F414684

General Info

Members Datasets Scaffolds Average Seq Length
341 157 682 476

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10001917|Ga0070717_100019174
Length 568
Sequence MTGASGATVLELSLEPSELFAGAAGRGLSTGAGELDWARATPANSRQTKPFRNNLKGFLQRRWANKNRSTEQSRFTGPFXLGGTSRQSDNADMSGAPAIFGSKAMRAEKRTVAANSVFAAVAITSLKIIVGITTGSLGILSEAAHSGLDLIAATVTLFSVRVSDKPADADHQYGHGKVENFSAFIETGLLLVTCVVIIYEAVKRLFFHHVDIEPNGAAFLVMFFSMAVDFWRSRALGRIAEKYDSQALQADALHFSTDIWSSGVVVLGLGLVLLGRKFGVAWLIDADPVAALFVGGVIVFVSSRLARKTIDALLDTAPTGARSKIITALRTVDGLLEVDRVRIRRAGNRYFADVSIGLARNVTFQRSGQVADEVTGAVQKILPNTDVVVHSVPRPAFTENIFDRVRAVATRHNLNVHDVSVQDLDGQLHVEQHLEMDERLSLKQAHDRVTLMETEIREEVPEIASILTHIESEPATIEPGEQIARDARLEERLKGVATEFPEILDMHDIKVKRVREHVYVSCHCTFPDELPLSRVHDLSTALEIRFKQEAPELFRVLIHPEPSTDNRR

