pu_bacteria 2881161766 2881162919 371
253 iso_pu_bacteria 2903492973 2903506153 371
254 iso_pu_bacteria 2904659560 2904665889 371
255 iso_pu_bacteria 2906308376 2906312093 371
256 iso_pu_bacteria 2906321335 2906323831 371
257 iso_pu_bacteria 2924776078 2924780242 371
258 iso_pu_bacteria 2937813078 2937818083 371
259 iso_pu_bacteria 2937822353 2937829164 371
260 iso_pu_bacteria 2937877337 2937882762 371
261 iso_pu_bacteria 2937972304 2937973264 371
262 iso_pu_bacteria 2958034702 2958037636 371
263 iso_pu_bacteria 2958041894 2958047347 371
264 iso_pu_bacteria 2958084443 2958089887 371
265 iso_pu_bacteria 2958130278 2958134176 371
266 iso_pu_bacteria 2958144490 2958149403 371
267 iso_pu_bacteria 2958179912 2958183822 371
268 iso_pu_bacteria 2961077736 2961081788 371
269 iso_pu_bacteria 2961114664 2961121233 371
270 iso_pu_bacteria 2968016561 2968019529 371
271 iso_pu_bacteria 2968110612 2968117385 371
272 iso_pu_bacteria 2970469710 2970472850 371
273 iso_pu_bacteria 2970593180 2970596278 371
274 iso_pu_bacteria 2977843712 2977851181 371
275 iso_pu_bacteria 2979710463 2979714708 371
276 iso_pu_bacteria 2987636660 2987643583 371
277 iso_pu_bacteria 2996348954 2996352031 371
278 iso_pu_bacteria 3004203850 3004207128 371
279 iso_pu_bacteria 3004275668 3004278729 371
280 iso_pu_bacteria 3004289098 3004296639 371
281 iso_pu_bacteria 8004387939 8004391681 371
282 iso_pu_bacteria 8004640170 8004641297 371
283 iso_pu_bacteria 8004714634 8004717050 371
284 iso_pu_bacteria 2512875016 2512929721 372
285 iso_pu_bacteria 2876363079 2876366717 372
286 iso_pu_bacteria 2885305155 2885311703 372
287 iso_pu_bacteria 2888350351 2888350744 372
288 iso_pu_bacteria 2889016732 2889022054 372
289 iso_pu_bacteria 2903521522 2903524584 372
290 iso_pu_bacteria 2903528002 2903531173 372
291 iso_pu_bacteria 2906354277 2906356596 372
292 iso_pu_bacteria 2922130491 2922134913 372
293 iso_pu_bacteria 2924762789 2924764526 372
294 iso_pu_bacteria 2958172287 2958173594 372
295 iso_pu_bacteria 2963644680 2963649511 372
296 iso_pu_bacteria 2968091066 2968092319 372
297 iso_pu_bacteria 2977942078 2977947266 372
298 iso_pu_bacteria 2977971508 2977973773 372
299 iso_pu_bacteria 2977971508 2977973775 372
300 iso_pu_bacteria 2979710463 2979716598 372
301 iso_pu_bacteria 2979742915 2979743830 372
302 iso_pu_bacteria 2987652177 2987659279 372
303 iso_pu_bacteria 2987652177 2987659281 372
304 iso_pu_bacteria 2987666974 2987672631 372
305 iso_pu_bacteria 3000135777 3000141951 372
306 3300059477 Ga0587084_010447 Ga0587084_010447_14_1174 373
307 3300059504 Ga0587082_008777 Ga0587082_008777_185_1345 373
308 3300059505 Ga0587083_0015350 Ga0587083_0015350_91_1251 373
309 3300059508 Ga0587088_004705 Ga0587088_004705_545_1705 373
310 3300059512 Ga0587092_009457 Ga0587092_009457_86_1246 373
311 3300059513 Ga0587094_009101 Ga0587094_009101_15_1175 373
312 3300059640 Ga0587067_010064 Ga0587067_010064_185_1345 373
313 3300059641 Ga0587068_011731 Ga0587068_011731_95_1255 373
314 3300059642 Ga0587069_009262 Ga0587069_009262_14_1174 373
315 3300059643 Ga0587072_012418 Ga0587072_012418_56_1216 373
316 3300059646 Ga0587078_006409 Ga0587078_006409_44_1204 373
317 3300059649 Ga0587102_003306 Ga0587102_003306_86_1246 373
318 3300060344 Ga0587071_019666 Ga0587071_019666_44_1204 373
319 iso_pu_bacteria 2844002411 2844005666 373
320 iso_pu_bacteria 2965110997 2965111831 373
321 iso_pu_bacteria 2857349434 2857354979 374
322 iso_pu_bacteria 2871444079 2871446854 374
323 iso_pu_bacteria 2889010040 2889013084 374
324 iso_pu_bacteria 2922158528 2922161573 374
325 iso_pu_bacteria 2924726620 2924726750 374
326 iso_pu_bacteria 2968128360 2968131762 374
327 iso_pu_bacteria 2977986579 2977990957 374
328 iso_pu_bacteria 2987636660 2987643580 374
329 iso_pu_bacteria 2996341866 2996343139 374
330 iso_pu_bacteria 3004203850 3004207125 374
331 iso_pu_bacteria 3004334049 3004340541 374
332 3300046524 Ga0495648_0103830 Ga0495648_0103830_130_1293 375
333 iso_pu_bacteria 2958100919 2958107902 376
334 iso_pu_bacteria 2958172287 2958173591 376
335 iso_pu_bacteria 2889010040 2889013082 377
336 iso_pu_bacteria 2889016732 2889022057 380
337 iso_pu_bacteria 2965119406 2965125885 380
338 iso_pu_bacteria 2509276022 2509397825 381
339 iso_pu_bacteria 2856334872 2856340197 381
340 iso_pu_bacteria 2857367948 2857374471 381
341 iso_pu_bacteria 2878781027 2878787344 381
342 iso_pu_bacteria 2924733363 2924740454 381
343 iso_pu_bacteria 2977872689 2977874846 381
344 3300009545 Ga0105237_10414244 Ga0105237_104142441 382
345 iso_pu_bacteria 2588253730 2588515302 383
346 3300009551 Ga0105238_10186372 Ga0105238_101863722 387
347 3300002705 JGI25156J39149_1001842 JGI25156J39149_10018423 388
348 3300025250 Ga0209026_1000005 Ga0209026_10000052 388
349 3300025256 Ga0209759_1000577 Ga0209759_10005773 388

