F412336

General Info

Members Datasets Scaffolds Average Seq Length
335 182 670 183

Family's Representative Sequence

Representative Sequence 3300039453|Ga0436362_0910542|Ga0436362_0910542_152_763
Length 203
Sequence LISRFPGELKLWHPVAVQPRSEEALIQIRDVLLETYAVNDAMNQLLLAHLDRRAWRAQLPNGKRSAGRSIAAIFAHLHNNRLLWLRNSAPHLKCPAPLDPARCTIRQAASAHRKSAAQCVRMLSEALSTDLNRKVTKFSRGWGRKWNAGAAMFAYMFSHEAHHRGQILMLAHQLGYRLPDHAAYGIWQWDKLWMEHGFTSRPR

Samples

Sample ID Description Type Environment
1 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
83 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
84 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
129 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
132 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
133 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
134 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
135 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
136 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
137 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
138 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
139 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
140 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
141 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
142 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
143 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
144 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
145 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
146 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
148 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
149 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
152 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
153 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
156 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
157 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
158 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
159 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
160 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
161 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
162 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
163 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
164 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
165 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
166 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
167 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
168 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
169 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
170 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
171 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
172 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
180 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
181 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
182 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.51
Metatranscriptomes 1.49
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.39
Rhizosphere 97.61
Stem 0
Stem Tuber 0
Unclassified 19.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436362_0910542 3300039453 Bacteria 1260
2 MBSR1b_contig_12759690 2162886012 Bacteria 2000
3 MBSR1b_contig_12891285 2162886012 Bacteria 2260
4 Ga0070683_100074378 3300005329 Bacteria 3173
5 Ga0068869_100100885 3300005334 Bacteria 2183
6 Ga0070680_100602886 3300005336 Bacteria 943
7 Ga0068868_100007450 3300005338 Bacteria 7793
8 Ga0068868_100030942 3300005338 Bacteria 4107
9 Ga0070689_100259070 3300005340 Bacteria 1437
10 Ga0070661_100281194 3300005344 Bacteria 1291
11 Ga0070661_100768280 3300005344 Bacteria 789
12 Ga0070675_100260033 3300005354 Bacteria 1521
13 Ga0070688_100285903 3300005365 Bacteria 1187
14 Ga0070659_100375721 3300005366 Bacteria 1196
15 Ga0070703_10099794 3300005406 Unclassified 1021