Samples

Sample ID Description Type Environment
1 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
67 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
68 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
104 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
105 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
106 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
107 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
108 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
109 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
110 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
111 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
112 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
113 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
114 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
115 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
116 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
117 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
122 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
123 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
124 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
125 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
126 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
127 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
128 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
129 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
130 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
131 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
132 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
133 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
134 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
135 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
136 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
137 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
138 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
139 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
140 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
141 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
142 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
143 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
144 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
145 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
146 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
153 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
154 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
155 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
156 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
157 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.41
Metatranscriptomes 0.59
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.81
Rhizosphere 95.89
Stem 0
Stem Tuber 0
Unclassified 20.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070717_10001917 3300006028 Bacteria 14536
2 Ga0065712_10017791 3300005290 Unclassified 1659
3 Ga0070676_10023963 3300005328 Unclassified 3434
4 Ga0070670_100003453 3300005331 Bacteria 13117
5 Ga0068869_100001697 3300005334 Bacteria 13164
6 Ga0070666_10054793 3300005335 Unclassified 2690
7 Ga0070680_100035840 3300005336 Unclassified 4006
8 Ga0070682_100036543 3300005337 Unclassified 3003
9 Ga0068868_100002852 3300005338 Bacteria 11984
10 Ga0068868_100015772 3300005338 Bacteria 5597
11 Ga0068868_100046108 3300005338 Bacteria 3412
12 Ga0070660_100024092 3300005339 Unclassified 4515
13 Ga0070673_100015301 3300005364 Bacteria 5383
14 Ga0070709_10011092 3300005434 Bacteria 5011
15 Ga0070709_10064353 3300005434 Unclassified 2345
16 Ga0070714_100000069 3300005435 Bacteria 93567
17 Ga0070714_100269140 3300005435 Unclassified 1580
18 Ga0070713_100000432 3300005436 Bacteria 26764
19 Ga0070713_100001604 3300005436 Bacteria 14476
20 Ga0070713_100015996 3300005436 Bacteria 5629
21 Ga0070713_100025744 3300005436 Bacteria 4606
