F414173

General Info

Members Datasets Scaffolds Average Seq Length
340 267 680 361

Family's Representative Sequence

Representative Sequence 3300002987|JGI25159J45721_1000476|JGI25159J45721_100047612
Length 420
Sequence LPETYNGDVDNAERSYKVLAETYNGGEMSDDDFAKRPKGRFERWMSELAARRAAVEKEEPPMMKEIDIAYRTMFAELVQRTHDGQFLADFPLEGWFVTVTVKGRDYWYFDLPTQEGKDKRSYVGPQSDEEITARVKAHKEIKDDLRERRRMVSTLRRAGLPGPDGFAGDVTKALADAGLFRLRAVLIGSVAFSTYAGMIGVRLPSSAMQTGDADFAQDFAISAGVEDSLPPILEVLQSVDPDFRAVPHQADRAKVVAFENAKGYRVEFLTGNRGSDEYTGKPSPMPALGGASAENLRFLDYLIYEPVRTVLLHREGVNVLVPAPERYAVHKLIVSSRRLTDTLGRVKADKDLSQASLLFEGLVKTRQSDAIAVAWEEAWDRGDAWREAITKGLARLPPMGVKALGQALGPEVVEGLLKRQ

Samples

Sample ID Description Type Environment
1 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
16 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
19 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
20 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
21 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
22 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
23 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
24 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
25 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
26 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
27 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
28 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
29 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
30 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
31 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
32 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
33 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
34 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
35 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
36 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
37 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
39 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
40 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
41 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
43 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
44 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
48 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
49 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
50 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
51 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
52 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
53 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
54 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
55 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
56 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
57 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
58 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
59 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
60 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
61 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
62 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
63 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
64 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
65 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
66 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
67 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
68 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
69 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
70 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
71 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
72 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
73 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
74 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
75 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
76 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
77 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
78 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
79 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
80 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
81 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
82 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
83 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
84 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
85 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
86 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
87 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
88 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
89 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
90 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
91 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
92 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
93 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
94 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
95 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
96 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
97 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
98 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
99 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
100 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
101 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
102 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
103 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
104 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
105 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
106 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
107 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
108 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
109 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
110 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
111 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
112 2508501050 Microvirga lupini Lut6 Isolate Nodule
113 2509276019 Ensifer aridi TW10 Isolate Nodule
114 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
115 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
116 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
117 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
118 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
119 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
120 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
121 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
122 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
123 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
124 2516143018 Ensifer sp. BR816 Isolate Nodule
125 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
126 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
127 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
128 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
129 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
130 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
131 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
132 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
133 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
134 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
135 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
136 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
137 2643221557 Ensifer sp. Root558 Isolate Unclassified
138 2643221610 Ensifer sp. Root74 Isolate Unclassified
139 2643221618 Ensifer sp. Root231 Isolate Unclassified
140 2643221655 Ensifer sp. Root1252 Isolate Unclassified
141 2643221659 Ensifer sp. Root127 Isolate Unclassified
142 2643221668 Ensifer sp. Root423 Isolate Unclassified
143 2643221674 Devosia sp. Root436 Isolate Unclassified
144 2643221675 Ensifer sp. Root1298 Isolate Unclassified
145 2643221680 Ensifer sp. Root1312 Isolate Unclassified
146 2643221693 Rhizobium sp. Root491 Isolate Unclassified
147 2643221698 Ensifer sp. Root142 Isolate Unclassified
148 2643221712 Ensifer sp. Root258 Isolate Unclassified
149 2643221723 Ensifer sp. Root278 Isolate Unclassified
150 2643221726 Ensifer sp. Root954 Isolate Unclassified
151 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
152 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
153 2791355266 Rhizobium sp. L43 Isolate Nodule
154 2802429634 Rhizobium anhuiense S10 Isolate Nodule
155 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
156 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
157 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
158 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
159 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
160 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
161 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
162 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
163 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
164 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
165 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
166 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
167 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
168 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
169 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
170 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
171 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
172 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
173 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
174 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
175 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
176 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
177 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
178 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
179 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
180 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
181 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
182 2844163670 Ensifer sp. 1H6 Isolate Unclassified
183 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
184 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
185 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
186 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
187 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
188 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
189 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
190 2902330777 Methylobacterium sp. 2A Isolate Unclassified
191 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
192 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
193 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
194 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
195 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
196 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
197 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
198 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
199 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
200 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
201 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
202 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
203 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
204 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
205 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
206 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
207 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
208 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
209 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
210 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
211 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
212 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
213 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
214 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
215 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
216 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
217 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
218 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
219 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
220 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
221 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
222 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
223 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
224 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
225 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
226 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
227 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
228 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
229 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
230 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
231 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
232 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
233 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
234 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
235 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
236 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
237 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
238 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
239 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
240 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
241 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
242 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
243 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
244 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
245 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
246 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
247 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
248 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
249 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
250 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
251 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
252 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
253 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
254 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
255 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
256 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
257 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
258 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
259 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
260 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
261 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
262 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
263 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
264 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
265 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
266 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
267 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 49.41
Metatranscriptomes 0
Isolates 50.59

