F415466

General Info

Members Datasets Scaffolds Average Seq Length
343 214 343 109

Family's Representative Sequence

Representative Sequence 3300005437|Ga0070710_10208877|Ga0070710_102088771
Length 125
Sequence MGESVGAKLRPIMPMPNEIVGLLRSKITLKWSDGHETVYRARDLRLACRCAACIEETSGRPLLDPTKVADTVRAKRIELVGQYAIGIEWSDGHTTGIYNFRDLRANCPCEPCMAERAAGRAPQSP

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
135 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
136 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
137 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
138 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
139 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
140 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
141 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
142 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
143 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
144 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
145 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
147 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
148 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
149 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
150 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
151 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
152 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
153 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
154 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
155 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
157 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
159 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
160 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
161 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
164 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
165 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
166 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
167 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
168 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
169 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
170 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
171 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
172 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
173 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
174 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
175 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
176 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
177 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
178 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
179 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
180 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
184 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
185 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
190 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
191 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
201 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
202 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
203 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
204 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
205 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
206 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
207 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
208 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
209 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
210 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
211 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
212 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
213 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
214 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.75
Rhizosphere 90.09
Stem 0
Stem Tuber 0
Unclassified 1.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10246417 3300003320 Bacteria 1447
2 Ga0065715_10671287 3300005293 Bacteria 639
3 Ga0070676_10017109 3300005328 Bacteria 4010
4 Ga0070676_11382301 3300005328 Unclassified 540
5 Ga0070683_100008372 3300005329 Bacteria 8782
6 Ga0070683_100184944 3300005329 Bacteria 1978
7 Ga0070683_100462501 3300005329 Bacteria 1211
8 Ga0070690_100008518 3300005330 Bacteria 5911
9 Ga0070690_100016130 3300005330 Bacteria 4469
10 Ga0070690_100268102 3300005330 Unclassified 1214
11 Ga0070670_100096987 3300005331 Bacteria 2536
12 Ga0070670_100195936 3300005331 Bacteria 1755
13 Ga0070677_10693355 3300005333 Unclassified 573
14 Ga0068869_100519850 3300005334 Unclassified 996
15 Ga0070666_10136649 3300005335 Bacteria 1706
16 Ga0070680_101358691 3300005336 Bacteria 615
17 Ga0070682_100250243 3300005337 Bacteria 1277
18 Ga0070682_100727032 3300005337 Unclassified 799
19 Ga0068868_101081674 3300005338 Bacteria 737
20 Ga0070689_100005506 3300005340 Bacteria 8655
21 Ga0070689_100012821 3300005340 Bacteria 6052
22 Ga0070689_100035755 3300005340 Bacteria 3796
23 Ga0070687_100012687 3300005343 Bacteria 3727
24 Ga0070687_100095776 3300005343 Bacteria 1651
25 Ga0070692_10002622 3300005345 Bacteria 7021
26 Ga0070668_100025315 3300005347 Bacteria 4498
27 Ga0070669_100036254 3300005353 Bacteria 3573
28 Ga0070675_100048216 3300005354 Bacteria 3492
29 Ga0070671_100077219 3300005355 Bacteria 2783
30 Ga0070674_100002664 3300005356 Bacteria 9893
31 Ga0070674_101323375 3300005356 Unclassified 643