16 Ga0070709_10008214 3300005434 Unclassified 5733
17 Ga0070709_10218198 3300005434 Unclassified 1359
18 Ga0070714_100001619 3300005435 Bacteria 16373
19 Ga0070714_100002437 3300005435 Bacteria 13712
20 Ga0070713_100029906 3300005436 Bacteria 4320
21 Ga0070713_100135318 3300005436 Bacteria 2177
22 Ga0070713_100739575 3300005436 Bacteria 940
23 Ga0070711_100391283 3300005439 Unclassified 1126
24 Ga0070705_100001066 3300005440 Bacteria 15258
25 Ga0070705_100186269 3300005440 Bacteria 1410
26 Ga0070705_100805507 3300005440 Bacteria 748
27 Ga0070694_100063991 3300005444 Unclassified 2517
28 Ga0070708_100005667 3300005445 Bacteria 9904
29 Ga0070708_101047763 3300005445 Bacteria 764
30 Ga0070678_100445935 3300005456 Bacteria 1133
31 Ga0070662_100298685 3300005457 Bacteria 1308
32 Ga0070681_10023869 3300005458 Bacteria 6157
33 Ga0070681_10032550 3300005458 Bacteria 5233
34 Ga0070681_10126506 3300005458 Bacteria 2488
35 Ga0068867_100018888 3300005459 Bacteria 4906
36 Ga0068867_100028225 3300005459 Bacteria 4040
37 Ga0070706_100002394 3300005467 Bacteria 18913
38 Ga0070706_100003661 3300005467 Bacteria 15044
39 Ga0070707_100934667 3300005468 Bacteria 832
40 Ga0070698_100230363 3300005471 Unclassified 1786
41 Ga0070699_100134835 3300005518 Unclassified 2178
42 Ga0070699_100755310 3300005518 Bacteria 889
43 Ga0070679_100028411 3300005530 Bacteria 5514
44 Ga0070679_100151012 3300005530 Bacteria 2300
45 Ga0070679_100667107 3300005530 Bacteria 983
46 Ga0070684_100039507 3300005535 Bacteria 4059
47 Ga0070684_100117439 3300005535 Bacteria 2391
48 Ga0070697_100095770 3300005536 Bacteria 2462
49 Ga0070697_101021609 3300005536 Unclassified 735
50 Ga0068853_100092005 3300005539 Bacteria 2668
51 Ga0068853_100479275 3300005539 Unclassified 1173
52 Ga0070695_100007966 3300005545 Bacteria 6274
53 Ga0070695_100013434 3300005545 Bacteria 4921
54 Ga0070696_100000161 3300005546 Bacteria 37761
55 Ga0070693_100000290 3300005547 Bacteria 23482
56 Ga0070693_100054340 3300005547 Bacteria 2303
57 Ga0070704_100028424 3300005549 Unclassified 3720
58 Ga0068855_100000563 3300005563 Bacteria 45518
59 Ga0068855_100004163 3300005563 Bacteria 17651
60 Ga0068855_100008914 3300005563 Bacteria 12128
61 Ga0068855_100216009 3300005563 Bacteria 2152
62 Ga0068855_100231501 3300005563 Bacteria 2069
63 Ga0070664_100000879 3300005564 Bacteria 23312
64 Ga0070664_100053981 3300005564 Bacteria 3408
65 Ga0068857_100000022 3300005577 Bacteria 87864
66 Ga0068857_100002691 3300005577 Bacteria 14592
67 Ga0068854_100007043 3300005578 Bacteria 7177
68 Ga0068854_100101147 3300005578 Unclassified 2161
69 Ga0068856_100000448 3300005614 Bacteria 45521
70 Ga0068856_100002645 3300005614 Bacteria 18368
71 Ga0068856_100004550 3300005614 Bacteria 13783
72 Ga0068856_100055339 3300005614 Archaea 3915
73 Ga0070702_100766811 3300005615 Unclassified 742
74 Ga0068852_100009679 3300005616 Bacteria 7162
75 Ga0068852_100015711 3300005616 Bacteria 5883
76 Ga0068859_100000885 3300005617 Bacteria 30517
77 Ga0068864_100001248 3300005618 Bacteria 21136
78 Ga0068864_100052118 3300005618 Bacteria 3527
79 Ga0068866_10000934 3300005718 Bacteria 12833
80 Ga0068870_10079011 3300005840 Bacteria 1814
81 Ga0068863_100001089 3300005841 Bacteria 27150
82 Ga0068863_100022442 3300005841 Bacteria 6028
83 Ga0068858_100001352 3300005842 Bacteria 25271
84 Ga0068858_100040332 3300005842 Bacteria 4330
85 Ga0068858_100080189 3300005842 Bacteria 3033
86 Ga0068860_100026095 3300005843 Bacteria 5636
87 Ga0068860_100038371 3300005843 Unclassified 4582
88 Ga0068860_100218466 3300005843 Bacteria 1851
89 Ga0068860_100450376 3300005843 Bacteria 1280
90 Ga0070717_10033440 3300006028 Bacteria 4149
91 Ga0070717_10642631 3300006028 Bacteria 963
92 Ga0070715_10087746 3300006163 Bacteria 1425
93 Ga0070716_100043836 3300006173 Bacteria 2504
94 Ga0070716_100093300 3300006173 Bacteria 1827
95 Ga0070716_100190936 3300006173 Unclassified 1353