Biome Distribution

Category Percentage (%)
Aerial Root 1.18
Bulb 0
Endosphere 26.47
Nodule 37.65
Rhizoplane 1.18
Rhizosphere 16.76
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1000476 3300002987 Bacteria 18463
2 JGI25152J39213_1004914 3300002773 Bacteria 4059
3 JGI25152J39213_1007751 3300002773 Bacteria 2746
4 JGI25159J45721_1000043 3300002987 Bacteria 63751
5 JGI25151J46595_10000401 3300003187 Bacteria 45001
6 JGI25151J46595_10002020 3300003187 Bacteria 12694
7 JGI25151J46595_10002151 3300003187 Bacteria 12232
8 JGI25151J46595_10006144 3300003187 Bacteria 6088
9 JGI25153J46596_10000283 3300003215 Bacteria 38778
10 rootL2_10130727 3300003322 Bacteria 2267
11 rootH1_10030071 3300003323 Bacteria 3908
12 JGI25160J50197_1000078 3300003354 Bacteria 102092
13 JGI25160J50197_1000144 3300003354 Bacteria 63751
14 JGI25160J50197_1000965 3300003354 Bacteria 15018
15 JGI25161J50226_1000059 3300003374 Bacteria 102092
16 JGI25161J50226_1000589 3300003374 Bacteria 15318
17 Ga0055526_1000845 3300003771 Bacteria 22838
18 Ga0055526_1006481 3300003771 Bacteria 6343
19 Ga0055524_1000369 3300003775 Bacteria 39814
20 Ga0055524_1000481 3300003775 Bacteria 31410
21 Ga0055524_1000556 3300003775 Bacteria 28198
22 Ga0055524_1000967 3300003775 Bacteria 18017
23 Ga0055536_1012342 3300003781 Bacteria 3179
24 Ga0055528_1000426 3300003790 Bacteria 33881
25 Ga0055530_10018581 3300003791 Bacteria 2137
26 Ga0055531_10019609 3300003794 Bacteria 2724
27 Ga0058692_1000535 3300003856 Bacteria 16314
28 Ga0058692_1019032 3300003856 Bacteria 1472
29 Ga0055543_1000058 3300004625 Bacteria 102130
30 Ga0055543_1000200 3300004625 Bacteria 49056
31 Ga0055543_1000272 3300004625 Bacteria 38422
32 Ga0065165_1000400 3300005262 Bacteria 69947
33 Ga0065165_1000461 3300005262 Bacteria 63722
34 Ga0065165_1004352 3300005262 Bacteria 8877
35 Ga0065165_1008799 3300005262 Bacteria 4650
36 Ga0075365_10011680 3300006038 Bacteria 5174
37 Ga0075367_10039498 3300006178 Bacteria 2752
38 Ga0075370_10028123 3300006353 Bacteria 3124
39 Ga0123340_1057481 3300009763 Bacteria 1212
40 Ga0123341_1033181 3300009765 Bacteria 3743
41 Ga0123342_1013562 3300009766 Bacteria 8117
42 Ga0105239_10524516 3300010375 Bacteria 1348
43 Ga0157370_10039778 3300013104 Bacteria 4543
44 Ga0171463_1002 3300013249 Bacteria 1274851
45 Ga0214542_1023788 3300021321 Bacteria 3572
46 Ga0214543_1000012 3300021327 Bacteria 338982
47 Ga0209436_100248 3300025208 Bacteria 24774
48 Ga0209672_102114 3300025228 Bacteria 5299
49 Ga0207425_1002850 3300025245 Bacteria 5815
50 Ga0209129_1000082 3300025258 Bacteria 183436
51 Ga0209129_1000635 3300025258 Bacteria 23490
52 Ga0209129_1006015 3300025258 Bacteria 4072
53 Ga0209565_1010785 3300025263 Bacteria 2254
54 Ga0209673_1000621 3300025273 Bacteria 54117
55 Ga0209130_1000221 3300025284 Bacteria 74712
56 Ga0209130_1000274 3300025284 Bacteria 64411
57 Ga0209675_1015726 3300025291 Bacteria 2233
58 Ga0209676_1013845 3300025292 Bacteria 3074
59 Ga0209025_1000162 3300025294 Bacteria 166313
60 Ga0209025_1000172 3300025294 Bacteria 160407
61 Ga0209025_1000418 3300025294 Bacteria 85091
62 Ga0209025_1003198 3300025294 Bacteria 15886
63 Ga0209025_1010774 3300025294 Bacteria 6143
64 Ga0209564_1000341 3300025295 Bacteria 89262
65 Ga0209564_1000980 3300025295 Bacteria 35965
66 Ga0209758_1000603 3300025297 Bacteria 55707
67 Ga0209050_1007234 3300025298 Bacteria 6294
68 Ga0209256_1000565 3300025299 Bacteria 52844
69 Ga0209256_1000613 3300025299 Bacteria 49419
70 Ga0209256_1004219 3300025299 Bacteria 9219
71 Ga0209256_1019632 3300025299 Bacteria 2143
72 Ga0207426_1000083 3300025302 Bacteria 298770
73 Ga0207426_1000299 3300025302 Bacteria 97846