32 Ga0070673_100000274 3300005364 Bacteria 26538
33 Ga0070673_100050416 3300005364 Bacteria 3255
34 Ga0070673_100222091 3300005364 Unclassified 1635
35 Ga0070673_100315769 3300005364 Bacteria 1379
36 Ga0070688_100009677 3300005365 Bacteria 5285
37 Ga0070659_100164343 3300005366 Bacteria 1816
38 Ga0070667_100376129 3300005367 Bacteria 1290
39 Ga0070667_100421577 3300005367 Bacteria 1217
40 Ga0070709_11743208 3300005434 Bacteria 509
41 Ga0070713_101003684 3300005436 Bacteria 805
42 Ga0070710_10040363 3300005437 Bacteria 2573
43 Ga0070710_10208877 3300005437 Bacteria 1237
44 Ga0070710_10398265 3300005437 Unclassified 922
45 Ga0070701_10049925 3300005438 Bacteria 2164
46 Ga0070711_101205734 3300005439 Unclassified 655
47 Ga0070705_100046857 3300005440 Bacteria 2495
48 Ga0070700_100035218 3300005441 Bacteria 3028
49 Ga0070700_100726796 3300005441 Bacteria 792
50 Ga0070700_101864636 3300005441 Bacteria 519
51 Ga0070694_100112568 3300005444 Bacteria 1941
52 Ga0070678_100219147 3300005456 Bacteria 1581
53 Ga0070678_101992514 3300005456 Bacteria 549
54 Ga0070662_100186025 3300005457 Bacteria 1640
55 Ga0070681_10137647 3300005458 Bacteria 2372
56 Ga0070681_10147393 3300005458 Bacteria 2282
57 Ga0068867_100025351 3300005459 Bacteria 4254
58 Ga0070685_10144593 3300005466 Bacteria 1501
59 Ga0070685_10174083 3300005466 Bacteria 1381
60 Ga0070707_100490718 3300005468 Unclassified 1190
61 Ga0070698_101339916 3300005471 Bacteria 666
62 Ga0070679_100660585 3300005530 Unclassified 988
63 Ga0070684_100001774 3300005535 Bacteria 15747
64 Ga0070684_100838776 3300005535 Unclassified 860
65 Ga0070684_101977560 3300005535 Unclassified 550
66 Ga0070684_102229758 3300005535 Bacteria 517
67 Ga0070672_100019801 3300005543 Bacteria 4893
68 Ga0070672_100077033 3300005543 Bacteria 2665
69 Ga0070672_100270426 3300005543 Bacteria 1435
70 Ga0070672_101169564 3300005543 Bacteria 685
71 Ga0070686_100003431 3300005544 Bacteria 8700
72 Ga0070686_100727674 3300005544 Unclassified 794
73 Ga0070695_100207623 3300005545 Bacteria 1404
74 Ga0070693_100870671 3300005547 Bacteria 673
75 Ga0070665_101677661 3300005548 Unclassified 643
76 Ga0070704_101687799 3300005549 Bacteria 585
77 Ga0068855_100002160 3300005563 Bacteria 24307
78 Ga0068857_101725750 3300005577 Bacteria 612
79 Ga0068857_102090736 3300005577 Bacteria 556
80 Ga0068856_100737858 3300005614 Bacteria 1005
81 Ga0070702_101043122 3300005615 Bacteria 650
82 Ga0068852_100353436 3300005616 Bacteria 1435
83 Ga0068859_100177916 3300005617 Bacteria 2209
84 Ga0068866_11271398 3300005718 Unclassified 534
85 Ga0068861_100044424 3300005719 Bacteria 3341
86 Ga0068861_101315817 3300005719 Unclassified 703
87 Ga0068851_10289757 3300005834 Unclassified 938
88 Ga0068870_10551306 3300005840 Bacteria 776
89 Ga0068863_100397994 3300005841 Bacteria 1347
90 Ga0068858_100052182 3300005842 Bacteria 3783
91 Ga0068860_100112203 3300005843 Bacteria 2607
92 Ga0068862_100029451 3300005844 Bacteria 4627
93 Ga0070717_10507864 3300006028 Bacteria 1090
94 Ga0070717_11416446 3300006028 Bacteria 631
95 Ga0070712_100535776 3300006175 Unclassified 985
96 Ga0097621_102447849 3300006237 Bacteria 500
97 Ga0068871_100832865 3300006358 Bacteria 852
98 Ga0075428_101025289 3300006844 Unclassified 873
99 Ga0075431_101399068 3300006847 Bacteria 659
100 Ga0068865_100001784 3300006881 Bacteria 12627
101 Ga0068865_101063723 3300006881 Bacteria 711
102 Ga0097620_100177919 3300006931 Bacteria 2209
103 Ga0105240_10190608 3300009093 Bacteria 2411
104 Ga0111539_10012798 3300009094 Bacteria 10497
105 Ga0111539_13106836 3300009094 Bacteria 536
106 Ga0105245_10971138 3300009098 Bacteria 893
107 Ga0105245_12306586 3300009098 Unclassified 592
108 Ga0114129_12365658 3300009147 Bacteria 637
109 Ga0105243_10230514 3300009148 Bacteria 1643
110 Ga0105248_12391781 3300009177 Bacteria 602
111 Ga0105237_10018953 3300009545 Bacteria 7110
112 Ga0105238_10893344 3300009551 Unclassified 907
113 Ga0105249_10160651 3300009553 Bacteria 2171
114 Ga0157374_10247178 3300013296 Bacteria 1755
115 Ga0157374_11189497 3300013296 Bacteria 783
116 Ga0163162_10774014 3300013306 Unclassified 1078
117 Ga0157372_10397215 3300013307 Unclassified 1607
118 Ga0157375_11526252 3300013308 Unclassified 789
119 Ga0163163_11354688 3300014325 Unclassified 773
120 Ga0157380_11178651 3300014326 Bacteria 809
121 Ga0157379_10019285 3300014968 Bacteria 6023
122 Ga0157379_11411830 3300014968 Unclassified 675
123 Ga0157376_10711081 3300014969 Bacteria 1011
124 Ga0157376_10825051 3300014969 Unclassified 941
125 Ga0157376_12444609 3300014969 Unclassified 562
126 Ga0213876_10366431 3300021384 Bacteria 766
127 Ga0207697_10037861 3300025315 Bacteria 1978
128 Ga0207656_10639658 3300025321 Unclassified 544
129 Ga0207692_10117090 3300025898 Unclassified 1486
130 Ga0207692_10663607 3300025898 Bacteria 674
131 Ga0207692_10704423 3300025898 Unclassified 655
132 Ga0207688_10310414 3300025901 Bacteria 966
133 Ga0207680_10123929 3300025903 Bacteria 1694
134 Ga0207680_10311811 3300025903 Bacteria 1098
135 Ga0207699_10208409 3300025906 Bacteria 1328
136 Ga0207645_10030994 3300025907 Bacteria 3444
137 Ga0207707_10084882 3300025912 Bacteria 2766
138 Ga0207707_10117205 3300025912 Bacteria 2328
139 Ga0207695_10154239 3300025913 Bacteria 2232
140 Ga0207671_10020206 3300025914 Bacteria 5073
141 Ga0207693_10516682 3300025915 Unclassified 932
142 Ga0207662_10028826 3300025918 Bacteria 3213
143 Ga0207662_10032811 3300025918 Bacteria 3024