96 Ga0070716_100200505 3300006173 Unclassified 1326
97 Ga0070716_100554993 3300006173 Unclassified 857
98 Ga0070712_100326690 3300006175 Bacteria 1249
99 Ga0097621_100000279 3300006237 Bacteria 34252
100 Ga0097621_100000712 3300006237 Bacteria 23346
101 Ga0097621_100104191 3300006237 Bacteria 2390
102 Ga0068871_100000304 3300006358 Bacteria 34254
103 Ga0068871_100002004 3300006358 Bacteria 13783
104 Ga0068871_100048155 3300006358 Bacteria 3440
105 Ga0075433_10255837 3300006852 Bacteria 1553
106 Ga0075434_100048258 3300006871 Bacteria 4225
107 Ga0068865_100011952 3300006881 Bacteria 5452
108 Ga0068865_100021076 3300006881 Bacteria 4236
109 Ga0075436_100011081 3300006914 Bacteria 6183
110 Ga0097620_100000885 3300006931 Bacteria 30517
111 Ga0075435_100030900 3300007076 Bacteria 4216
112 Ga0099794_10019845 3300007265 Bacteria 3036
113 Ga0099794_10021827 3300007265 Bacteria 2912
114 Ga0099794_10138942 3300007265 Unclassified 1230
115 Ga0099794_10197104 3300007265 Bacteria 1031
116 Ga0105240_10007213 3300009093 Bacteria 16187
117 Ga0105240_10289534 3300009093 Unclassified 1878
118 Ga0114129_10000891 3300009147 Bacteria 38929
119 Ga0105241_10087492 3300009174 Bacteria 2453
120 Ga0105241_10159453 3300009174 Unclassified 1853
121 Ga0105242_10331294 3300009176 Bacteria 1400
122 Ga0105248_10167822 3300009177 Bacteria 2474
123 Ga0105248_10243353 3300009177 Bacteria 2025
124 Ga0105248_10292572 3300009177 Bacteria 1834
125 Ga0105248_10601938 3300009177 Bacteria 1240
126 Ga0105237_10169347 3300009545 Bacteria 2184
127 Ga0105237_10188325 3300009545 Unclassified 2064
128 Ga0105238_10018330 3300009551 Bacteria 7124
129 Ga0105238_10065773 3300009551 Bacteria 3626
130 Ga0105238_10969022 3300009551 Bacteria 871
131 Ga0105239_10039890 3300010375 Bacteria 5143
132 Ga0105239_10542548 3300010375 Bacteria 1324
133 Ga0105246_10645523 3300011119 Bacteria 921
134 Ga0157373_10026179 3300013100 Bacteria 4216
135 Ga0157373_10174287 3300013100 Bacteria 1514
136 Ga0157371_10107948 3300013102 Bacteria 1975
137 Ga0157371_10115595 3300013102 Bacteria 1906
138 Ga0157370_10236161 3300013104 Unclassified 1692
139 Ga0157370_10359371 3300013104 Bacteria 1342
140 Ga0157369_10000243 3300013105 Bacteria 75602
141 Ga0157369_10025453 3300013105 Bacteria 6571
142 Ga0157369_10056729 3300013105 Bacteria 4226
143 Ga0157374_10001216 3300013296 Bacteria 22009
144 Ga0157374_10032284 3300013296 Bacteria 4766
145 Ga0157378_10000030 3300013297 Bacteria 124811
146 Ga0157378_10030684 3300013297 Bacteria 4748
147 Ga0157378_10112539 3300013297 Bacteria 2497
148 Ga0157372_10037537 3300013307 Bacteria 5345
149 Ga0157372_10043103 3300013307 Unclassified 4995
150 Ga0157372_10065052 3300013307 Bacteria 4093
151 Ga0157372_10964325 3300013307 Unclassified 988
152 Ga0157375_10324953 3300013308 Bacteria 1703
153 Ga0163163_10120550 3300014325 Unclassified 2657
154 Ga0157376_10000028 3300014969 Bacteria 202069
155 Ga0157376_10020436 3300014969 Bacteria 5122
156 Ga0157376_10577234 3300014969 Bacteria 1116
157 Ga0157376_11146122 3300014969 Unclassified 804
158 Ga0224572_1005055 3300024225 Bacteria 2335
159 Ga0228598_1000054 3300024227 Bacteria 16523
160 Ga0207642_10002317 3300025899 Bacteria 5936
161 Ga0207647_10006332 3300025904 Bacteria 8611
162 Ga0207699_10038188 3300025906 Bacteria 2750
163 Ga0207699_10299911 3300025906 Unclassified 1122
164 Ga0207699_10580395 3300025906 Unclassified 815
165 Ga0207643_10203566 3300025908 Bacteria 1206
166 Ga0207684_10005413 3300025910 Bacteria 11781
167 Ga0207654_10047725 3300025911 Bacteria 2447
168 Ga0207654_10274034 3300025911 Unclassified 1139
169 Ga0207707_10001814 3300025912 Bacteria 19598
170 Ga0207707_10009181 3300025912 Bacteria 8584
171 Ga0207695_10020070 3300025913 Bacteria 7667
172 Ga0207695_10122516 3300025913 Bacteria 2567
173 Ga0207695_10558345 3300025913 Bacteria 1026
174 Ga0207671_10078653 3300025914 Bacteria 2470
175 Ga0207693_10052190 3300025915 Bacteria 3207