74 Ga0207426_1000460 3300025302 Bacteria 63857
75 Ga0209051_1003660 3300025303 Bacteria 9949
76 Ga0209051_1010437 3300025303 Bacteria 4688
77 Ga0209257_1000599 3300025304 Bacteria 59865
78 Ga0209257_1030378 3300025304 Bacteria 1745
79 Ga0207681_10035660 3300025923 Bacteria 3279
80 Ga0209281_1010258 3300027111 Bacteria 2156
81 Ga0209371_1001372 3300027312 Bacteria 16799
82 Ga0209371_1006453 3300027312 Bacteria 4340
83 Ga0268256_1000478 3300030500 Bacteria 34415
84 Ga0268256_1006198 3300030500 Bacteria 4498
85 Ga0316181_1143019 3300030744 Bacteria 1969
86 Ga0265339_10005824 3300031249 Bacteria 8174
87 Ga0436360_1184978 3300039438 Bacteria 1345
88 Ga0439465_0022504 3300041413 Bacteria 1980
89 Ga0451835_0437321 3300041492 Bacteria 1211
90 Ga0451839_0518423 3300041496 Bacteria 1808
91 Ga0451849_1110458 3300041505 Bacteria 2017
92 Ga0451855_0216182 3300041511 Bacteria 1626
93 Ga0451855_0636974 3300041511 Bacteria 1932
94 Ga0451853_1262808 3300041512 Bacteria 2392
95 Ga0439449_0005094 3300042007 Bacteria 5054
96 Ga0439449_0022451 3300042007 Bacteria 2363
97 Ga0466966_0020474 3300044684 Bacteria 4349
98 Ga0466963_0022773 3300044694 Bacteria 3971
99 Ga0466970_0026701 3300044765 Bacteria 3026
100 Ga0495627_000946 3300046453 Bacteria 19963
101 Ga0495638_0000673 3300046460 Bacteria 37126
102 Ga0495583_0003376 3300046506 Bacteria 12256
103 Ga0495606_0001021 3300046507 Bacteria 40583
104 Ga0495610_0000011 3300046512 Bacteria 518476
105 Ga0495631_0002715 3300046518 Bacteria 9816
106 Ga0495632_0014403 3300046519 Bacteria 4476
107 Ga0495643_0022404 3300046522 Bacteria 3605
108 Ga0495643_0121018 3300046522 Bacteria 1322
109 Ga0495648_0157660 3300046524 Bacteria 1177
110 Ga0495587_0041479 3300046536 Bacteria 2746
111 Ga0495633_0000210 3300046558 Bacteria 73666
112 Ga0495625_0000592 3300046660 Bacteria 52738
113 Ga0495625_0005601 3300046660 Bacteria 11386
114 Ga0495625_0009258 3300046660 Bacteria 8263
115 Ga0495661_0000976 3300046665 Bacteria 25857
116 Ga0495657_0041452 3300046675 Bacteria 3150
117 Ga0495670_0055770 3300046691 Bacteria 1982
118 Ga0495600_0035501 3300046809 Bacteria 3238
119 Ga0495660_0024662 3300046810 Bacteria 3425
120 Ga0495604_0100753 3300047317 Bacteria 2123
121 Ga0495672_0094141 3300047320 Bacteria 1639
122 Ga0495687_001136 3300047443 Bacteria 25798
123 Ga0495673_0020709 3300047469 Bacteria 3268
124 Ga0495686_0014964 3300047472 Bacteria 5320
125 Ga0496106_0010234 3300048909 Bacteria 6933
126 Ga0496107_0044274 3300048910 Bacteria 3199
127 Ga0496116_0079404 3300048919 Bacteria 2042
128 Ga0496117_0001295 3300048920 Bacteria 36825
129 Ga0496117_0106349 3300048920 Bacteria 1761
130 Ga0496118_0013266 3300048921 Bacteria 7811
131 Ga0496121_0017254 3300048924 Bacteria 7387
132 Ga0496121_0088736 3300048924 Bacteria 2423
133 Ga0496122_0002889 3300048925 Bacteria 23500
134 Ga0496122_0074282 3300048925 Bacteria 2406
135 Ga0496122_0078908 3300048925 Bacteria 2303
136 Ga0496123_0021093 3300048926 Bacteria 5075
137 Ga0496123_0044309 3300048926 Bacteria 3043
138 Ga0496123_0085631 3300048926 Bacteria 1895
139 Ga0496124_0001740 3300048927 Bacteria 30540
140 Ga0496124_0007110 3300048927 Bacteria 11986
141 Ga0496125_0001126 3300048928 Bacteria 40818
142 Ga0496125_0038776 3300048928 Bacteria 4114
143 Ga0496126_0001991 3300048929 Bacteria 28960
144 Ga0496126_0012584 3300048929 Bacteria 8659
145 nmdc:mga03683_381_c1 3300050489 Bacteria 12697
146 nmdc:mga00v17_103784_c1 3300050491 Bacteria 1797
147 nmdc:mga00v17_219_c1 3300050491 Bacteria 34370
148 nmdc:mga0yw44_14516_c1 3300050492 Bacteria 4187
149 nmdc:mga0yw44_56_c1 3300050492 Bacteria 40187
150 nmdc:mga0k408_50114_c1 3300050493 Bacteria 2417
151 nmdc:mga06z11_7567_c1 3300050494 Bacteria 4480