144 Ga0207662_11279275 3300025918 Unclassified 521
145 Ga0207652_10388168 3300025921 Bacteria 1260
146 Ga0207646_10391391 3300025922 Unclassified 1256
147 Ga0207681_10008905 3300025923 Bacteria 6127
148 Ga0207694_10544531 3300025924 Bacteria 974
149 Ga0207650_10025617 3300025925 Bacteria 4203
150 Ga0207650_10074189 3300025925 Bacteria 2564
151 Ga0207659_10194836 3300025926 Bacteria 1614
152 Ga0207659_10602101 3300025926 Bacteria 937
153 Ga0207659_11530488 3300025926 Unclassified 570
154 Ga0207687_10710789 3300025927 Bacteria 853
155 Ga0207687_11763701 3300025927 Bacteria 530
156 Ga0207690_11388322 3300025932 Unclassified 587
157 Ga0207706_10210526 3300025933 Bacteria 1704
158 Ga0207709_10471521 3300025935 Bacteria 974
159 Ga0207709_11190638 3300025935 Unclassified 628
160 Ga0207670_10012327 3300025936 Bacteria 4998
161 Ga0207670_10039064 3300025936 Bacteria 3105
162 Ga0207669_10001418 3300025937 Bacteria 10209
163 Ga0207669_10855102 3300025937 Unclassified 757
164 Ga0207704_10015001 3300025938 Bacteria 3934
165 Ga0207691_10005290 3300025940 Bacteria 12456
166 Ga0207691_10022657 3300025940 Bacteria 5923
167 Ga0207691_10062512 3300025940 Bacteria 3378
168 Ga0207691_10763107 3300025940 Unclassified 814
169 Ga0207667_10907840 3300025949 Bacteria 872
170 Ga0207651_10000991 3300025960 Bacteria 12551
171 Ga0207651_10196334 3300025960 Bacteria 1613
172 Ga0207651_11648414 3300025960 Bacteria 578
173 Ga0207712_10096152 3300025961 Bacteria 2192
174 Ga0207640_10208869 3300025981 Bacteria 1486
175 Ga0207658_10667134 3300025986 Unclassified 938
176 Ga0207658_11146485 3300025986 Unclassified 710
177 Ga0207658_11501991 3300025986 Unclassified 616
178 Ga0207677_11594525 3300026023 Bacteria 604
179 Ga0207703_10054446 3300026035 Bacteria 3253
180 Ga0207703_12031628 3300026035 Unclassified 551
181 Ga0207708_10001671 3300026075 Bacteria 16460
182 Ga0207708_11682611 3300026075 Unclassified 557
183 Ga0207702_10337701 3300026078 Unclassified 1438
184 Ga0207702_11044520 3300026078 Bacteria 811
185 Ga0207641_10296617 3300026088 Bacteria 1525
186 Ga0207641_11071653 3300026088 Unclassified 804
187 Ga0207648_10008183 3300026089 Bacteria 10165
188 Ga0207676_10563453 3300026095 Bacteria 1090
189 Ga0207676_10985059 3300026095 Bacteria 830
190 Ga0207674_10614273 3300026116 Bacteria 1050
191 Ga0207674_10958207 3300026116 Bacteria 824
192 Ga0207674_11757579 3300026116 Bacteria 588
193 Ga0207675_100001691 3300026118 Bacteria 22078
194 Ga0207683_10063203 3300026121 Bacteria 3261
195 Ga0207698_10849026 3300026142 Bacteria 918
196 Ga0207698_10934983 3300026142 Unclassified 875
197 Ga0207428_10003500 3300027907 Bacteria 15205
198 Ga0268266_10614354 3300028379 Bacteria 1045
199 Ga0268265_11006438 3300028380 Unclassified 823
200 Ga0268264_10028924 3300028381 Bacteria 4537
201 Ga0268264_10963206 3300028381 Bacteria 859
202 Ga0265338_10006814 3300028800 Bacteria 14394
203 Ga0265330_10346021 3300031235 Bacteria 628
204 Ga0265332_10066899 3300031238 Bacteria 1532
205 Ga0265328_10000184 3300031239 Bacteria 29116
206 Ga0265320_10005928 3300031240 Bacteria 7770
207 Ga0265320_10006674 3300031240 Bacteria 7251
208 Ga0265320_10084324 3300031240 Unclassified 1480
209 Ga0265339_10006135 3300031249 Bacteria 7924
210 Ga0265339_10007469 3300031249 Bacteria 7064
211 Ga0265339_10013047 3300031249 Bacteria 5048
212 Ga0265316_10181259 3300031344 Bacteria 1568
213 Ga0265313_10244574 3300031595 Bacteria 733
214 Ga0265314_10004258 3300031711 Bacteria 13402
215 Ga0265314_10026101 3300031711 Bacteria 4396
216 Ga0265342_10000388 3300031712 Bacteria 48589
217 Ga0265342_10001673 3300031712 Bacteria 20362
218 Ga0265342_10104690 3300031712 Bacteria 1608
219 Ga0373950_0000002 3300034818 Bacteria 933559
220 Ga0373950_0000008 3300034818 Bacteria 390102
221 Ga0373923_0331290 3300035111 Bacteria 724
222 Ga0373923_0563815 3300035111 Bacteria 559
223 Ga0373936_0188358 3300035113 Bacteria 907
224 Ga0373945_0047628 3300035116 Bacteria 1568
225 Ga0373953_0018657 3300035117 Bacteria 2570
226 Ga0373953_0222151 3300035117 Unclassified 818
227 Ga0373954_0046386 3300035118 Bacteria 2031
228 Ga0373954_0123951 3300035118 Unclassified 1255
229 Ga0373956_0014451 3300035119 Bacteria 3299
230 Ga0373956_0175882 3300035119 Bacteria 1011
231 Ga0373957_0006678 3300035120 Bacteria 3648
232 Ga0373957_0082210 3300035120 Bacteria 1273
233 Ga0373943_0067321 3300035170 Bacteria 1806
234 Ga0373946_0280567 3300035171 Bacteria 819
235 Ga0373955_0002230 3300035172 Bacteria 8414
236 Ga0373955_0290942 3300035172 Bacteria 984
237 Ga0373955_0546793 3300035172 Unclassified 708
238 Ga0373955_0800034 3300035172 Bacteria 579
239 Ga0373924_0209821 3300035410 Unclassified 860
240 Ga0373931_1170159 3300035691 Unclassified 526
241 Ga0373935_0384126 3300035692 Unclassified 1006
242 Ga0373927_0274359 3300035695 Bacteria 1109
243 Ga0373933_0000178 3300035724 Bacteria 41903
244 Ga0373933_0007605 3300035724 Bacteria 5916
245 Ga0373933_0034316 3300035724 Bacteria 2956
246 Ga0373933_0482177 3300035724 Bacteria 812
247 Ga0373933_0775340 3300035724 Bacteria 631
248 Ga0373947_0036471 3300035725 Bacteria 2916
249 Ga0373947_0410348 3300035725 Bacteria 914
250 Ga0373937_0002178 3300036401 Bacteria 16401
251 Ga0373937_0006246 3300036401 Bacteria 10275
252 Ga0373937_0043456 3300036401 Bacteria 4102
253 Ga0373937_0161659 3300036401 Bacteria 2099
254 Ga0373937_0403416 3300036401 Unclassified 1297
255 Ga0373937_0751930 3300036401 Bacteria 922