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02530

Porin_2

Porin subfamily

87

461

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4aui-assembly1.cif.gz_C structure and function of the porb porin from disseminating n. gonorrhoeae 0.6207 57 388
4aui-assembly1.cif.gz_C structure and function of the porb porin from disseminating n. gonorrhoeae 0.6171 57 388
3upg-assembly1.cif.gz_A loop deletion mutant of salmonella typhi osmoporin (ompc):an outer membrane protein. 0.6092 45 388
3wi5-assembly1.cif.gz_A crystal structure of the loop 7 mutant porb from neisseria meningitidis serogroup b 0.6085 57 388
3upg-assembly1.cif.gz_A loop deletion mutant of salmonella typhi osmoporin (ompc):an outer membrane protein. 0.6075 45 388
ID Description Score Start End Superfamily
1nrfA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.6804 332 386 3.40.710.10
4auiC00 Mainly Beta;Beta Barrel;Porin;Porin 0.6207 57 388 2.40.160.10
4auiC00 Mainly Beta;Beta Barrel;Porin;Porin 0.6171 57 388 2.40.160.10
3uu2B00 Mainly Beta;Beta Barrel;Porin;Porin 0.5879 55 388 2.40.160.10
af_H9GYR4_95_410_2.40.160.10 Mainly Beta;Beta Barrel;Porin;Porin 0.5826 84 354 2.40.160.10
ID Description Score Start End GO Terms
AF-A0A529IL01-F1-model_v4 deleted 0.8863 160 388
AF-A0A212DQI7-F1-model_v4 deleted 0.8837 70 388
AF-A0A439UFA7-F1-model_v4 Porin 0.8825 48 388 GO:0006811
GO:0009279
GO:0015288
GO:0046930
AF-A0A435SUT9-F1-model_v4 deleted 0.8813 68 388
AF-A0A439UFA7-F1-model_v4 Porin 0.88 48 388 GO:0006811
GO:0009279
GO:0015288
GO:0046930

Feature Viewer

pLDDT pTM Quality
73.51 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map