152 nmdc:mga07m45_181987_c1 3300050496 Bacteria 1222
153 nmdc:mga07m45_27715_c1 3300050496 Bacteria 3123
154 nmdc:mga07m45_8868_c1 3300050496 Bacteria 5191
155 nmdc:mga07m45_94_c1 3300050496 Bacteria 34655
156 Ga0500578_0032239 3300053086 Bacteria 3368
157 Ga0500651_0035555 3300053093 Bacteria 3139
158 Ga0500560_000051 3300053107 Bacteria 11425
159 Ga0500560_000223 3300053107 Bacteria 6898
160 Ga0500608_000111 3300053122 Bacteria 33608
161 Ga0500658_0028733 3300053134 Bacteria 2160
162 Ga0500568_0000291 3300053139 Bacteria 41336
163 Ga0500577_0071387 3300053142 Bacteria 1363
164 Ga0500616_0006990 3300053153 Bacteria 7260
165 Ga0500616_0009536 3300053153 Bacteria 5899
166 Ga0500616_0039835 3300053153 Bacteria 2530
167 Ga0500624_000141 3300053157 Bacteria 30539
168 Ga0500634_0023914 3300053161 Bacteria 3321
169 2508730303 2508501050 Bacteria 9633614
170 2509377610 2509276019 Bacteria 6802256
171 2510306882 2510065057 Bacteria 6649661
172 2512530679 2512047086 Bacteria 6850303
173 2513594963 2513237088 Bacteria 6927906
174 2513620986 2513237091 Bacteria 6900273
175 2513709637 2513237103 Bacteria 7647401
176 2513869589 2513237138 Bacteria 7368160
177 2513883196 2513237140 Bacteria 7076289
178 2513923944 2513237146 Bacteria 7166346
179 2515115450 2515075009 Bacteria 7288508
180 2515636546 2515154113 Bacteria 7807172
181 2516206403 2516143018 Bacteria 6951533
182 2516897577 2516653046 Bacteria 6989037
183 2517042126 2516653077 Bacteria 7555578
184 2517093610 2517093000 Bacteria 7412387
185 2551714465 2551306089 Bacteria 7162724
186 2558865149 2558860100 Bacteria 8458965
187 2585203932 2582581294 Bacteria 6626667
188 2585227799 2582581299 Bacteria 6518058
189 2585231578 2582581299 Bacteria 6518058
190 2585259000 2582581304 Bacteria 5831370
191 2585823191 2585427590 Bacteria 6824633
192 2587983634 2585428125 Bacteria 6662905
193 2599415987 2599185170 Bacteria 7295545
194 2600195925 2599185352 Bacteria 7228948
195 2600196375 2599185352 Bacteria 7228948
196 2643806468 2643221557 Bacteria 7184309
197 2644065295 2643221610 Bacteria 7480339
198 2644106789 2643221618 Bacteria 7717186
199 2644309861 2643221655 Bacteria 7722067
200 2644337142 2643221659 Bacteria 7890716
201 2644376679 2643221668 Bacteria 7306521
202 2644413660 2643221674 Bacteria 3919126
203 2644416894 2643221675 Bacteria 7473456
204 2644449934 2643221680 Bacteria 7473610
205 2644520524 2643221693 Bacteria 5513853
206 2644540544 2643221698 Bacteria 7756764
207 2644616312 2643221712 Bacteria 7729434
208 2644674594 2643221723 Bacteria 7095460
209 2644687027 2643221726 Bacteria 7455827
210 2692317970 2690316117 Bacteria 6800650
211 2778174799 2775507266 Bacteria 7392367
212 2793360847 2791355266 Bacteria 7116587
213 2793360892 2791355266 Bacteria 7116587
214 2806055616 2802429634 Bacteria 7083200
215 2806061358 2802429635 Bacteria 7650140
216 2806069880 2802429636 Bacteria 7597525
217 2819562179 2818991439 Bacteria 6907412
218 2838036103 2838035591 Bacteria 7166484
219 2838667331 2838661181 Bacteria 7385261
220 2838679347 2838675328 Bacteria 4909118
221 2838680008 2838675328 Bacteria 4909118
222 2838680921 2838680041 Bacteria 6545511
223 2838695045 2838694306 Bacteria 6853137
224 2838708422 2838707686 Bacteria 6619912
225 2838719512 2838714209 Bacteria 5525906
226 2838719575 2838714209 Bacteria 5525906
227 2838724887 2838719591 Bacteria 5523910
228 2838724951 2838719591 Bacteria 5523910
229 2838729025 2838724970 Bacteria 4908691
230 2838729668 2838724970 Bacteria 4908691
231 2842080345 2842077413 Bacteria 6508645
232 2842120964 2842118031 Bacteria 7033875
233 2842134249 2842130223 Bacteria 4909145