256 Ga0373937_0780509 3300036401 Bacteria 903
257 Ga0373937_0839169 3300036401 Bacteria 867
258 Ga0373925_0015128 3300037068 Bacteria 5578
259 Ga0373925_1489123 3300037068 Bacteria 554
260 Ga0436365_0127925 3300039437 Bacteria 810
261 Ga0451800_0962944 3300041459 Unclassified 541
262 Ga0451800_1484416 3300041459 Unclassified 573
263 Ga0451807_2386520 3300041486 Unclassified 916
264 Ga0451833_1308035 3300041491 Unclassified 782
265 Ga0451576_0580264 3300045051 Bacteria 1178
266 Ga0466967_0082250 3300045976 Bacteria 2910
267 Ga0495608_0683225 3300046511 Bacteria 612
268 Ga0495618_0433984 3300046514 Bacteria 799
269 Ga0495618_0777452 3300046514 Unclassified 559
270 Ga0495630_0048438 3300046517 Bacteria 3180
271 Ga0495630_0478397 3300046517 Unclassified 955
272 Ga0495632_0324164 3300046519 Unclassified 680
273 Ga0495586_0015611 3300046535 Bacteria 4041
274 Ga0495587_0476449 3300046536 Unclassified 691
275 Ga0495667_0611654 3300046559 Bacteria 678
276 Ga0495668_0566691 3300046616 Unclassified 627
277 Ga0495634_0000867 3300046642 Bacteria 29091
278 Ga0495674_0030536 3300047319 Bacteria 4899
279 Ga0495680_0559154 3300047322 Bacteria 770
280 Ga0496100_0276590 3300048903 Bacteria 1250
281 Ga0496101_0070236 3300048904 Bacteria 2564
282 Ga0496101_0659527 3300048904 Bacteria 827
283 Ga0496104_0383032 3300048907 Bacteria 1319
284 Ga0496104_0725528 3300048907 Unclassified 901
285 Ga0496104_0765813 3300048907 Bacteria 872
286 Ga0496105_0318935 3300048908 Bacteria 1246
287 Ga0496106_0067923 3300048909 Bacteria 2718
288 Ga0496106_1117423 3300048909 Bacteria 617
289 Ga0496106_1451325 3300048909 Unclassified 529
290 Ga0496107_0061735 3300048910 Bacteria 2714
291 Ga0496107_0504453 3300048910 Bacteria 897
292 Ga0496108_0168718 3300048911 Bacteria 1893
293 Ga0496109_0253593 3300048912 Bacteria 1657
294 Ga0496110_0396252 3300048913 Bacteria 1259
295 Ga0496112_0035062 3300048915 Bacteria 4884
296 Ga0496112_1185140 3300048915 Bacteria 681
297 Ga0496112_1699885 3300048915 Unclassified 544
298 Ga0496114_0000103 3300048917 Bacteria 61061
299 Ga0496114_0002265 3300048917 Bacteria 14648
300 Ga0496114_0053782 3300048917 Bacteria 3356
301 Ga0496114_0756563 3300048917 Bacteria 849
302 Ga0496114_0843405 3300048917 Bacteria 796
303 Ga0496114_1672720 3300048917 Unclassified 524
304 Ga0496115_0049476 3300048918 Bacteria 3365
305 Ga0496115_0050148 3300048918 Bacteria 3343
306 Ga0496115_0325283 3300048918 Bacteria 1257
307 Ga0501034_0000048 3300049571 Bacteria 216615
308 Ga0501036_0020323 3300049572 Bacteria 5577
309 Ga0501036_0038882 3300049572 Bacteria 4028
310 Ga0501038_0063925 3300049574 Bacteria 3140
311 Ga0501042_0257816 3300049578 Unclassified 1259
312 Ga0501043_0000984 3300049579 Bacteria 25114
313 Ga0501046_0000335 3300049580 Bacteria 47390
314 Ga0501047_0000013 3300049581 Bacteria 364111
315 Ga0501048_0001068 3300049582 Bacteria 20536
316 Ga0501067_0000004 3300049583 Bacteria 140058
317 Ga0501067_0171386 3300049583 Bacteria 1209
318 Ga0501068_0009720 3300049584 Bacteria 5384
319 Ga0501072_0000011 3300049588 Bacteria 190693
320 Ga0501073_0000081 3300049589 Bacteria 60191
321 Ga0501073_0001169 3300049589 Bacteria 19168
322 Ga0501073_0003572 3300049589 Bacteria 11691
323 Ga0501073_0039609 3300049589 Bacteria 3338
324 Ga0501073_0674467 3300049589 Unclassified 713
325 Ga0501074_0000219 3300049590 Bacteria 31556
326 Ga0501079_0004226 3300049741 Bacteria 10651
327 Ga0501080_0000699 3300049742 Bacteria 26963
328 Ga0501080_0156329 3300049742 Bacteria 2106
329 Ga0501080_0572909 3300049742 Bacteria 1004
330 Ga0501080_1026237 3300049742 Unclassified 714
331 Ga0501080_1701468 3300049742 Unclassified 532
332 Ga0501080_1795029 3300049742 Bacteria 515
333 Ga0501083_0003588 3300049744 Bacteria 10883
334 Ga0501083_0238763 3300049744 Bacteria 1183
335 nmdc:mga0qj67_1328696_c1 3300050509 Bacteria 556
336 nmdc:mga06r32_1812415_c1 3300050510 Unclassified 546
337 nmdc:mga08y16_4042_c1 3300050511 Bacteria 15304
338 Ga0495601_0045542 3300053077 Bacteria 2759
339 Ga0495601_0868761 3300053077 Unclassified 571
340 Ga0495619_0032183 3300053085 Bacteria 3402
341 Ga0501084_0000007 3300054114 Bacteria 215126
342 Ga0501082_0001468 3300060353 Bacteria 20735
343 Ga0501082_0377571 3300060353 Unclassified 1237

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048917 Ga0496114_0843405 Ga0496114_0843405_420_749 101
2 3300005544 Ga0070686_100727674 Ga0070686_1007276742 102
3 3300005577 Ga0068857_101725750 Ga0068857_1017257502 102
4 3300009551 Ga0105238_10893344 Ga0105238_108933442 102
5 3300014969 Ga0157376_10711081 Ga0157376_107110812 102
6 3300026078 Ga0207702_10337701 Ga0207702_103377011 102
7 3300048915 Ga0496112_1185140 Ga0496112_1185140_236_544 102
8 3300048909 Ga0496106_1117423 Ga0496106_1117423_247_582 103
9 3300005330 Ga0070690_100008518 Ga0070690_1000085185 104
10 3300005337 Ga0070682_100727032 Ga0070682_1007270322 104
11 3300005340 Ga0070689_100012821 Ga0070689_1000128212 104
12 3300005354 Ga0070675_100048216 Ga0070675_1000482164 104
13 3300005364 Ga0070673_100315769 Ga0070673_1003157692 104
14 3300005436 Ga0070713_101003684 Ga0070713_1010036841 104
15 3300005437 Ga0070710_10040363 Ga0070710_100403632 104
16 3300005466 Ga0070685_10174083 Ga0070685_101740832 104
17 3300005543 Ga0070672_100270426 Ga0070672_1002704262 104
18 3300005719 Ga0068861_101315817 Ga0068861_1013158172 104
19 3300005841 Ga0068863_100397994 Ga0068863_1003979942 104
20 3300006175 Ga0070712_100535776 Ga0070712_1005357761 104