176 Ga0207693_10215268 3300025915 Bacteria 1510
177 Ga0207663_10454278 3300025916 Unclassified 989
178 Ga0207660_10545222 3300025917 Bacteria 943
179 Ga0207660_10556549 3300025917 Bacteria 933
180 Ga0207660_10638845 3300025917 Bacteria 867
181 Ga0207649_10239079 3300025920 Bacteria 1303
182 Ga0207652_10003767 3300025921 Bacteria 12413
183 Ga0207652_10071597 3300025921 Bacteria 3013
184 Ga0207652_10739888 3300025921 Bacteria 876
185 Ga0207646_10140264 3300025922 Bacteria 2177
186 Ga0207646_10328935 3300025922 Bacteria 1381
187 Ga0207646_10584891 3300025922 Unclassified 1003
188 Ga0207694_10000896 3300025924 Bacteria 26371
189 Ga0207694_10042071 3300025924 Bacteria 3523
190 Ga0207694_10699472 3300025924 Bacteria 855
191 Ga0207650_10219292 3300025925 Bacteria 1530
192 Ga0207659_10147946 3300025926 Bacteria 1831
193 Ga0207700_10024276 3300025928 Bacteria 4194
194 Ga0207700_10117459 3300025928 Unclassified 2151
195 Ga0207700_10246794 3300025928 Unclassified 1524
196 Ga0207700_10578676 3300025928 Bacteria 998
197 Ga0207700_10654386 3300025928 Bacteria 937
198 Ga0207700_11005764 3300025928 Unclassified 746
199 Ga0207664_10002080 3300025929 Bacteria 13171
200 Ga0207664_10049118 3300025929 Bacteria 3320
201 Ga0207690_10216247 3300025932 Bacteria 1464
202 Ga0207686_10126046 3300025934 Bacteria 1750
203 Ga0207686_10609507 3300025934 Bacteria 860
204 Ga0207670_10289167 3300025936 Bacteria 1280
205 Ga0207704_10033401 3300025938 Bacteria 2925
206 Ga0207704_10061427 3300025938 Bacteria 2331
207 Ga0207665_10058024 3300025939 Bacteria 2616
208 Ga0207665_10163901 3300025939 Bacteria 1601
209 Ga0207665_10281888 3300025939 Unclassified 1237
210 Ga0207665_10936780 3300025939 Unclassified 688
211 Ga0207711_10204661 3300025941 Bacteria 1802
212 Ga0207711_10723497 3300025941 Bacteria 928
213 Ga0207689_10033833 3300025942 Bacteria 4245
214 Ga0207661_10054742 3300025944 Bacteria 3197
215 Ga0207661_10627398 3300025944 Bacteria 987
216 Ga0207679_10001790 3300025945 Bacteria 13372
217 Ga0207679_10070274 3300025945 Bacteria 2638
218 Ga0207667_10000302 3300025949 Bacteria 68245
219 Ga0207667_10002360 3300025949 Bacteria 23658
220 Ga0207667_10016361 3300025949 Bacteria 8384
221 Ga0207667_10280254 3300025949 Unclassified 1703
222 Ga0207667_10466629 3300025949 Bacteria 1282
223 Ga0207640_10002615 3300025981 Bacteria 9649
224 Ga0207640_10144151 3300025981 Unclassified 1740
225 Ga0207677_10020303 3300026023 Bacteria 4032
226 Ga0207677_10342279 3300026023 Bacteria 1250
227 Ga0207703_10001842 3300026035 Bacteria 18897
228 Ga0207703_10142336 3300026035 Bacteria 2083
229 Ga0207703_10576251 3300026035 Bacteria 1063
230 Ga0207639_10583867 3300026041 Unclassified 1029
231 Ga0207639_10829638 3300026041 Bacteria 862
232 Ga0207702_10000120 3300026078 Bacteria 91853
233 Ga0207702_10001675 3300026078 Bacteria 21899
234 Ga0207702_10007270 3300026078 Bacteria 9471
235 Ga0207702_10203252 3300026078 Bacteria 1838
236 Ga0207702_10553199 3300026078 Unclassified 1126
237 Ga0207641_10003055 3300026088 Bacteria 15083
238 Ga0207641_10294793 3300026088 Bacteria 1530
239 Ga0207641_10545311 3300026088 Bacteria 1130
240 Ga0207648_10042030 3300026089 Bacteria 4013
241 Ga0207676_10009792 3300026095 Bacteria 6815
242 Ga0207674_10000056 3300026116 Bacteria 113265
243 Ga0207674_10031652 3300026116 Bacteria 5554
244 Ga0207683_10492625 3300026121 Bacteria 1132
245 Ga0207698_10096932 3300026142 Bacteria 2432
246 Ga0207698_10101051 3300026142 Bacteria 2391
247 Ga0207698_11133727 3300026142 Unclassified 795
248 Ga0209588_1001625 3300027671 Bacteria 5907
249 Ga0209588_1027487 3300027671 Bacteria 1810
250 Ga0209588_1070455 3300027671 Bacteria 1130
251 Ga0265354_1000008 3300028016 Bacteria 30843
252 Ga0268264_10196060 3300028381 Bacteria 1844
253 Ga0268264_10220685 3300028381 Unclassified 1745
254 Ga0268264_10614285 3300028381 Bacteria 1073
255 Ga0268264_11395137 3300028381 Unclassified 711