234 2842134911 2842130223 Bacteria 4909145
235 2842156245 2842152218 Bacteria 4908957
236 2842156908 2842152218 Bacteria 4908957
237 2842175757 2842170452 Bacteria 5525737
238 2842175821 2842170452 Bacteria 5525737
239 2842179661 2842175837 Bacteria 4908771
240 2842180533 2842175837 Bacteria 4908771
241 2842192613 2842187318 Bacteria 5524014
242 2842192677 2842187318 Bacteria 5524014
243 2842216966 2842211629 Bacteria 5523832
244 2842216993 2842211629 Bacteria 5523832
245 2842229643 2842224351 Bacteria 5524473
246 2842229714 2842224351 Bacteria 5524473
247 2842237834 2842237096 Bacteria 6620661
248 2842294004 2842291075 Bacteria 7076806
249 2842371385 2842370503 Bacteria 7038661
250 2842380401 2842377471 Bacteria 7140707
251 2842387472 2842384541 Bacteria 7057858
252 2842515645 2842509118 Bacteria 6850950
253 2844166090 2844163670 Bacteria 7266046
254 2844168616 2844163670 Bacteria 7266046
255 2847423528 2847417321 Bacteria 6913799
256 2848998597 2848992105 Bacteria 6810864
257 2850084862 2850079185 Bacteria 6848280
258 2852393605 2852387548 Bacteria 8025568
259 2855844381 2855839649 Bacteria 7135830
260 2896388914 2896384573 Bacteria 7700774
261 2899849568 2899845264 Bacteria 5672268
262 2902334020 2902330777 Bacteria 6395352
263 2916002747 2916000859 Bacteria 6865702
264 2916014742 2916014648 Bacteria 6946486
265 2916025237 2916021584 Bacteria 6854472
266 2916029433 2916028427 Bacteria 6748433
267 2916045419 2916041962 Bacteria 6820487
268 2916051275 2916048683 Bacteria 6543552
269 2916061750 2916055098 Bacteria 6758838
270 2916078250 2916076590 Bacteria 6596108
271 2919117653 2919114240 Bacteria 5700270
272 2921239612 2921237296 Bacteria 6876710
273 2921257790 2921257292 Bacteria 6808382
274 2921264472 2921263974 Bacteria 6864552
275 2924173870 2924172951 Bacteria 6749356
276 2924185733 2924179722 Bacteria 6843264
277 2926759379 2926754445 Bacteria 5964435
278 2926763113 2926760298 Bacteria 5505990
279 2933010061 2933006813 Bacteria 4912075
280 2933011427 2933006813 Bacteria 4912075
281 2933018217 2933016740 Bacteria 6355406
282 2935895568 2935894831 Bacteria 6620579
283 2936368611 2936367885 Bacteria 7324495
284 2936377704 2936375103 Bacteria 6652732
285 2937004184 2937002841 Bacteria 6934057
286 2937011665 2937009748 Bacteria 6746052
287 2937029095 2937023124 Bacteria 6815156
288 2937044897 2937042894 Bacteria 6741576
289 2937054225 2937049772 Bacteria 6757901
290 2937078264 2937071275 Bacteria 6984483
291 2937132151 2937126314 Bacteria 6771275
292 2941505451 2941499720 Bacteria 7599444
293 2957385273 2957382221 Bacteria 6737050
294 2957393503 2957388812 Bacteria 6778072
295 2957396146 2957395598 Bacteria 6822399
296 2957405723 2957402308 Bacteria 6741770
297 2957414306 2957408893 Bacteria 6558585
298 2957446088 2957443900 Bacteria 6869977
299 2957453559 2957450854 Bacteria 6765715
300 2957484363 2957478035 Bacteria 6756658
301 2960614545 2960610863 Bacteria 6691244
302 2960624020 2960617483 Bacteria 6727748
303 2960628435 2960624210 Bacteria 6875384
304 2960663612 2960660292 Bacteria 7041660
305 2964615857 2964615318 Bacteria 6809089
306 2964641486 2964636051 Bacteria 7091832
307 2964653200 2964649959 Bacteria 6675118
308 2964703103 2964698721 Bacteria 6765331
309 2964711607 2964705432 Bacteria 7114648
310 2967762245 2967755722 Bacteria 6814706
311 2967778091 2967775926 Bacteria 6738189
312 2970045769 2970040964 Bacteria 6731123
313 2970097439 2970095765 Bacteria 6936963
314 2970108735 2970102677 Bacteria 6812532
315 2970118931 2970116247 Bacteria 6501857
316 2970176338 2970170962 Bacteria 6876229
317 2970181622 2970177841 Bacteria 6768001
318 2977522355 2977516862 Bacteria 6940108