21 3300009148 Ga0105243_10230514 Ga0105243_102305143 104
22 3300009553 Ga0105249_10160651 Ga0105249_101606513 104
23 3300013306 Ga0163162_10774014 Ga0163162_107740142 104
24 3300014968 Ga0157379_11411830 Ga0157379_114118302 104
25 3300014969 Ga0157376_10825051 Ga0157376_108250511 104
26 3300025898 Ga0207692_10117090 Ga0207692_101170904 104
27 3300025903 Ga0207680_10311811 Ga0207680_103118112 104
28 3300025915 Ga0207693_10516682 Ga0207693_105166822 104
29 3300025918 Ga0207662_10028826 Ga0207662_100288265 104
30 3300025924 Ga0207694_10544531 Ga0207694_105445314 104
31 3300025926 Ga0207659_10194836 Ga0207659_101948362 104
32 3300025936 Ga0207670_10039064 Ga0207670_100390642 104
33 3300025940 Ga0207691_10062512 Ga0207691_100625124 104
34 3300026088 Ga0207641_10296617 Ga0207641_102966173 104
35 3300045051 Ga0451576_0580264 Ga0451576_0580264_418_732 104
36 3300046514 Ga0495618_0433984 Ga0495618_0433984_424_738 104
37 3300049589 Ga0501073_0674467 Ga0501073_0674467_351_665 104
38 3300060353 Ga0501082_0377571 Ga0501082_0377571_908_1222 104
39 3300005441 Ga0070700_101864636 Ga0070700_1018646362 105
40 3300014969 Ga0157376_12444609 Ga0157376_124446092 105
41 3300031240 Ga0265320_10084324 Ga0265320_100843242 105
42 3300031712 Ga0265342_10104690 Ga0265342_101046903 105
43 3300035111 Ga0373923_0331290 Ga0373923_0331290_332_649 105
44 3300035170 Ga0373943_0067321 Ga0373943_0067321_839_1156 105
45 3300035172 Ga0373955_0546793 Ga0373955_0546793_67_384 105
46 3300036401 Ga0373937_0161659 Ga0373937_0161659_450_767 105
47 3300005293 Ga0065715_10671287 Ga0065715_106712872 106
48 3300005328 Ga0070676_10017109 Ga0070676_100171092 106
49 3300005329 Ga0070683_100008372 Ga0070683_1000083722 106
50 3300005330 Ga0070690_100016130 Ga0070690_1000161305 106
51 3300005330 Ga0070690_100268102 Ga0070690_1002681022 106
52 3300005333 Ga0070677_10693355 Ga0070677_106933552 106
53 3300005334 Ga0068869_100519850 Ga0068869_1005198502 106
54 3300005335 Ga0070666_10136649 Ga0070666_101366492 106
55 3300005337 Ga0070682_100250243 Ga0070682_1002502432 106
56 3300005338 Ga0068868_101081674 Ga0068868_1010816742 106
57 3300005340 Ga0070689_100005506 Ga0070689_1000055066 106
58 3300005340 Ga0070689_100035755 Ga0070689_1000357552 106
59 3300005343 Ga0070687_100012687 Ga0070687_1000126876 106
60 3300005345 Ga0070692_10002622 Ga0070692_100026227 106
61 3300005347 Ga0070668_100025315 Ga0070668_1000253153 106
62 3300005353 Ga0070669_100036254 Ga0070669_1000362543 106
63 3300005355 Ga0070671_100077219 Ga0070671_1000772191 106
64 3300005356 Ga0070674_100002664 Ga0070674_10000266411 106
65 3300005364 Ga0070673_100000274 Ga0070673_1000002745 106
66 3300005364 Ga0070673_100222091 Ga0070673_1002220911 106
67 3300005365 Ga0070688_100009677 Ga0070688_1000096775 106
68 3300005366 Ga0070659_100164343 Ga0070659_1001643432 106
69 3300005367 Ga0070667_100376129 Ga0070667_1003761293 106
70 3300005367 Ga0070667_100421577 Ga0070667_1004215772 106
71 3300005438 Ga0070701_10049925 Ga0070701_100499253 106
72 3300005440 Ga0070705_100046857 Ga0070705_1000468573 106
73 3300005441 Ga0070700_100035218 Ga0070700_1000352185 106
74 3300005444 Ga0070694_100112568 Ga0070694_1001125683 106
75 3300005456 Ga0070678_100219147 Ga0070678_1002191472 106
76 3300005456 Ga0070678_101992514 Ga0070678_1019925141 106
77 3300005457 Ga0070662_100186025 Ga0070662_1001860253 106
78 3300005459 Ga0068867_100025351 Ga0068867_1000253512 106
79 3300005535 Ga0070684_100001774 Ga0070684_10000177411 106
80 3300005535 Ga0070684_100838776 Ga0070684_1008387761 106
81 3300005543 Ga0070672_100019801 Ga0070672_1000198015 106
82 3300005543 Ga0070672_100077033 Ga0070672_1000770335 106
83 3300005544 Ga0070686_100003431 Ga0070686_1000034318 106
84 3300005545 Ga0070695_100207623 Ga0070695_1002076233 106
85 3300005548 Ga0070665_101677661 Ga0070665_1016776612 106
86 3300005549 Ga0070704_101687799 Ga0070704_1016877991 106
87 3300005615 Ga0070702_101043122 Ga0070702_1010431221 106
88 3300005617 Ga0068859_100177916 Ga0068859_1001779163 106
89 3300005718 Ga0068866_11271398 Ga0068866_112713982 106
90 3300005719 Ga0068861_100044424 Ga0068861_1000444245 106
91 3300005840 Ga0068870_10551306 Ga0068870_105513062 106
92 3300005842 Ga0068858_100052182 Ga0068858_1000521825 106
93 3300005843 Ga0068860_100112203 Ga0068860_1001122035 106
94 3300005844 Ga0068862_100029451 Ga0068862_1000294517 106
95 3300006237 Ga0097621_102447849 Ga0097621_1024478491 106
96 3300006358 Ga0068871_100832865 Ga0068871_1008328652 106
97 3300006844 Ga0075428_101025289 Ga0075428_1010252892 106
98 3300006881 Ga0068865_100001784 Ga0068865_10000178410 106
99 3300006931 Ga0097620_100177919 Ga0097620_1001779193 106
100 3300009094 Ga0111539_10012798 Ga0111539_100127989 106
101 3300009094 Ga0111539_13106836 Ga0111539_131068362 106
102 3300009098 Ga0105245_12306586 Ga0105245_123065862 106
103 3300013308 Ga0157375_11526252 Ga0157375_115262522 106
104 3300025315 Ga0207697_10037861 Ga0207697_100378613 106
105 3300025901 Ga0207688_10310414 Ga0207688_103104142 106
106 3300025903 Ga0207680_10123929 Ga0207680_101239292 106
107 3300025907 Ga0207645_10030994 Ga0207645_100309945 106
108 3300025918 Ga0207662_11279275 Ga0207662_112792752 106
109 3300025923 Ga0207681_10008905 Ga0207681_100089057 106
110 3300025926 Ga0207659_10602101 Ga0207659_106021012 106
111 3300025926 Ga0207659_11530488 Ga0207659_115304882 106
112 3300025927 Ga0207687_11763701 Ga0207687_117637012 106