22 Ga0070713_100051274 3300005436 Bacteria 3412
23 Ga0070713_100089468 3300005436 Unclassified 2644
24 Ga0070713_100151364 3300005436 Bacteria 2064
25 Ga0070713_100225898 3300005436 Bacteria 1700
26 Ga0070710_10078490 3300005437 Bacteria 1921
27 Ga0070711_100000340 3300005439 Bacteria 24038
28 Ga0070711_100001263 3300005439 Bacteria 13724
29 Ga0070711_100006866 3300005439 Bacteria 6894
30 Ga0070711_100009672 3300005439 Bacteria 5941
31 Ga0070711_100035097 3300005439 Bacteria 3350
32 Ga0070711_100069569 3300005439 Bacteria 2476
33 Ga0070708_100001602 3300005445 Bacteria 17338
34 Ga0070708_100043912 3300005445 Unclassified 3929
35 Ga0070662_100016350 3300005457 Unclassified 4981
36 Ga0070681_10000988 3300005458 Bacteria 24052
37 Ga0070681_10012121 3300005458 Bacteria 8551
38 Ga0070681_10114370 3300005458 Unclassified 2637
39 Ga0070706_100000499 3300005467 Bacteria 45986
40 Ga0070706_100010487 3300005467 Bacteria 8600
41 Ga0070707_100009485 3300005468 Bacteria 9039
42 Ga0070707_100215428 3300005468 Bacteria 1871
43 Ga0070699_100001027 3300005518 Bacteria 25921
44 Ga0070699_100008978 3300005518 Bacteria 8658
45 Ga0070679_100126722 3300005530 Unclassified 2535
46 Ga0070679_100185623 3300005530 Bacteria 2050
47 Ga0070684_100006948 3300005535 Bacteria 8791
48 Ga0070684_100179394 3300005535 Bacteria 1925
49 Ga0070697_100000237 3300005536 Bacteria 44549
50 Ga0070697_100005514 3300005536 Bacteria 9753
51 Ga0070697_100040019 3300005536 Bacteria 3791
52 Ga0068853_100005486 3300005539 Bacteria 9939
53 Ga0068853_100008970 3300005539 Bacteria 8057
54 Ga0068853_100095037 3300005539 Bacteria 2627
55 Ga0068853_100097458 3300005539 Unclassified 2596
56 Ga0068853_100122820 3300005539 Bacteria 2318
57 Ga0068855_100000440 3300005563 Bacteria 51346
58 Ga0068855_100001467 3300005563 Bacteria 29462
59 Ga0068855_100011155 3300005563 Bacteria 10850
60 Ga0070664_100000079 3300005564 Bacteria 61393
61 Ga0068857_100005472 3300005577 Bacteria 10830
62 Ga0068857_100031317 3300005577 Unclassified 4699
63 Ga0068854_100008529 3300005578 Bacteria 6595
64 Ga0068854_100040962 3300005578 Unclassified 3270
65 Ga0068854_100055283 3300005578 Bacteria 2857
66 Ga0068856_100000314 3300005614 Bacteria 53174
67 Ga0068856_100000884 3300005614 Bacteria 32074
68 Ga0068856_100001689 3300005614 Bacteria 23073
69 Ga0068856_100012736 3300005614 Bacteria 8142
70 Ga0068856_100105264 3300005614 Bacteria 2815
71 Ga0068856_100167130 3300005614 Bacteria 2211
72 Ga0068852_100026415 3300005616 Bacteria 4719
73 Ga0068852_100178334 3300005616 Bacteria 1996
74 Ga0068859_100000743 3300005617 Bacteria 32840
75 Ga0068864_100001188 3300005618 Bacteria 21660
76 Ga0068864_100020681 3300005618 Bacteria 5508
77 Ga0068864_100045582 3300005618 Bacteria 3761
78 Ga0068866_10000598 3300005718 Bacteria 16433
79 Ga0068863_100013754 3300005841 Bacteria 7800
80 Ga0068858_100010215 3300005842 Bacteria 8907
81 Ga0068860_100037171 3300005843 Unclassified 4661
82 Ga0068860_100164290 3300005843 Bacteria 2142
83 Ga0070717_10001986 3300006028 Bacteria 14301
84 Ga0070717_10002964 3300006028 Bacteria 12068
85 Ga0070717_10005116 3300006028 Bacteria 9568
86 Ga0070717_10009302 3300006028 Bacteria 7384
87 Ga0070717_10020242 3300006028 Bacteria 5229
88 Ga0070717_10164083 3300006028 Unclassified 1929
89 Ga0070716_100000963 3300006173 Bacteria 12483
90 Ga0070716_100003222 3300006173 Bacteria 7658
91 Ga0070716_100012926 3300006173 Bacteria 4243
92 Ga0070716_100102201 3300006173 Bacteria 1760
93 Ga0070712_100000193 3300006175 Bacteria 33852
94 Ga0070712_100001489 3300006175 Bacteria 14297
95 Ga0070712_100005991 3300006175 Bacteria 7521
96 Ga0097621_100000088 3300006237 Bacteria 49698
97 Ga0097621_100000377 3300006237 Bacteria 31025
98 Ga0097621_100000731 3300006237 Bacteria 22963
99 Ga0097621_100016919 3300006237 Bacteria 5528
100 Ga0097621_100029666 3300006237 Unclassified 4323
101 Ga0068871_100000266 3300006358 Bacteria 35937
102 Ga0068871_100000428 3300006358 Bacteria 29019