256 Ga0265338_10421854 3300028800 Bacteria 948
257 Ga0265338_10544232 3300028800 Unclassified 813
258 Ga0265338_10619208 3300028800 Unclassified 753
259 Ga0265770_1003854 3300030878 Bacteria 2039
260 Ga0265760_10020168 3300031090 Unclassified 1923
261 Ga0265760_10035437 3300031090 Bacteria 1478
262 Ga0265760_10073355 3300031090 Unclassified 1052
263 Ga0265760_10128126 3300031090 Unclassified 819
264 Ga0265316_10107726 3300031344 Unclassified 2113
265 Ga0373926_0068816 3300035083 Bacteria 1298
266 Ga0373926_0193714 3300035083 Unclassified 781
267 Ga0373934_0000390 3300035086 Bacteria 15333
268 Ga0373940_0239802 3300035088 Unclassified 608
269 Ga0373923_0540916 3300035111 Unclassified 570
270 Ga0373936_0000507 3300035113 Bacteria 13236
271 Ga0373953_0013234 3300035117 Bacteria 2942
272 Ga0373953_0033536 3300035117 Bacteria 2009
273 Ga0373954_0000107 3300035118 Bacteria 28069
274 Ga0373954_0022341 3300035118 Bacteria 2869
275 Ga0373954_0040944 3300035118 Bacteria 2159
276 Ga0373956_0004833 3300035119 Bacteria 5392
277 Ga0373956_0290360 3300035119 Unclassified 778
278 Ga0373957_0009685 3300035120 Bacteria 3158
279 Ga0373943_0000489 3300035170 Bacteria 16858
280 Ga0373946_0016418 3300035171 Bacteria 2820
281 Ga0373955_0001803 3300035172 Bacteria 9197
282 Ga0373955_0043380 3300035172 Bacteria 2419
283 Ga0373924_0010260 3300035410 Bacteria 3448
284 Ga0373931_0719579 3300035691 Unclassified 660
285 Ga0373935_0006442 3300035692 Bacteria 7009
286 Ga0373927_0000428 3300035695 Bacteria 32350
287 Ga0373933_0000462 3300035724 Bacteria 25399
288 Ga0373933_0023795 3300035724 Bacteria 3502
289 Ga0373947_0000054 3300035725 Bacteria 57013
290 Ga0373937_0001306 3300036401 Bacteria 20878
291 Ga0373937_0004147 3300036401 Bacteria 12291
292 Ga0373937_0022709 3300036401 Bacteria 5644
293 Ga0373937_0039664 3300036401 Unclassified 4292
294 Ga0373925_0512069 3300037068 Bacteria 985
295 Ga0373925_1415191 3300037068 Bacteria 569
296 Ga0451577_0125529 3300042876 Bacteria 2299
297 Ga0453683_0040738 3300044673 Unclassified 2916
298 Ga0453683_0095947 3300044673 Unclassified 1860
299 Ga0451576_0652060 3300045051 Bacteria 1106
300 Ga0495592_0262856 3300046454 Unclassified 1136
301 Ga0495651_0134338 3300046462 Bacteria 1802
302 Ga0495653_0077869 3300046463 Unclassified 2461
303 Ga0495653_0115075 3300046463 Bacteria 1926
304 Ga0495580_0089648 3300046472 Bacteria 2141
305 Ga0495580_0361159 3300046472 Bacteria 983
306 Ga0495608_0008724 3300046511 Bacteria 7093
307 Ga0495628_0132561 3300046516 Bacteria 1905
308 Ga0495628_0315344 3300046516 Bacteria 1155
309 Ga0495630_0937098 3300046517 Bacteria 659
310 Ga0495587_0006891 3300046536 Bacteria 7389
311 Ga0495645_0264245 3300046543 Bacteria 1138
312 Ga0495635_0384928 3300046663 Unclassified 933
313 Ga0495623_0024746 3300046679 Unclassified 3867
314 Ga0495646_0444229 3300046680 Bacteria 670
315 Ga0495658_0295682 3300046683 Unclassified 1024
316 Ga0495624_0155036 3300046690 Bacteria 1400
317 Ga0495604_0002393 3300047317 Bacteria 15037
318 Ga0495674_0023342 3300047319 Bacteria 5702
319 Ga0495674_0356298 3300047319 Bacteria 1187
320 Ga0495684_0026748 3300047471 Unclassified 4433
321 Ga0495602_0004470 3300048088 Bacteria 14587
322 Ga0495602_0069539 3300048088 Bacteria 3018
323 Ga0496100_0367552 3300048903 Bacteria 1090
324 Ga0496104_0128672 3300048907 Bacteria 2432
325 Ga0496110_0805343 3300048913 Bacteria 844
326 Ga0496112_0004054 3300048915 Bacteria 12292
327 Ga0496112_0089900 3300048915 Bacteria 3039
328 Ga0496114_0055217 3300048917 Bacteria 3313
329 Ga0496115_0012677 3300048918 Bacteria 6352
330 Ga0496115_0055646 3300048918 Bacteria 3178
331 nmdc:mga0n895_4469_c1 3300050512 Bacteria 11492
332 nmdc:mga0rr50_1175595_c1 3300050513 Unclassified 652
333 nmdc:mga0rr50_718900_c1 3300050513 Unclassified 852
334 nmdc:mga08x19_35997_c1 3300050514 Unclassified 3133
335 Ga0495619_0450511 3300053085 Unclassified 887