113 3300025932 Ga0207690_11388322 Ga0207690_113883222 106
114 3300025933 Ga0207706_10210526 Ga0207706_102105262 106
115 3300025935 Ga0207709_10471521 Ga0207709_104715212 106
116 3300025935 Ga0207709_11190638 Ga0207709_111906381 106
117 3300025936 Ga0207670_10012327 Ga0207670_100123273 106
118 3300025937 Ga0207669_10001418 Ga0207669_1000141811 106
119 3300025938 Ga0207704_10015001 Ga0207704_100150016 106
120 3300025940 Ga0207691_10005290 Ga0207691_100052909 106
121 3300025940 Ga0207691_10022657 Ga0207691_100226572 106
122 3300025960 Ga0207651_10000991 Ga0207651_100009913 106
123 3300025960 Ga0207651_11648414 Ga0207651_116484141 106
124 3300025961 Ga0207712_10096152 Ga0207712_100961522 106
125 3300025981 Ga0207640_10208869 Ga0207640_102088692 106
126 3300025986 Ga0207658_11146485 Ga0207658_111464852 106
127 3300025986 Ga0207658_11501991 Ga0207658_115019912 106
128 3300026023 Ga0207677_11594525 Ga0207677_115945252 106
129 3300026035 Ga0207703_10054446 Ga0207703_100544463 106
130 3300026035 Ga0207703_12031628 Ga0207703_120316281 106
131 3300026075 Ga0207708_10001671 Ga0207708_1000167117 106
132 3300026088 Ga0207641_11071653 Ga0207641_110716532 106
133 3300026089 Ga0207648_10008183 Ga0207648_100081833 106
134 3300026095 Ga0207676_10563453 Ga0207676_105634533 106
135 3300026116 Ga0207674_10614273 Ga0207674_106142733 106
136 3300026118 Ga0207675_100001691 Ga0207675_1000016912 106
137 3300026121 Ga0207683_10063203 Ga0207683_100632035 106
138 3300027907 Ga0207428_10003500 Ga0207428_1000350016 106
139 3300028379 Ga0268266_10614354 Ga0268266_106143542 106
140 3300028380 Ga0268265_11006438 Ga0268265_110064382 106
141 3300028381 Ga0268264_10028924 Ga0268264_100289245 106
142 3300028381 Ga0268264_10963206 Ga0268264_109632062 106
143 3300041459 Ga0451800_0962944 Ga0451800_0962944_83_403 106
144 3300041486 Ga0451807_2386520 Ga0451807_2386520_282_602 106
145 3300041491 Ga0451833_1308035 Ga0451833_1308035_122_442 106
146 3300048904 Ga0496101_0659527 Ga0496101_0659527_486_806 106
147 3300048907 Ga0496104_0725528 Ga0496104_0725528_272_592 106
148 3300048907 Ga0496104_0765813 Ga0496104_0765813_60_380 106
149 3300048908 Ga0496105_0318935 Ga0496105_0318935_458_778 106
150 3300048911 Ga0496108_0168718 Ga0496108_0168718_1256_1576 106
151 3300048912 Ga0496109_0253593 Ga0496109_0253593_129_449 106
152 3300050511 nmdc:mga08y16_4042_c1 nmdc:mga08y16_4042_c1_8135_8455 106
153 3300005331 Ga0070670_100195936 Ga0070670_1001959362 107
154 3300005616 Ga0068852_100353436 Ga0068852_1003534362 107
155 3300025925 Ga0207650_10025617 Ga0207650_100256173 107
156 3300026142 Ga0207698_10849026 Ga0207698_108490262 107
157 3300035117 Ga0373953_0222151 Ga0373953_0222151_283_606 107
158 3300035118 Ga0373954_0123951 Ga0373954_0123951_294_617 107
159 3300035119 Ga0373956_0175882 Ga0373956_0175882_436_759 107
160 3300035120 Ga0373957_0006678 Ga0373957_0006678_1371_1694 107
161 3300035172 Ga0373955_0002230 Ga0373955_0002230_7173_7496 107
162 3300035410 Ga0373924_0209821 Ga0373924_0209821_418_741 107
163 3300035724 Ga0373933_0034316 Ga0373933_0034316_1369_1692 107
164 3300035725 Ga0373947_0410348 Ga0373947_0410348_44_367 107
165 3300036401 Ga0373937_0006246 Ga0373937_0006246_2923_3246 107
166 3300036401 Ga0373937_0751930 Ga0373937_0751930_540_863 107
167 3300045976 Ga0466967_0082250 Ga0466967_0082250_2180_2503 107
168 3300048903 Ga0496100_0276590 Ga0496100_0276590_805_1128 107
169 3300048904 Ga0496101_0070236 Ga0496101_0070236_973_1296 107
170 3300048909 Ga0496106_0067923 Ga0496106_0067923_1447_1770 107
171 3300048910 Ga0496107_0061735 Ga0496107_0061735_289_612 107
172 3300048917 Ga0496114_0000103 Ga0496114_0000103_13594_13917 107
173 3300048918 Ga0496115_0049476 Ga0496115_0049476_1648_1971 107
174 3300053085 Ga0495619_0032183 Ga0495619_0032183_2865_3188 107
175 3300005328 Ga0070676_11382301 Ga0070676_113823012 108
176 3300005434 Ga0070709_11743208 Ga0070709_117432081 108
177 3300005437 Ga0070710_10398265 Ga0070710_103982651 108
178 3300005471 Ga0070698_101339916 Ga0070698_1013399161 108
179 3300005535 Ga0070684_102229758 Ga0070684_1022297581 108
180 3300005547 Ga0070693_100870671 Ga0070693_1008706711 108
181 3300006028 Ga0070717_11416446 Ga0070717_114164462 108
182 3300021384 Ga0213876_10366431 Ga0213876_103664312 108
183 3300025898 Ga0207692_10704423 Ga0207692_107044232 108
184 3300025986 Ga0207658_10667134 Ga0207658_106671342 108
185 3300026116 Ga0207674_10958207 Ga0207674_109582072 108
186 3300035113 Ga0373936_0188358 Ga0373936_0188358_444_770 108
187 3300035691 Ga0373931_1170159 Ga0373931_1170159_108_434 108
188 3300035692 Ga0373935_0384126 Ga0373935_0384126_88_414 108
189 3300046514 Ga0495618_0777452 Ga0495618_0777452_181_507 108
190 3300046517 Ga0495630_0048438 Ga0495630_0048438_1965_2291 108
191 3300046535 Ga0495586_0015611 Ga0495586_0015611_1975_2301 108
192 3300046642 Ga0495634_0000867 Ga0495634_0000867_2427_2753 108
193 3300047319 Ga0495674_0030536 Ga0495674_0030536_3926_4252 108
194 3300053077 Ga0495601_0045542 Ga0495601_0045542_2220_2546 108
195 3300005364 Ga0070673_100050416 Ga0070673_1000504165 109
196 3300005466 Ga0070685_10144593 Ga0070685_101445932 109
197 3300005468 Ga0070707_100490718 Ga0070707_1004907183 109
198 3300005543 Ga0070672_101169564 Ga0070672_1011695641 109
199 3300006881 Ga0068865_101063723 Ga0068865_1010637232 109
200 3300009177 Ga0105248_12391781 Ga0105248_123917812 109
201 3300013296 Ga0157374_10247178 Ga0157374_102471782 109