103 Ga0068871_100001979 3300006358 Bacteria 13887
104 Ga0068871_100017578 3300006358 Bacteria 5415
105 Ga0075434_100005455 3300006871 Bacteria 11589
106 Ga0075434_100020739 3300006871 Bacteria 6378
107 Ga0075436_100001002 3300006914 Bacteria 18960
108 Ga0075436_100013227 3300006914 Bacteria 5657
109 Ga0075436_100036716 3300006914 Unclassified 3383
110 Ga0075436_100041212 3300006914 Bacteria 3185
111 Ga0097620_100000743 3300006931 Bacteria 32840
112 Ga0075435_100066848 3300007076 Bacteria 2926
113 Ga0105240_10005076 3300009093 Bacteria 19734
114 Ga0105240_10048974 3300009093 Bacteria 5338
115 Ga0105240_10082557 3300009093 Bacteria 3946
116 Ga0105240_10089835 3300009093 Bacteria 3756
117 Ga0105240_10170367 3300009093 Bacteria 2579
118 Ga0105245_10001216 3300009098 Bacteria 23271
119 Ga0114129_10014271 3300009147 Bacteria 11322
120 Ga0114129_10099034 3300009147 Bacteria 4035
121 Ga0105241_10046962 3300009174 Bacteria 3281
122 Ga0105248_10002754 3300009177 Bacteria 19526
123 Ga0105248_10024941 3300009177 Bacteria 6646
124 Ga0105237_10069706 3300009545 Bacteria 3512
125 Ga0105238_10001256 3300009551 Bacteria 25520
126 Ga0105238_10235284 3300009551 Bacteria 1809
127 Ga0105239_10176903 3300010375 Unclassified 2387
128 Ga0105246_10020579 3300011119 Unclassified 4234
129 Ga0157373_10021421 3300013100 Unclassified 4696
130 Ga0157373_10053080 3300013100 Unclassified 2882
131 Ga0157370_10060115 3300013104 Unclassified 3609
132 Ga0157369_10000196 3300013105 Bacteria 84536
133 Ga0157369_10000442 3300013105 Bacteria 55048
134 Ga0157369_10016488 3300013105 Bacteria 8309
135 Ga0157369_10025174 3300013105 Bacteria 6608
136 Ga0157369_10034127 3300013105 Bacteria 5586
137 Ga0157369_10043009 3300013105 Unclassified 4925
138 Ga0157369_10050392 3300013105 Bacteria 4510
139 Ga0157369_10062346 3300013105 Bacteria 4018
140 Ga0157374_10000989 3300013296 Bacteria 24633
141 Ga0157374_10001078 3300013296 Bacteria 23634
142 Ga0157374_10001572 3300013296 Bacteria 19190
143 Ga0157374_10046865 3300013296 Unclassified 4005
144 Ga0157374_10199926 3300013296 Unclassified 1957
145 Ga0157374_10273060 3300013296 Unclassified 1667
146 Ga0157378_10000057 3300013297 Bacteria 96589
147 Ga0157378_10000058 3300013297 Bacteria 96172
148 Ga0157378_10000500 3300013297 Bacteria 37186
149 Ga0157378_10003193 3300013297 Bacteria 14566
150 Ga0163162_10061087 3300013306 Unclassified 3806
151 Ga0163162_10184933 3300013306 Bacteria 2210
152 Ga0163162_10309995 3300013306 Unclassified 1711
153 Ga0157372_10000200 3300013307 Bacteria 66086
154 Ga0157372_10000379 3300013307 Bacteria 49273
155 Ga0157372_10002913 3300013307 Bacteria 18517
156 Ga0157372_10003854 3300013307 Bacteria 16121
157 Ga0157372_10004695 3300013307 Bacteria 14508
158 Ga0157372_10016945 3300013307 Bacteria 7823
159 Ga0157372_10034567 3300013307 Bacteria 5557
160 Ga0157372_10035397 3300013307 Bacteria 5497
161 Ga0163163_10018737 3300014325 Bacteria 6488
162 Ga0163163_10030385 3300014325 Bacteria 5206
163 Ga0182008_10015208 3300014497 Unclassified 4018
164 Ga0157376_10085692 3300014969 Bacteria 2715
165 Ga0182006_1031108 3300015261 Bacteria 2153
166 Ga0182007_10003201 3300015262 Bacteria 7812
167 Ga0182007_10005454 3300015262 Bacteria 5582
168 Ga0206356_11684388 3300020070 Unclassified 2982
169 Ga0224712_10024490 3300022467 Unclassified 2109
170 Ga0228598_1000339 3300024227 Bacteria 9214
171 Ga0207692_10001160 3300025898 Bacteria 9728
172 Ga0207692_10002644 3300025898 Bacteria 6892
173 Ga0207642_10003926 3300025899 Bacteria 4742
174 Ga0207699_10037774 3300025906 Unclassified 2763
175 Ga0207699_10135783 3300025906 Bacteria 1611
176 Ga0207684_10002771 3300025910 Bacteria 17451
177 Ga0207684_10008622 3300025910 Bacteria 9059
178 Ga0207654_10039377 3300025911 Bacteria 2658
179 Ga0207707_10000617 3300025912 Bacteria 35411
180 Ga0207707_10002456 3300025912 Bacteria 16676
181 Ga0207695_10037036 3300025913 Bacteria 5265
182 Ga0207695_10078736 3300025913 Unclassified 3343
183 Ga0207695_10088023 3300025913 Bacteria 3127