319 2977525741 2977523885 Bacteria 6960446
320 2977568551 2977565890 Bacteria 6901543
321 2977584650 2977579622 Bacteria 6772100
322 2979103281 2979100975 Bacteria 5423623
323 2984514042 2984509177 Bacteria 5274802
324 2984523073 2984518228 Bacteria 5277463
325 2984542390 2984537506 Bacteria 5277481
326 2984606295 2984601300 Bacteria 5455244
327 3005418278 3005416602 Bacteria 7064308
328 639651558 639633055 Bacteria 7751309
329 643823353 643692032 Bacteria 6891900
330 650842293 650716007 Bacteria 5573770
331 8003997788 8003992118 Bacteria 7266902
332 8005292341 8005289223 Bacteria 6634003
333 8005304174 8005301065 Bacteria 6614431
334 8005316048 8005314921 Bacteria 7072929
335 8005377114 8005376324 Bacteria 6590079
336 8005466675 8005460587 Bacteria 7157962
337 8005569930 8005563573 Bacteria 7153261
338 8005687070 8005682033 Bacteria 6726518
339 8005690600 8005688590 Bacteria 6610080
340 8024480605 8024479707 Bacteria 6954785
341 JGI25159J45721_1000476
342 JGI25152J39213_1004914
343 JGI25152J39213_1007751
344 JGI25159J45721_1000043
345 JGI25151J46595_10000401
346 JGI25151J46595_10002020
347 JGI25151J46595_10002151
348 JGI25151J46595_10006144
349 JGI25153J46596_10000283
350 rootL2_10130727
351 rootH1_10030071
352 JGI25160J50197_1000078
353 JGI25160J50197_1000144
354 JGI25160J50197_1000965
355 JGI25161J50226_1000059
356 JGI25161J50226_1000589
357 Ga0055526_1000845
358 Ga0055526_1006481
359 Ga0055524_1000369
360 Ga0055524_1000481
361 Ga0055524_1000556
362 Ga0055524_1000967
363 Ga0055536_1012342
364 Ga0055528_1000426
365 Ga0055530_10018581
366 Ga0055531_10019609
367 Ga0058692_1000535
368 Ga0058692_1019032
369 Ga0055543_1000058
370 Ga0055543_1000200
371 Ga0055543_1000272
372 Ga0065165_1000400
373 Ga0065165_1000461
374 Ga0065165_1004352
375 Ga0065165_1008799
376 Ga0075365_10011680
377 Ga0075367_10039498
378 Ga0075370_10028123
379 Ga0123340_1057481
380 Ga0123341_1033181
381 Ga0123342_1013562
382 Ga0105239_10524516
383 Ga0157370_10039778
384 Ga0171463_1002
385 Ga0214542_1023788
386 Ga0214543_1000012
387 Ga0209436_100248
388 Ga0209672_102114
389 Ga0207425_1002850
390 Ga0209129_1000082
391 Ga0209129_1000635
392 Ga0209129_1006015
393 Ga0209565_1010785
394 Ga0209673_1000621
395 Ga0209130_1000221
396 Ga0209130_1000274
397 Ga0209675_1015726
398 Ga0209676_1013845
399 Ga0209025_1000162
400 Ga0209025_1000172
401 Ga0209025_1000418
402 Ga0209025_1003198
403 Ga0209025_1010774
404 Ga0209564_1000341
405 Ga0209564_1000980
406 Ga0209758_1000603
407 Ga0209050_1007234
408 Ga0209256_1000565
409 Ga0209256_1000613
410 Ga0209256_1004219
411 Ga0209256_1019632
412 Ga0207426_1000083
413 Ga0207426_1000299
414 Ga0207426_1000460
415 Ga0209051_1003660
416 Ga0209051_1010437
417 Ga0209257_1000599
418 Ga0209257_1030378
419 Ga0207681_10035660
420 Ga0209281_1010258
421 Ga0209371_1001372
422 Ga0209371_1006453
423 Ga0268256_1000478
424 Ga0268256_1006198
425 Ga0316181_1143019
426 Ga0265339_10005824
427 Ga0436360_1184978
428 Ga0439465_0022504
429 Ga0451835_0437321
430 Ga0451839_0518423
431 Ga0451849_1110458
432 Ga0451855_0216182
433 Ga0451855_0636974
434 Ga0451853_1262808
435 Ga0439449_0005094
436 Ga0439449_0022451
437 Ga0466966_0020474
438 Ga0466963_0022773
439 Ga0466970_0026701
440 Ga0495627_000946
441 Ga0495638_0000673
442 Ga0495583_0003376
443 Ga0495606_0001021
444 Ga0495610_0000011
445 Ga0495631_0002715
446 Ga0495632_0014403
447 Ga0495643_0022404
448 Ga0495643_0121018
449 Ga0495648_0157660
450 Ga0495587_0041479
451 Ga0495633_0000210
452 Ga0495625_0000592
453 Ga0495625_0005601
454 Ga0495625_0009258
455 Ga0495661_0000976
456 Ga0495657_0041452
457 Ga0495670_0055770
458 Ga0495600_0035501
459 Ga0495660_0024662
460 Ga0495604_0100753
461 Ga0495672_0094141