336 Ga0436362_0910542
337 MBSR1b_contig_12759690
338 MBSR1b_contig_12891285
339 Ga0070683_100074378
340 Ga0068869_100100885
341 Ga0070680_100602886
342 Ga0068868_100007450
343 Ga0068868_100030942
344 Ga0070689_100259070
345 Ga0070661_100281194
346 Ga0070661_100768280
347 Ga0070675_100260033
348 Ga0070688_100285903
349 Ga0070659_100375721
350 Ga0070703_10099794
351 Ga0070709_10008214
352 Ga0070709_10218198
353 Ga0070714_100001619
354 Ga0070714_100002437
355 Ga0070713_100029906
356 Ga0070713_100135318
357 Ga0070713_100739575
358 Ga0070711_100391283
359 Ga0070705_100001066
360 Ga0070705_100186269
361 Ga0070705_100805507
362 Ga0070694_100063991
363 Ga0070708_100005667
364 Ga0070708_101047763
365 Ga0070678_100445935
366 Ga0070662_100298685
367 Ga0070681_10023869
368 Ga0070681_10032550
369 Ga0070681_10126506
370 Ga0068867_100018888
371 Ga0068867_100028225
372 Ga0070706_100002394
373 Ga0070706_100003661
374 Ga0070707_100934667
375 Ga0070698_100230363
376 Ga0070699_100134835
377 Ga0070699_100755310
378 Ga0070679_100028411
379 Ga0070679_100151012
380 Ga0070679_100667107
381 Ga0070684_100039507
382 Ga0070684_100117439
383 Ga0070697_100095770
384 Ga0070697_101021609
385 Ga0068853_100092005
386 Ga0068853_100479275
387 Ga0070695_100007966
388 Ga0070695_100013434
389 Ga0070696_100000161
390 Ga0070693_100000290
391 Ga0070693_100054340
392 Ga0070704_100028424
393 Ga0068855_100000563
394 Ga0068855_100004163
395 Ga0068855_100008914
396 Ga0068855_100216009
397 Ga0068855_100231501
398 Ga0070664_100000879
399 Ga0070664_100053981
400 Ga0068857_100000022
401 Ga0068857_100002691
402 Ga0068854_100007043
403 Ga0068854_100101147
404 Ga0068856_100000448
405 Ga0068856_100002645
406 Ga0068856_100004550
407 Ga0068856_100055339
408 Ga0070702_100766811
409 Ga0068852_100009679
410 Ga0068852_100015711
411 Ga0068859_100000885
412 Ga0068864_100001248
413 Ga0068864_100052118
414 Ga0068866_10000934
415 Ga0068870_10079011
416 Ga0068863_100001089
417 Ga0068863_100022442
418 Ga0068858_100001352
419 Ga0068858_100040332
420 Ga0068858_100080189
421 Ga0068860_100026095
422 Ga0068860_100038371
423 Ga0068860_100218466
424 Ga0068860_100450376
425 Ga0070717_10033440
426 Ga0070717_10642631
427 Ga0070715_10087746
428 Ga0070716_100043836
429 Ga0070716_100093300
430 Ga0070716_100190936
431 Ga0070716_100200505
432 Ga0070716_100554993
433 Ga0070712_100326690
434 Ga0097621_100000279
435 Ga0097621_100000712
436 Ga0097621_100104191
437 Ga0068871_100000304
438 Ga0068871_100002004
439 Ga0068871_100048155
440 Ga0075433_10255837
441 Ga0075434_100048258
442 Ga0068865_100011952
443 Ga0068865_100021076
444 Ga0075436_100011081
445 Ga0097620_100000885
446 Ga0075435_100030900
447 Ga0099794_10019845
448 Ga0099794_10021827
449 Ga0099794_10138942
450 Ga0099794_10197104
451 Ga0105240_10007213
452 Ga0105240_10289534
453 Ga0114129_10000891
454 Ga0105241_10087492
455 Ga0105241_10159453
456 Ga0105242_10331294
457 Ga0105248_10167822
458 Ga0105248_10243353
459 Ga0105248_10292572
460 Ga0105248_10601938
461 Ga0105237_10169347
462 Ga0105237_10188325
463 Ga0105238_10018330
464 Ga0105238_10065773
465 Ga0105238_10969022
466 Ga0105239_10039890
467 Ga0105239_10542548
468 Ga0105246_10645523
469 Ga0157373_10026179
470 Ga0157373_10174287
471 Ga0157371_10107948
472 Ga0157371_10115595
473 Ga0157370_10236161
474 Ga0157370_10359371
475 Ga0157369_10000243
476 Ga0157369_10025453
477 Ga0157369_10056729
478 Ga0157374_10001216
479 Ga0157374_10032284
480 Ga0157378_10000030
481 Ga0157378_10030684
482 Ga0157378_10112539
483 Ga0157372_10037537
484 Ga0157372_10043103
485 Ga0157372_10065052
486 Ga0157372_10964325
487 Ga0157375_10324953
488 Ga0163163_10120550
489 Ga0157376_10000028
490 Ga0157376_10020436
491 Ga0157376_10577234
492 Ga0157376_11146122
493 Ga0224572_1005055
494 Ga0228598_1000054
495 Ga0207642_10002317
496 Ga0207647_10006332
497 Ga0207699_10038188
498 Ga0207699_10299911
499 Ga0207699_10580395