184 Ga0207695_10106204 3300025913 Unclassified 2794
185 Ga0207695_10116263 3300025913 Bacteria 2649
186 Ga0207671_10031296 3300025914 Bacteria 3964
187 Ga0207693_10000689 3300025915 Bacteria 30320
188 Ga0207693_10002941 3300025915 Bacteria 14743
189 Ga0207693_10003255 3300025915 Bacteria 13927
190 Ga0207693_10004721 3300025915 Bacteria 11456
191 Ga0207693_10014039 3300025915 Bacteria 6449
192 Ga0207693_10020004 3300025915 Bacteria 5325
193 Ga0207663_10000541 3300025916 Bacteria 16618
194 Ga0207663_10047321 3300025916 Bacteria 2655
195 Ga0207663_10047639 3300025916 Unclassified 2648
196 Ga0207663_10076216 3300025916 Bacteria 2178
197 Ga0207652_10202843 3300025921 Bacteria 1785
198 Ga0207646_10010353 3300025922 Bacteria 9120
199 Ga0207646_10060333 3300025922 Bacteria 3387
200 Ga0207646_10078909 3300025922 Bacteria 2943
201 Ga0207694_10000743 3300025924 Bacteria 29301
202 Ga0207687_10006138 3300025927 Bacteria 7949
203 Ga0207700_10002500 3300025928 Bacteria 10534
204 Ga0207700_10005755 3300025928 Bacteria 7443
205 Ga0207700_10033529 3300025928 Unclassified 3675
206 Ga0207700_10047164 3300025928 Bacteria 3192
207 Ga0207664_10000084 3300025929 Bacteria 93564
208 Ga0207664_10001858 3300025929 Bacteria 13932
209 Ga0207664_10002513 3300025929 Bacteria 12133
210 Ga0207664_10053970 3300025929 Bacteria 3183
211 Ga0207664_10100969 3300025929 Unclassified 2383
212 Ga0207706_10015387 3300025933 Bacteria 6911
213 Ga0207665_10001295 3300025939 Bacteria 16905
214 Ga0207665_10008299 3300025939 Bacteria 6857
215 Ga0207665_10023580 3300025939 Unclassified 4052
216 Ga0207665_10025633 3300025939 Bacteria 3891
217 Ga0207689_10006133 3300025942 Bacteria 10637
218 Ga0207679_10000766 3300025945 Bacteria 21148
219 Ga0207667_10001753 3300025949 Bacteria 27293
220 Ga0207667_10005888 3300025949 Bacteria 14932
221 Ga0207667_10009198 3300025949 Bacteria 11671
222 Ga0207651_10055354 3300025960 Unclassified 2724
223 Ga0207640_10128126 3300025981 Unclassified 1830
224 Ga0207677_10004651 3300026023 Bacteria 7387
225 Ga0207677_10044591 3300026023 Unclassified 2956
226 Ga0207703_10140907 3300026035 Unclassified 2092
227 Ga0207639_10006272 3300026041 Bacteria 8075
228 Ga0207639_10011494 3300026041 Bacteria 6152
229 Ga0207639_10123036 3300026041 Unclassified 2135
230 Ga0207702_10001299 3300026078 Bacteria 25024
231 Ga0207702_10007803 3300026078 Bacteria 9083
232 Ga0207702_10010170 3300026078 Bacteria 7876
233 Ga0207702_10024223 3300026078 Bacteria 5036
234 Ga0207702_10032645 3300026078 Bacteria 4344
235 Ga0207641_10009919 3300026088 Bacteria 7840
236 Ga0207676_10005664 3300026095 Bacteria 8843
237 Ga0207676_10043992 3300026095 Bacteria 3442
238 Ga0207674_10004610 3300026116 Bacteria 16547
239 Ga0207674_10043972 3300026116 Bacteria 4603
240 Ga0207698_10029873 3300026142 Bacteria 3911
241 Ga0268264_10010583 3300028381 Bacteria 7625
242 Ga0268264_10139720 3300028381 Bacteria 2158
243 Ga0265338_10001963 3300028800 Bacteria 32066
244 Ga0265339_10015912 3300031249 Unclassified 4496
245 Ga0265339_10051888 3300031249 Unclassified 2236
246 Ga0373926_0008092 3300035083 Unclassified 3501
247 Ga0373934_0006504 3300035086 Bacteria 4336
248 Ga0373944_0028144 3300035089 Bacteria 1671
249 Ga0373936_0004722 3300035113 Bacteria 5147
250 Ga0373957_0008137 3300035120 Bacteria 3386
251 Ga0373943_0000009 3300035170 Bacteria 67175
252 Ga0373946_0003102 3300035171 Bacteria 5888
253 Ga0373946_0019887 3300035171 Unclassified 2590
254 Ga0373955_0003705 3300035172 Bacteria 6729
255 Ga0373955_0007748 3300035172 Bacteria 4947
256 Ga0373924_0000371 3300035410 Bacteria 13811
257 Ga0373931_0038084 3300035691 Unclassified 2514
258 Ga0373931_0038577 3300035691 Bacteria 2500
259 Ga0373935_0001716 3300035692 Bacteria 12271
260 Ga0373935_0027698 3300035692 Bacteria 3502
261 Ga0373935_0035950 3300035692 Unclassified 3094
262 Ga0373935_0054596 3300035692 Unclassified 2544
263 Ga0373927_0000539 3300035695 Bacteria 28719
264 Ga0373927_0013639 3300035695 Bacteria 5396
