F411088
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 332 | 201 | 332 | 97 |
Family's Representative Sequence
| Representative Sequence | 3300048088|Ga0495602_0040615|Ga0495602_0040615_3511_3861 |
| Length | 116 |
| Sequence | MIEVCRLDWHIAPFRADRWLDLWEPAAAKMPAYGAKSWSLTRSIDDPLAFQQTATWEKRSDFERYWYSEEIETARASVIDLYDLPLRLRLFALQGGHGESGGLKLVPVVLGGLAGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 2 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 3 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 26 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 31 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 32 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 34 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 35 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 36 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 37 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 38 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 39 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 42 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 43 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 44 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 95 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 96 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 97 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 98 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 99 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 100 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 101 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 102 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 103 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 104 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 105 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 106 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 107 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 108 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 109 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 110 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 111 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 112 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 113 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 114 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 168 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 169 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 170 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 171 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 172 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 173 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 174 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 175 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 176 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 177 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 178 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 179 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 180 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 181 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 182 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 183 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 194 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 195 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 201 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.7 |
| Metatranscriptomes | 0.3 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.6 |
| Nodule | 0 |
| Rhizoplane | 10.24 |
| Rhizosphere | 87.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.51 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24748J21848_1000328 | 3300002074 | Bacteria | 5472 |
| 2 | JGI24034J26672_10001750 | 3300002239 | Bacteria | 2921 |
| 3 | JGI24742J22300_10001636 | 3300002244 | Bacteria | 3561 |
| 4 | JGI25406J46586_10050854 | 3300003203 | Bacteria | 1390 |
| 5 | Ga0058862_12562150 | 3300004803 | Bacteria | 735 |
| 6 | Ga0070677_10000022 | 3300005333 | Bacteria | 45355 |
| 7 | Ga0070680_100033504 | 3300005336 | Bacteria | 4142 |
| 8 | Ga0070682_100000099 | 3300005337 | Bacteria | 77574 |
| 9 | Ga0070689_100333145 | 3300005340 | Bacteria | 1270 |
| 10 | Ga0070691_10002218 | 3300005341 | Bacteria | 8594 |
| 11 | Ga0070691_10572365 | 3300005341 | Unclassified | 663 |
| 12 | Ga0070668_101474945 | 3300005347 | Unclassified | 621 |
| 13 | Ga0070669_100035869 | 3300005353 | Bacteria | 3593 |
| 14 | Ga0070675_102249177 | 3300005354 | Unclassified | 502 |
| 15 | Ga0070674_100000683 | 3300005356 | Bacteria | 17159 |
| 16 | Ga0070673_100005169 | 3300005364 | Bacteria | 8331 |
| 17 | Ga0070688_100085494 | 3300005365 | Bacteria | 2050 |
| 18 | Ga0070667_100864549 | 3300005367 | Unclassified | 841 |