500 Ga0207643_10203566
501 Ga0207684_10005413
502 Ga0207654_10047725
503 Ga0207654_10274034
504 Ga0207707_10001814
505 Ga0207707_10009181
506 Ga0207695_10020070
507 Ga0207695_10122516
508 Ga0207695_10558345
509 Ga0207671_10078653
510 Ga0207693_10052190
511 Ga0207693_10215268
512 Ga0207663_10454278
513 Ga0207660_10545222
514 Ga0207660_10556549
515 Ga0207660_10638845
516 Ga0207649_10239079
517 Ga0207652_10003767
518 Ga0207652_10071597
519 Ga0207652_10739888
520 Ga0207646_10140264
521 Ga0207646_10328935
522 Ga0207646_10584891
523 Ga0207694_10000896
524 Ga0207694_10042071
525 Ga0207694_10699472
526 Ga0207650_10219292
527 Ga0207659_10147946
528 Ga0207700_10024276
529 Ga0207700_10117459
530 Ga0207700_10246794
531 Ga0207700_10578676
532 Ga0207700_10654386
533 Ga0207700_11005764
534 Ga0207664_10002080
535 Ga0207664_10049118
536 Ga0207690_10216247
537 Ga0207686_10126046
538 Ga0207686_10609507
539 Ga0207670_10289167
540 Ga0207704_10033401
541 Ga0207704_10061427
542 Ga0207665_10058024
543 Ga0207665_10163901
544 Ga0207665_10281888
545 Ga0207665_10936780
546 Ga0207711_10204661
547 Ga0207711_10723497
548 Ga0207689_10033833
549 Ga0207661_10054742
550 Ga0207661_10627398
551 Ga0207679_10001790
552 Ga0207679_10070274
553 Ga0207667_10000302
554 Ga0207667_10002360
555 Ga0207667_10016361
556 Ga0207667_10280254
557 Ga0207667_10466629
558 Ga0207640_10002615
559 Ga0207640_10144151
560 Ga0207677_10020303
561 Ga0207677_10342279
562 Ga0207703_10001842
563 Ga0207703_10142336
564 Ga0207703_10576251
565 Ga0207639_10583867
566 Ga0207639_10829638
567 Ga0207702_10000120
568 Ga0207702_10001675
569 Ga0207702_10007270
570 Ga0207702_10203252
571 Ga0207702_10553199
572 Ga0207641_10003055
573 Ga0207641_10294793
574 Ga0207641_10545311
575 Ga0207648_10042030
576 Ga0207676_10009792
577 Ga0207674_10000056
578 Ga0207674_10031652
579 Ga0207683_10492625
580 Ga0207698_10096932
581 Ga0207698_10101051
582 Ga0207698_11133727
583 Ga0209588_1001625
584 Ga0209588_1027487
585 Ga0209588_1070455
586 Ga0265354_1000008
587 Ga0268264_10196060
588 Ga0268264_10220685
589 Ga0268264_10614285
590 Ga0268264_11395137
591 Ga0265338_10421854
592 Ga0265338_10544232
593 Ga0265338_10619208
594 Ga0265770_1003854
595 Ga0265760_10020168
596 Ga0265760_10035437
597 Ga0265760_10073355
598 Ga0265760_10128126
599 Ga0265316_10107726
600 Ga0373926_0068816
601 Ga0373926_0193714
602 Ga0373934_0000390
603 Ga0373940_0239802
604 Ga0373923_0540916
605 Ga0373936_0000507
606 Ga0373953_0013234
607 Ga0373953_0033536
608 Ga0373954_0000107
609 Ga0373954_0022341
610 Ga0373954_0040944
611 Ga0373956_0004833
612 Ga0373956_0290360
613 Ga0373957_0009685
614 Ga0373943_0000489
615 Ga0373946_0016418
616 Ga0373955_0001803
617 Ga0373955_0043380
618 Ga0373924_0010260
619 Ga0373931_0719579
620 Ga0373935_0006442
621 Ga0373927_0000428
622 Ga0373933_0000462
623 Ga0373933_0023795
624 Ga0373947_0000054
625 Ga0373937_0001306
626 Ga0373937_0004147
627 Ga0373937_0022709
628 Ga0373937_0039664
629 Ga0373925_0512069
630 Ga0373925_1415191
631 Ga0451577_0125529
632 Ga0453683_0040738
633 Ga0453683_0095947
634 Ga0451576_0652060
635 Ga0495592_0262856
636 Ga0495651_0134338
637 Ga0495653_0077869
638 Ga0495653_0115075
639 Ga0495580_0089648
640 Ga0495580_0361159
641 Ga0495608_0008724
642 Ga0495628_0132561
643 Ga0495628_0315344
644 Ga0495630_0937098
645 Ga0495587_0006891
646 Ga0495645_0264245
647 Ga0495635_0384928
648 Ga0495623_0024746
649 Ga0495646_0444229
650 Ga0495658_0295682
651 Ga0495624_0155036
652 Ga0495604_0002393
653 Ga0495674_0023342
654 Ga0495674_0356298
655 Ga0495684_0026748
656 Ga0495602_0004470
657 Ga0495602_0069539
658 Ga0496100_0367552
659 Ga0496104_0128672
660 Ga0496110_0805343
661 Ga0496112_0004054
662 Ga0496112_0089900
663 Ga0496114_0055217
664 Ga0496115_0012677
665 Ga0496115_0055646
666 nmdc:mga0n895_4469_c1
667 nmdc:mga0rr50_1175595_c1
668 nmdc:mga0rr50_718900_c1
669 nmdc:mga08x19_35997_c1
670 Ga0495619_0450511