462 Ga0495687_001136
463 Ga0495673_0020709
464 Ga0495686_0014964
465 Ga0496106_0010234
466 Ga0496107_0044274
467 Ga0496116_0079404
468 Ga0496117_0001295
469 Ga0496117_0106349
470 Ga0496118_0013266
471 Ga0496121_0017254
472 Ga0496121_0088736
473 Ga0496122_0002889
474 Ga0496122_0074282
475 Ga0496122_0078908
476 Ga0496123_0021093
477 Ga0496123_0044309
478 Ga0496123_0085631
479 Ga0496124_0001740
480 Ga0496124_0007110
481 Ga0496125_0001126
482 Ga0496125_0038776
483 Ga0496126_0001991
484 Ga0496126_0012584
485 nmdc:mga03683_381_c1
486 nmdc:mga00v17_103784_c1
487 nmdc:mga00v17_219_c1
488 nmdc:mga0yw44_14516_c1
489 nmdc:mga0yw44_56_c1
490 nmdc:mga0k408_50114_c1
491 nmdc:mga06z11_7567_c1
492 nmdc:mga07m45_181987_c1
493 nmdc:mga07m45_27715_c1
494 nmdc:mga07m45_8868_c1
495 nmdc:mga07m45_94_c1
496 Ga0500578_0032239
497 Ga0500651_0035555
498 Ga0500560_000051
499 Ga0500560_000223
500 Ga0500608_000111
501 Ga0500658_0028733
502 Ga0500568_0000291
503 Ga0500577_0071387
504 Ga0500616_0006990
505 Ga0500616_0009536
506 Ga0500616_0039835
507 Ga0500624_000141
508 Ga0500634_0023914
509 2508730303
510 2509377610
511 2510306882
512 2512530679
513 2513594963
514 2513620986
515 2513709637
516 2513869589
517 2513883196
518 2513923944
519 2515115450
520 2515636546
521 2516206403
522 2516897577
523 2517042126
524 2517093610
525 2551714465
526 2558865149
527 2585203932
528 2585227799
529 2585231578
530 2585259000
531 2585823191
532 2587983634
533 2599415987
534 2600195925
535 2600196375
536 2643806468
537 2644065295
538 2644106789
539 2644309861
540 2644337142
541 2644376679
542 2644413660
543 2644416894
544 2644449934
545 2644520524
546 2644540544
547 2644616312
548 2644674594
549 2644687027
550 2692317970
551 2778174799
552 2793360847
553 2793360892
554 2806055616
555 2806061358
556 2806069880
557 2819562179
558 2838036103
559 2838667331
560 2838679347
561 2838680008
562 2838680921
563 2838695045
564 2838708422
565 2838719512
566 2838719575
567 2838724887
568 2838724951
569 2838729025
570 2838729668
571 2842080345
572 2842120964
573 2842134249
574 2842134911
575 2842156245
576 2842156908
577 2842175757
578 2842175821
579 2842179661
580 2842180533
581 2842192613
582 2842192677
583 2842216966
584 2842216993
585 2842229643
586 2842229714
587 2842237834
588 2842294004
589 2842371385
590 2842380401
591 2842387472
592 2842515645
593 2844166090
594 2844168616
595 2847423528
596 2848998597
597 2850084862
598 2852393605
599 2855844381
600 2896388914
601 2899849568
602 2902334020
603 2916002747
604 2916014742
605 2916025237
606 2916029433
607 2916045419
608 2916051275
609 2916061750
610 2916078250
611 2919117653
612 2921239612
613 2921257790
614 2921264472
615 2924173870
616 2924185733
617 2926759379
618 2926763113
619 2933010061
620 2933011427
621 2933018217
622 2935895568
623 2936368611
624 2936377704
625 2937004184
626 2937011665
627 2937029095
628 2937044897
629 2937054225
630 2937078264
631 2937132151
632 2941505451
633 2957385273
634 2957393503
635 2957396146
636 2957405723
637 2957414306
638 2957446088
639 2957453559
640 2957484363
641 2960614545
642 2960624020
643 2960628435
644 2960663612
645 2964615857
646 2964641486
647 2964653200
648 2964703103
649 2964711607
650 2967762245
651 2967778091
652 2970045769
653 2970097439
654 2970108735
655 2970118931
656 2970176338
657 2970181622
658 2977522355
659 2977525741
660 2977568551
661 2977584650
662 2979103281
663 2984514042
664 2984523073
665 2984542390
666 2984606295
667 3005418278
668 639651558
669 643823353
670 650842293
671 8003997788
672 8005292341
673 8005304174
674 8005316048
675 8005377114
676 8005466675
677 8005569930
678 8005687070
679 8005690600
680 8024480605