265 Ga0373927_0051398 3300035695 Bacteria 2665
266 Ga0373947_0002046 3300035725 Bacteria 12302
267 Ga0373937_0000060 3300036401 Bacteria 98143
268 Ga0373937_0006927 3300036401 Bacteria 9787
269 Ga0373937_0008946 3300036401 Bacteria 8691
270 Ga0373937_0015512 3300036401 Bacteria 6740
271 Ga0373937_0041998 3300036401 Unclassified 4173
272 Ga0373937_0045185 3300036401 Bacteria 4024
273 Ga0373937_0334293 3300036401 Archaea 1434
274 Ga0373925_0001274 3300037068 Bacteria 22247
275 Ga0373925_0005162 3300037068 Bacteria 9784
276 Ga0373925_0016904 3300037068 Bacteria 5281
277 Ga0373925_0029793 3300037068 Bacteria 4004
278 Ga0373925_0030518 3300037068 Unclassified 3956
279 Ga0395905_0022530 3300037471 Bacteria 5958
280 Ga0395905_0063091 3300037471 Unclassified 3466
281 Ga0395905_0311065 3300037471 Bacteria 1464
282 Ga0436363_0860426 3300039450 Bacteria 3867
283 Ga0436362_1105462 3300039453 Bacteria 6502
284 Ga0451577_0122254 3300042876 Unclassified 2332
285 Ga0466966_0042206 3300044684 Unclassified 2930
286 Ga0466961_0080067 3300044693 Bacteria 2068
287 Ga0466963_0147856 3300044694 Bacteria 1631
288 Ga0466957_0001008 3300044842 Bacteria 14500
289 Ga0466959_0057616 3300045049 Bacteria 2832
290 Ga0451576_0037122 3300045051 Bacteria 5162
291 Ga0466967_0001949 3300045976 Bacteria 12493
292 Ga0466967_0003344 3300045976 Bacteria 10430
293 Ga0466967_0033873 3300045976 Bacteria 4328
294 Ga0466967_0055276 3300045976 Unclassified 3497
295 Ga0466967_0150608 3300045976 Bacteria 2174
296 Ga0495629_0077451 3300046459 Bacteria 2321
297 Ga0495580_0001858 3300046472 Bacteria 18574
298 Ga0495580_0002538 3300046472 Bacteria 15898
299 Ga0495580_0005568 3300046472 Bacteria 10385
300 Ga0495580_0006888 3300046472 Bacteria 9181
301 Ga0495580_0014786 3300046472 Bacteria 5914
302 Ga0495580_0050161 3300046472 Bacteria 2951
303 Ga0495580_0079454 3300046472 Unclassified 2287
304 Ga0495582_0002444 3300046473 Bacteria 10357
305 Ga0495664_0014988 3300046477 Bacteria 4401
306 Ga0495664_0066801 3300046477 Bacteria 2145
307 Ga0495608_0056843 3300046511 Bacteria 2583
308 Ga0495630_0155142 3300046517 Unclassified 1743
309 Ga0495652_0081402 3300046529 Unclassified 2671
310 Ga0495665_0002570 3300046531 Bacteria 9801
311 Ga0495665_0037026 3300046531 Unclassified 2604
312 Ga0495599_0068244 3300046678 Bacteria 2220
313 Ga0495623_0057716 3300046679 Bacteria 2442
314 Ga0495669_0090713 3300046684 Bacteria 1410
315 Ga0495604_0114898 3300047317 Bacteria 1957
316 Ga0495674_0002665 3300047319 Bacteria 17375
317 Ga0495674_0051738 3300047319 Unclassified 3620
318 Ga0495680_0125172 3300047322 Bacteria 1894
319 Ga0495675_0030954 3300047444 Bacteria 3415
320 Ga0495675_0103636 3300047444 Bacteria 1779
321 Ga0495602_0181254 3300048088 Unclassified 1624
322 Ga0496102_0045283 3300048905 Bacteria 3995
323 Ga0496102_0251997 3300048905 Unclassified 1665
324 Ga0496109_0026423 3300048912 Bacteria 5177
325 Ga0496109_0049827 3300048912 Unclassified 3814
326 Ga0496111_0001845 3300048914 Bacteria 12486
327 Ga0496111_0009969 3300048914 Bacteria 6355
328 Ga0496111_0145702 3300048914 Bacteria 1756
329 Ga0496112_0000399 3300048915 Bacteria 28374
330 Ga0496112_0004317 3300048915 Bacteria 12016
331 Ga0496112_0011594 3300048915 Bacteria 8059
332 Ga0496112_0080329 3300048915 Unclassified 3224
333 Ga0496113_0000811 3300048916 Bacteria 16239
334 Ga0496115_0057439 3300048918 Unclassified 3130
335 nmdc:mga0n895_1448_c1 3300050512 Bacteria 17728
336 nmdc:mga0n895_2844_c1 3300050512 Bacteria 13712
337 nmdc:mga0rr50_170332_c1 3300050513 Unclassified 1774
338 nmdc:mga08x19_2739_c1 3300050514 Bacteria 10644
339 nmdc:mga08x19_92238_c1 3300050514 Bacteria 2000
340 Ga0495601_0007031 3300053077 Bacteria 6594
341 Ga0495619_0055687 3300053085 Bacteria 2620
342 Ga0070717_10001917
343 Ga0065712_10017791
344 Ga0070676_10023963
345 Ga0070670_100003453
346 Ga0068869_100001697
347 Ga0070666_10054793
348 Ga0070680_100035840
349 Ga0070682_100036543
350 Ga0068868_100002852
351 Ga0068868_100015772
352 Ga0068868_100046108