202 3300014325 Ga0163163_11354688 Ga0163163_113546882 109
203 3300025940 Ga0207691_10763107 Ga0207691_107631072 109
204 3300025960 Ga0207651_10196334 Ga0207651_101963343 109
205 3300026075 Ga0207708_11682611 Ga0207708_116826111 109
206 3300026095 Ga0207676_10985059 Ga0207676_109850592 109
207 3300034818 Ga0373950_0000008 Ga0373950_0000008_97302_97631 109
208 3300035119 Ga0373956_0014451 Ga0373956_0014451_1206_1535 109
209 3300048917 Ga0496114_1672720 Ga0496114_1672720_121_450 109
210 3300049571 Ga0501034_0000048 Ga0501034_0000048_121061_121390 109
211 3300049572 Ga0501036_0020323 Ga0501036_0020323_2007_2336 109
212 3300049574 Ga0501038_0063925 Ga0501038_0063925_865_1194 109
213 3300049578 Ga0501042_0257816 Ga0501042_0257816_489_818 109
214 3300049579 Ga0501043_0000984 Ga0501043_0000984_19131_19460 109
215 3300049580 Ga0501046_0000335 Ga0501046_0000335_10585_10914 109
216 3300049581 Ga0501047_0000013 Ga0501047_0000013_268781_269110 109
217 3300049582 Ga0501048_0001068 Ga0501048_0001068_3712_4041 109
218 3300049584 Ga0501068_0009720 Ga0501068_0009720_3434_3763 109
219 3300049588 Ga0501072_0000011 Ga0501072_0000011_153919_154248 109
220 3300049589 Ga0501073_0003572 Ga0501073_0003572_32_361 109
221 3300049590 Ga0501074_0000219 Ga0501074_0000219_16194_16523 109
222 3300049741 Ga0501079_0004226 Ga0501079_0004226_5292_5621 109
223 3300049742 Ga0501080_0000699 Ga0501080_0000699_25298_25627 109
224 3300049742 Ga0501080_0156329 Ga0501080_0156329_461_790 109
225 3300049742 Ga0501080_0572909 Ga0501080_0572909_219_548 109
226 3300049742 Ga0501080_1795029 Ga0501080_1795029_172_501 109
227 3300049744 Ga0501083_0003588 Ga0501083_0003588_5292_5621 109
228 3300054114 Ga0501084_0000007 Ga0501084_0000007_177066_177395 109
229 3300060353 Ga0501082_0001468 Ga0501082_0001468_15376_15705 109
230 3300005329 Ga0070683_100184944 Ga0070683_1001849442 110
231 3300005336 Ga0070680_101358691 Ga0070680_1013586912 110
232 3300005356 Ga0070674_101323375 Ga0070674_1013233752 110
233 3300005458 Ga0070681_10147393 Ga0070681_101473933 110
234 3300005577 Ga0068857_102090736 Ga0068857_1020907362 110
235 3300005614 Ga0068856_100737858 Ga0068856_1007378582 110
236 3300009545 Ga0105237_10018953 Ga0105237_100189539 110
237 3300025912 Ga0207707_10084882 Ga0207707_100848823 110
238 3300025937 Ga0207669_10855102 Ga0207669_108551021 110
239 3300026078 Ga0207702_11044520 Ga0207702_110445202 110
240 3300026116 Ga0207674_11757579 Ga0207674_117575792 110
241 3300035116 Ga0373945_0047628 Ga0373945_0047628_784_1116 110
242 3300035171 Ga0373946_0280567 Ga0373946_0280567_165_497 110
243 3300035724 Ga0373933_0775340 Ga0373933_0775340_61_393 110
244 3300035725 Ga0373947_0036471 Ga0373947_0036471_1902_2234 110
245 3300036401 Ga0373937_0839169 Ga0373937_0839169_20_352 110
246 3300039437 Ga0436365_0127925 Ga0436365_0127925_154_486 110
247 3300048915 Ga0496112_0035062 Ga0496112_0035062_1144_1476 110
248 3300048915 Ga0496112_1699885 Ga0496112_1699885_163_495 110
249 3300048917 Ga0496114_0053782 Ga0496114_0053782_2881_3213 110
250 3300048918 Ga0496115_0325283 Ga0496115_0325283_303_635 110
251 3300049589 Ga0501073_0039609 Ga0501073_0039609_2845_3177 110
252 3300053077 Ga0495601_0868761 Ga0495601_0868761_56_388 110
253 3300005331 Ga0070670_100096987 Ga0070670_1000969872 111
254 3300005441 Ga0070700_100726796 Ga0070700_1007267961 111
255 3300005530 Ga0070679_100660585 Ga0070679_1006605852 111
256 3300005563 Ga0068855_100002160 Ga0068855_10000216019 111
257 3300006847 Ga0075431_101399068 Ga0075431_1013990682 111
258 3300009093 Ga0105240_10190608 Ga0105240_101906082 111
259 3300009147 Ga0114129_12365658 Ga0114129_123656581 111
260 3300014326 Ga0157380_11178651 Ga0157380_111786512 111
261 3300014968 Ga0157379_10019285 Ga0157379_100192856 111
262 3300025913 Ga0207695_10154239 Ga0207695_101542392 111
263 3300025922 Ga0207646_10391391 Ga0207646_103913912 111
264 3300025925 Ga0207650_10074189 Ga0207650_100741894 111
265 3300025949 Ga0207667_10907840 Ga0207667_109078402 111
266 3300026142 Ga0207698_10934983 Ga0207698_109349832 111
267 3300028800 Ga0265338_10006814 Ga0265338_100068143 111
268 3300031235 Ga0265330_10346021 Ga0265330_103460212 111
269 3300031238 Ga0265332_10066899 Ga0265332_100668992 111
270 3300031239 Ga0265328_10000184 Ga0265328_100001842 111
271 3300031240 Ga0265320_10005928 Ga0265320_100059286 111
272 3300031249 Ga0265339_10006135 Ga0265339_100061359 111
273 3300031249 Ga0265339_10013047 Ga0265339_100130472 111
274 3300031344 Ga0265316_10181259 Ga0265316_101812592 111
275 3300031595 Ga0265313_10244574 Ga0265313_102445742 111
276 3300031711 Ga0265314_10004258 Ga0265314_100042587 111
277 3300031711 Ga0265314_10026101 Ga0265314_100261012 111
278 3300031712 Ga0265342_10000388 Ga0265342_100003886 111
279 3300031712 Ga0265342_10001673 Ga0265342_1000167320 111
280 3300034818 Ga0373950_0000002 Ga0373950_0000002_581393_581728 111
281 3300035695 Ga0373927_0274359 Ga0373927_0274359_692_1027 111
282 3300035724 Ga0373933_0000178 Ga0373933_0000178_16148_16483 111
283 3300035724 Ga0373933_0482177 Ga0373933_0482177_429_764 111
284 3300036401 Ga0373937_0043456 Ga0373937_0043456_1788_2123 111
285 3300036401 Ga0373937_0403416 Ga0373937_0403416_95_430 111
286 3300036401 Ga0373937_0780509 Ga0373937_0780509_480_815 111
287 3300037068 Ga0373925_1489123 Ga0373925_1489123_135_470 111
288 3300046511 Ga0495608_0683225 Ga0495608_0683225_132_467 111
289 3300046519 Ga0495632_0324164 Ga0495632_0324164_49_384 111