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05163

DinB

DinB family

23

191

0.8

PF12867

DinB_2

DinB superfamily

35

167

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3di5-assembly1.cif.gz_A crystal structure of a dinb-like protein (bce_4655) from bacillus cereus atcc 10987 at 2.01 a resolution 0.747 2 149
3dka-assembly1.cif.gz_A crystal structure of a dinb-like protein (yjoa, bsu12410) from bacillus subtilis at 2.30 a resolution 0.7028 2 149
3di5-assembly1.cif.gz_A crystal structure of a dinb-like protein (bce_4655) from bacillus cereus atcc 10987 at 2.01 a resolution 0.6995 2 149
3dka-assembly1.cif.gz_B crystal structure of a dinb-like protein (yjoa, bsu12410) from bacillus subtilis at 2.30 a resolution 0.6989 2 149
2yqy-assembly1.cif.gz_A crystal structure of tt2238, a four-helix bundle protein 0.6984 1 137
ID Description Score Start End Superfamily
af_P9WLX5_142_317_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.8291 114 148 3.40.50.410
3di5A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7175 2 149 1.20.120.450
3di5A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6754 2 149 1.20.120.450
2hkvA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6743 3 146 1.20.120.450
3dkaA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6702 2 143 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A2V8Y0C5-F1-model_v4 Damage-inducible protein DinB 0.987 2 161
AF-A0A2V9TPU7-F1-model_v4 Damage-inducible protein DinB 0.9828 3 161
AF-A0A2V7Y207-F1-model_v4 Damage-inducible protein DinB 0.9769 2 161
AF-A0A2V9UR78-F1-model_v4 Damage-inducible protein DinB 0.9767 2 151
AF-A0A2V7WG68-F1-model_v4 Damage-inducible protein DinB 0.9748 2 161

Map