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12281

NTP_transf_8

Nucleotidyltransferase

166

380

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1r18-assembly1.cif.gz_A drosophila protein isoaspartyl methyltransferase with s-adenosyl-l-homocysteine 0.7372 33 64
7zv1-assembly1.cif.gz_A crystal structure of aichivirus a 2a protein l64m, l109m mutant 0.7164 33 59
1kr5-assembly1.cif.gz_A crystal structure of human l-isoaspartyl methyltransferase 0.7131 33 64
7zv1-assembly3.cif.gz_C crystal structure of aichivirus a 2a protein l64m, l109m mutant 0.7124 33 59
6nz6-assembly1.cif.gz_A ycjx-gdp (type ii) 0.6849 33 64
ID Description Score Start End Superfamily
af_F4J466_1_159_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.7301 29 68 2.120.10.80
af_Q86HX8_66_281_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.7243 31 66 2.120.10.30
1kr5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7131 33 64 3.40.50.150
af_F4J8W8_1_194_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.6967 29 69 2.120.10.80
af_Q9LIK3_1_199_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.692 30 68 2.120.10.80
ID Description Score Start End GO Terms
AF-A0A256FPQ9-F1-model_v4 Nucleotidyl transferase AbiEii/AbiGii toxin family protein 0.9172 91 358
AF-A0A256FPQ9-F1-model_v4 Nucleotidyl transferase AbiEii/AbiGii toxin family protein 0.9105 91 358
AF-A0A2N8JSZ2-F1-model_v4 deleted 0.8821 121 348
AF-A0A530GGI8-F1-model_v4 Uncharacterized protein 0.8776 124 217
AF-A0A117MSQ3-F1-model_v4 Uncharacterized protein 0.8732 260 352

Map