290 3300046536 Ga0495587_0476449 Ga0495587_0476449_305_673 111
291 3300046559 Ga0495667_0611654 Ga0495667_0611654_44_379 111
292 3300048910 Ga0496107_0504453 Ga0496107_0504453_114_449 111
293 3300048917 Ga0496114_0002265 Ga0496114_0002265_2286_2621 111
294 3300048917 Ga0496114_0756563 Ga0496114_0756563_17_352 111
295 3300049572 Ga0501036_0038882 Ga0501036_0038882_2506_2841 111
296 3300049583 Ga0501067_0000004 Ga0501067_0000004_97026_97361 111
297 3300049583 Ga0501067_0171386 Ga0501067_0171386_270_605 111
298 3300049589 Ga0501073_0000081 Ga0501073_0000081_14807_15142 111
299 3300049589 Ga0501073_0001169 Ga0501073_0001169_16055_16390 111
300 3300049742 Ga0501080_1026237 Ga0501080_1026237_100_435 111
301 3300049742 Ga0501080_1701468 Ga0501080_1701468_15_350 111
302 3300049744 Ga0501083_0238763 Ga0501083_0238763_547_882 111
303 3300050509 nmdc:mga0qj67_1328696_c1 nmdc:mga0qj67_1328696_c1_104_439 111
304 3300050510 nmdc:mga06r32_1812415_c1 nmdc:mga06r32_1812415_c1_21_356 111
305 3300005834 Ga0068851_10289757 Ga0068851_102897572 112
306 3300013307 Ga0157372_10397215 Ga0157372_103972152 112
307 3300025321 Ga0207656_10639658 Ga0207656_106396582 112
308 3300025914 Ga0207671_10020206 Ga0207671_100202067 112
309 3300037068 Ga0373925_0015128 Ga0373925_0015128_4499_4837 112
310 3300041459 Ga0451800_1484416 Ga0451800_1484416_105_443 112
311 3300046616 Ga0495668_0566691 Ga0495668_0566691_252_590 112
312 3300048907 Ga0496104_0383032 Ga0496104_0383032_604_942 112
313 3300048913 Ga0496110_0396252 Ga0496110_0396252_507_845 112
314 3300048918 Ga0496115_0050148 Ga0496115_0050148_1944_2282 112
315 3300005329 Ga0070683_100462501 Ga0070683_1004625011 113
316 3300005343 Ga0070687_100095776 Ga0070687_1000957763 113
317 3300005437 Ga0070710_10208877 Ga0070710_102088771 113
318 3300005439 Ga0070711_101205734 Ga0070711_1012057342 113
319 3300005458 Ga0070681_10137647 Ga0070681_101376473 113
320 3300005535 Ga0070684_101977560 Ga0070684_1019775601 113
321 3300006028 Ga0070717_10507864 Ga0070717_105078642 113
322 3300009098 Ga0105245_10971138 Ga0105245_109711382 113
323 3300013296 Ga0157374_11189497 Ga0157374_111894972 113
324 3300025898 Ga0207692_10663607 Ga0207692_106636071 113
325 3300025906 Ga0207699_10208409 Ga0207699_102084091 113
326 3300025912 Ga0207707_10117205 Ga0207707_101172053 113
327 3300025918 Ga0207662_10032811 Ga0207662_100328112 113
328 3300025921 Ga0207652_10388168 Ga0207652_103881682 113
329 3300025927 Ga0207687_10710789 Ga0207687_107107892 113
330 3300031240 Ga0265320_10006674 Ga0265320_100066744 113
331 3300031249 Ga0265339_10007469 Ga0265339_100074692 113
332 3300035111 Ga0373923_0563815 Ga0373923_0563815_67_441 113
333 3300035117 Ga0373953_0018657 Ga0373953_0018657_411_785 113
334 3300035118 Ga0373954_0046386 Ga0373954_0046386_697_1071 113
335 3300035120 Ga0373957_0082210 Ga0373957_0082210_52_426 113
336 3300035172 Ga0373955_0290942 Ga0373955_0290942_322_696 113
337 3300035172 Ga0373955_0800034 Ga0373955_0800034_185_526 113
338 3300035724 Ga0373933_0007605 Ga0373933_0007605_320_694 113
339 3300036401 Ga0373937_0002178 Ga0373937_0002178_6050_6424 113
340 3300046517 Ga0495630_0478397 Ga0495630_0478397_207_548 113
341 3300047322 Ga0495680_0559154 Ga0495680_0559154_297_638 113
342 3300048909 Ga0496106_1451325 Ga0496106_1451325_142_483 113
343 3300003320 rootH2_10246417 rootH2_102464173 115

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06155

GBBH-like_N

Gamma-butyrobetaine hydroxylase-like, N-terminal

23

103

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3o2g-assembly1.cif.gz_A crystal structure of human gamma-butyrobetaine,2-oxoglutarate dioxygenase 1 (bbox1) 0.8944 3 103
3n6w-assembly1.cif.gz_A-2 crystal structure of human gamma-butyrobetaine hydroxylase 0.8905 3 105
1yfi-assembly2.cif.gz_B crystal structure of restriction endonuclease mspi in complex with its cognate dna in p212121 space group 0.8812 14 28
6npb-assembly1.cif.gz_A x-ray crystal structure of tmpa, 2-trimethylaminoethylphosphonate hydroxylase, with fe and 2og 0.8773 3 96
6npc-assembly1.cif.gz_B x-ray crystal structure of tmpa, 2-trimethylaminoethylphosphonate hydroxylase, with fe, 2og, and 2-trimethylaminoethylphosphonate 0.8756 3 95
ID Description Score Start End Superfamily
af_A0A1D8PNJ2_5_94_3.30.2020.30 Alpha Beta;2-Layer Sandwich;NE0471 N-terminal domain-like; 0.9202 6 95 3.30.2020.30
af_Q9VDM7_3_81_3.30.2020.30 Alpha Beta;2-Layer Sandwich;NE0471 N-terminal domain-like; 0.9177 30 92 3.30.2020.30
af_Q0JJS8_426_515_3.30.2020.30 Alpha Beta;2-Layer Sandwich;NE0471 N-terminal domain-like; 0.905 13 92 3.30.2020.30
af_E7F0M9_49_126_3.30.2020.30 Alpha Beta;2-Layer Sandwich;NE0471 N-terminal domain-like; 0.9003 22 92 3.30.2020.30
3ms5A01 Alpha Beta;2-Layer Sandwich;NE0471 N-terminal domain-like; 0.8914 3 97 3.30.2020.30
ID Description Score Start End GO Terms
AF-A0A5C7MXK3-F1-model_v4 DUF971 domain-containing protein 0.9912 1 105 GO:0046872
AF-A0A800K0R6-F1-model_v4 DUF971 domain-containing protein 0.9877 27 92 GO:0046872
AF-A0A7Y6PUA6-F1-model_v4 DUF971 domain-containing protein 0.9831 1 91 GO:0046872
AF-A0A2E0H1E3-F1-model_v4 Gamma-butyrobetaine hydroxylase-like N-terminal domain-containing protein 0.9757 1 100 GO:0046872
AF-A0A382BC70-F1-model_v4 Gamma-butyrobetaine hydroxylase-like N-terminal domain-containing protein 0.9747 16 93 GO:0046872

Feature Viewer

pLDDT pTM Quality
81.54 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map