353 Ga0070660_100024092
354 Ga0070673_100015301
355 Ga0070709_10011092
356 Ga0070709_10064353
357 Ga0070714_100000069
358 Ga0070714_100269140
359 Ga0070713_100000432
360 Ga0070713_100001604
361 Ga0070713_100015996
362 Ga0070713_100025744
363 Ga0070713_100051274
364 Ga0070713_100089468
365 Ga0070713_100151364
366 Ga0070713_100225898
367 Ga0070710_10078490
368 Ga0070711_100000340
369 Ga0070711_100001263
370 Ga0070711_100006866
371 Ga0070711_100009672
372 Ga0070711_100035097
373 Ga0070711_100069569
374 Ga0070708_100001602
375 Ga0070708_100043912
376 Ga0070662_100016350
377 Ga0070681_10000988
378 Ga0070681_10012121
379 Ga0070681_10114370
380 Ga0070706_100000499
381 Ga0070706_100010487
382 Ga0070707_100009485
383 Ga0070707_100215428
384 Ga0070699_100001027
385 Ga0070699_100008978
386 Ga0070679_100126722
387 Ga0070679_100185623
388 Ga0070684_100006948
389 Ga0070684_100179394
390 Ga0070697_100000237
391 Ga0070697_100005514
392 Ga0070697_100040019
393 Ga0068853_100005486
394 Ga0068853_100008970
395 Ga0068853_100095037
396 Ga0068853_100097458
397 Ga0068853_100122820
398 Ga0068855_100000440
399 Ga0068855_100001467
400 Ga0068855_100011155
401 Ga0070664_100000079
402 Ga0068857_100005472
403 Ga0068857_100031317
404 Ga0068854_100008529
405 Ga0068854_100040962
406 Ga0068854_100055283
407 Ga0068856_100000314
408 Ga0068856_100000884
409 Ga0068856_100001689
410 Ga0068856_100012736
411 Ga0068856_100105264
412 Ga0068856_100167130
413 Ga0068852_100026415
414 Ga0068852_100178334
415 Ga0068859_100000743
416 Ga0068864_100001188
417 Ga0068864_100020681
418 Ga0068864_100045582
419 Ga0068866_10000598
420 Ga0068863_100013754
421 Ga0068858_100010215
422 Ga0068860_100037171
423 Ga0068860_100164290
424 Ga0070717_10001986
425 Ga0070717_10002964
426 Ga0070717_10005116
427 Ga0070717_10009302
428 Ga0070717_10020242
429 Ga0070717_10164083
430 Ga0070716_100000963
431 Ga0070716_100003222
432 Ga0070716_100012926
433 Ga0070716_100102201
434 Ga0070712_100000193
435 Ga0070712_100001489
436 Ga0070712_100005991
437 Ga0097621_100000088
438 Ga0097621_100000377
439 Ga0097621_100000731
440 Ga0097621_100016919
441 Ga0097621_100029666
442 Ga0068871_100000266
443 Ga0068871_100000428
444 Ga0068871_100001979
445 Ga0068871_100017578
446 Ga0075434_100005455
447 Ga0075434_100020739
448 Ga0075436_100001002
449 Ga0075436_100013227
450 Ga0075436_100036716
451 Ga0075436_100041212
452 Ga0097620_100000743
453 Ga0075435_100066848
454 Ga0105240_10005076
455 Ga0105240_10048974
456 Ga0105240_10082557
457 Ga0105240_10089835
458 Ga0105240_10170367
459 Ga0105245_10001216
460 Ga0114129_10014271
461 Ga0114129_10099034
462 Ga0105241_10046962
463 Ga0105248_10002754
464 Ga0105248_10024941
465 Ga0105237_10069706
466 Ga0105238_10001256
467 Ga0105238_10235284
468 Ga0105239_10176903
469 Ga0105246_10020579
470 Ga0157373_10021421
471 Ga0157373_10053080
472 Ga0157370_10060115
473 Ga0157369_10000196
474 Ga0157369_10000442
475 Ga0157369_10016488
476 Ga0157369_10025174
477 Ga0157369_10034127
478 Ga0157369_10043009
479 Ga0157369_10050392
480 Ga0157369_10062346
481 Ga0157374_10000989
482 Ga0157374_10001078
483 Ga0157374_10001572
484 Ga0157374_10046865
485 Ga0157374_10199926
486 Ga0157374_10273060
487 Ga0157378_10000057
488 Ga0157378_10000058
489 Ga0157378_10000500
490 Ga0157378_10003193
491 Ga0163162_10061087
492 Ga0163162_10184933
493 Ga0163162_10309995
494 Ga0157372_10000200
495 Ga0157372_10000379
496 Ga0157372_10002913
497 Ga0157372_10003854
498 Ga0157372_10004695
499 Ga0157372_10016945
500 Ga0157372_10034567
501 Ga0157372_10035397
502 Ga0163163_10018737
503 Ga0163163_10030385
504 Ga0182008_10015208
505 Ga0157376_10085692
506 Ga0182006_1031108
507 Ga0182007_10003201
508 Ga0182007_10005454
509 Ga0206356_11684388
510 Ga0224712_10024490
511 Ga0228598_1000339
512 Ga0207692_10001160
513 Ga0207692_10002644
514 Ga0207642_10003926
515 Ga0207699_10037774
516 Ga0207699_10135783
517 Ga0207684_10002771
518 Ga0207684_10008622
519 Ga0207654_10039377
520 Ga0207707_10000617
521 Ga0207707_10002456
522 Ga0207695_10037036
523 Ga0207695_10078736
524 Ga0207695_10088023
525 Ga0207695_10106204
526 Ga0207695_10116263
527 Ga0207671_10031296
528 Ga0207693_10000689
529 Ga0207693_10002941
530 Ga0207693_10003255
531 Ga0207693_10004721
532 Ga0207693_10014039
533 Ga0207693_10020004
534 Ga0207663_10000541
535 Ga0207663_10047321
536 Ga0207663_10047639
537 Ga0207663_10076216
538 Ga0207652_10202843
539 Ga0207646_10010353
540 Ga0207646_10060333
541 Ga0207646_10078909
542 Ga0207694_10000743
543 Ga0207687_10006138
544 Ga0207700_10002500
545 Ga0207700_10005755
546 Ga0207700_10033529
547 Ga0207700_10047164
548 Ga0207664_10000084
549 Ga0207664_10001858
550 Ga0207664_10002513
551 Ga0207664_10053970
552 Ga0207664_10100969
553 Ga0207706_10015387
554 Ga0207665_10001295
555 Ga0207665_10008299
556 Ga0207665_10023580
557 Ga0207665_10025633
558 Ga0207689_10006133
559 Ga0207679_10000766
560 Ga0207667_10001753
561 Ga0207667_10005888
562 Ga0207667_10009198
563 Ga0207651_10055354
564 Ga0207640_10128126
565 Ga0207677_10004651
566 Ga0207677_10044591
567 Ga0207703_10140907
568 Ga0207639_10006272
569 Ga0207639_10011494
570 Ga0207639_10123036
571 Ga0207702_10001299
572 Ga0207702_10007803
573 Ga0207702_10010170
574 Ga0207702_10024223
575 Ga0207702_10032645
576 Ga0207641_10009919
577 Ga0207676_10005664
578 Ga0207676_10043992
579 Ga0207674_10004610
580 Ga0207674_10043972
581 Ga0207698_10029873
582 Ga0268264_10010583
583 Ga0268264_10139720
584 Ga0265338_10001963
585 Ga0265339_10015912
586 Ga0265339_10051888
587 Ga0373926_0008092
588 Ga0373934_0006504
589 Ga0373944_0028144
590 Ga0373936_0004722
591 Ga0373957_0008137
592 Ga0373943_0000009
593 Ga0373946_0003102
594 Ga0373946_0019887
595 Ga0373955_0003705
596 Ga0373955_0007748
597 Ga0373924_0000371
598 Ga0373931_0038084
599 Ga0373931_0038577
600 Ga0373935_0001716
601 Ga0373935_0027698
602 Ga0373935_0035950
603 Ga0373935_0054596
604 Ga0373927_0000539
605 Ga0373927_0013639
606 Ga0373927_0051398
607 Ga0373947_0002046
608 Ga0373937_0000060
609 Ga0373937_0006927
610 Ga0373937_0008946
611 Ga0373937_0015512
612 Ga0373937_0041998
613 Ga0373937_0045185
614 Ga0373937_0334293
615 Ga0373925_0001274
616 Ga0373925_0005162
617 Ga0373925_0016904
618 Ga0373925_0029793
619 Ga0373925_0030518
620 Ga0395905_0022530
621 Ga0395905_0063091
622 Ga0395905_0311065
623 Ga0436363_0860426
624 Ga0436362_1105462
625 Ga0451577_0122254
626 Ga0466966_0042206
627 Ga0466961_0080067
628 Ga0466963_0147856
629 Ga0466957_0001008
630 Ga0466959_0057616
631 Ga0451576_0037122
632 Ga0466967_0001949
633 Ga0466967_0003344
634 Ga0466967_0033873
635 Ga0466967_0055276
636 Ga0466967_0150608
637 Ga0495629_0077451
638 Ga0495580_0001858
639 Ga0495580_0002538
640 Ga0495580_0005568
641 Ga0495580_0006888
642 Ga0495580_0014786
643 Ga0495580_0050161
644 Ga0495580_0079454
645 Ga0495582_0002444
646 Ga0495664_0014988
647 Ga0495664_0066801
648 Ga0495608_0056843
649 Ga0495630_0155142
650 Ga0495652_0081402
651 Ga0495665_0002570
652 Ga0495665_0037026
653 Ga0495599_0068244
654 Ga0495623_0057716
655 Ga0495669_0090713
656 Ga0495604_0114898
657 Ga0495674_0002665
658 Ga0495674_0051738
659 Ga0495680_0125172
660 Ga0495675_0030954
661 Ga0495675_0103636
662 Ga0495602_0181254
663 Ga0496102_0045283
664 Ga0496102_0251997
665 Ga0496109_0026423
666 Ga0496109_0049827
667 Ga0496111_0001845
668 Ga0496111_0009969
669 Ga0496111_0145702
670 Ga0496112_0000399
671 Ga0496112_0004317
672 Ga0496112_0011594
673 Ga0496112_0080329
674 Ga0496113_0000811
675 Ga0496115_0057439
676 nmdc:mga0n895_1448_c1
677 nmdc:mga0n895_2844_c1
678 nmdc:mga0rr50_170332_c1
679 nmdc:mga08x19_2739_c1
680 nmdc:mga08x19_92238_c1
681 Ga0495601_0007031
682 Ga0495619_0055687

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01545

Cation_efflux

Cation efflux family

114

314

0.97

PF16916

ZT_dimer

Dimerisation domain of Zinc Transporter

485

563

0.96

PF16916

ZT_dimer

Dimerisation domain of Zinc Transporter

317

394

0.95

PF16916

ZT_dimer

Dimerisation domain of Zinc Transporter

396

473

0.9

Map