| 19 | Ga0070667_101403671 | 3300005367 | Bacteria | 655 |
| 20 | Ga0070714_100089298 | 3300005435 | Bacteria | 2698 |
| 21 | Ga0070713_100051856 | 3300005436 | Bacteria | 3395 |
| 22 | Ga0070711_100290994 | 3300005439 | Bacteria | 1295 |
| 23 | Ga0070705_100430607 | 3300005440 | Bacteria | 985 |
| 24 | Ga0070685_10333149 | 3300005466 | Bacteria | 1032 |
| 25 | Ga0070679_100003306 | 3300005530 | Bacteria | 14762 |
| 26 | Ga0070684_100008707 | 3300005535 | Bacteria | 7954 |
| 27 | Ga0070684_100042946 | 3300005535 | Bacteria | 3904 |
| 28 | Ga0070684_100179931 | 3300005535 | Bacteria | 1922 |
| 29 | Ga0068853_100050462 | 3300005539 | Bacteria | 3579 |
| 30 | Ga0068853_100933698 | 3300005539 | Unclassified | 834 |
| 31 | Ga0070696_101116846 | 3300005546 | Bacteria | 663 |
| 32 | Ga0070693_101445642 | 3300005547 | Bacteria | 536 |
| 33 | Ga0070665_100000106 | 3300005548 | Bacteria | 157315 |
| 34 | Ga0070665_100559987 | 3300005548 | Bacteria | 1155 |
| 35 | Ga0070704_100772399 | 3300005549 | Bacteria | 857 |
| 36 | Ga0068855_100728549 | 3300005563 | Bacteria | 1059 |
| 37 | Ga0068855_100816850 | 3300005563 | Bacteria | 990 |
| 38 | Ga0068856_100036865 | 3300005614 | Bacteria | 4795 |
| 39 | Ga0068856_100923310 | 3300005614 | Bacteria | 892 |
| 40 | Ga0068856_101970295 | 3300005614 | Unclassified | 595 |
| 41 | Ga0070702_100057234 | 3300005615 | Bacteria | 2255 |
| 42 | Ga0068866_10000001 | 3300005718 | Bacteria | 519680 |
| 43 | Ga0068866_10001215 | 3300005718 | Bacteria | 11198 |
| 44 | Ga0068861_100191468 | 3300005719 | Bacteria | 1710 |
| 45 | Ga0068861_100280513 | 3300005719 | Bacteria | 1435 |
| 46 | Ga0068861_100427141 | 3300005719 | Bacteria | 1182 |
| 47 | Ga0068870_11433162 | 3300005840 | Bacteria | 507 |
| 48 | Ga0068863_100000342 | 3300005841 | Bacteria | 47536 |
| 49 | Ga0068863_100159772 | 3300005841 | Bacteria | 2159 |
| 50 | Ga0068858_100000009 | 3300005842 | Bacteria | 237748 |
| 51 | Ga0068858_100000065 | 3300005842 | Bacteria | 108233 |
| 52 | Ga0081539_10001097 | 3300005985 | Bacteria | 49223 |
| 53 | Ga0070715_10000001 | 3300006163 | Bacteria | 693690 |
| 54 | Ga0070712_100873071 | 3300006175 | Bacteria | 775 |
| 55 | Ga0075430_100008674 | 3300006846 | Bacteria | 8577 |
| 56 | Ga0075433_10000900 | 3300006852 | Bacteria | 20958 |
| 57 | Ga0075433_10019456 | 3300006852 | Bacteria | 5657 |
| 58 | Ga0068865_100931721 | 3300006881 | Bacteria | 757 |
| 59 | Ga0105245_10014785 | 3300009098 | Bacteria | 6798 |
| 60 | Ga0105245_12679043 | 3300009098 | Bacteria | 552 |
| 61 | Ga0105247_10000316 | 3300009101 | Bacteria | 43374 |
| 62 | Ga0105243_10069078 | 3300009148 | Bacteria | 2849 |
| 63 | Ga0105242_10062200 | 3300009176 | Bacteria | 3071 |
| 64 | Ga0105242_11070652 | 3300009176 | Bacteria | 818 |
| 65 | Ga0105238_10000011 | 3300009551 | Bacteria | 261080 |
| 66 | Ga0105238_10769707 | 3300009551 | Bacteria | 977 |
| 67 | Ga0105249_10000080 | 3300009553 | Bacteria | 138080 |
| 68 | Ga0105249_10140426 | 3300009553 | Bacteria | 2316 |
| 69 | Ga0105249_11123207 | 3300009553 | Bacteria | 856 |
| 70 | Ga0105239_10124615 | 3300010375 | Bacteria | 2863 |
| 71 | Ga0105246_11495513 | 3300011119 | Bacteria | 634 |
| 72 | Ga0157370_10019163 | 3300013104 | Bacteria | 6876 |
| 73 | Ga0157370_11157241 | 3300013104 | Unclassified | 698 |
| 74 | Ga0157370_11381082 | 3300013104 | Bacteria | 634 |
| 75 | Ga0157374_10103698 | 3300013296 | Bacteria | 2729 |
| 76 | Ga0157374_10211088 | 3300013296 | Bacteria | 1903 |
| 77 | Ga0163162_10647451 | 3300013306 | Unclassified | 1180 |
| 78 | Ga0157375_10003707 | 3300013308 | Bacteria | 13266 |
| 79 | Ga0157375_10056465 | 3300013308 | Bacteria | 3876 |
| 80 | Ga0157375_10173261 | 3300013308 | Bacteria | 2306 |
| 81 | Ga0157375_10401382 | 3300013308 | Bacteria | 1537 |
| 82 | Ga0163163_11205822 | 3300014325 | Bacteria | 819 |
| 83 | Ga0157380_10002003 | 3300014326 | Bacteria | 13578 |
| 84 | Ga0157379_10003159 | 3300014968 | Bacteria | 13936 |
| 85 | Ga0163161_10002086 | 3300017792 | Bacteria | 14485 |
| 86 | Ga0163161_10035900 | 3300017792 | Bacteria | 3549 |
| 87 | Ga0207682_10000005 | 3300025893 | Bacteria | 95617 |
| 88 | Ga0207642_10000002 | 3300025899 | Bacteria | 658166 |
| 89 | Ga0207642_10003653 | 3300025899 | Bacteria | 4884 |
| 90 | Ga0207710_10000458 | 3300025900 | Bacteria | 26155 |
| 91 | Ga0207710_10068743 | 3300025900 | Bacteria | 1620 |
| 92 | Ga0207710_10165069 | 3300025900 | Bacteria | 1080 |
| 93 | Ga0207685_10000027 | 3300025905 | Bacteria | 102101 |
| 94 | Ga0207693_10664357 | 3300025915 | Bacteria | 809 |
| 95 | Ga0207663_10022110 | 3300025916 | Bacteria | 3632 |
| 96 | Ga0207660_10134079 | 3300025917 | Unclassified | 1888 |
| 97 | Ga0207652_10000044 | 3300025921 | Bacteria | 127779 |
| 98 | Ga0207681_10124737 | 3300025923 | Bacteria | 1894 |
| 99 | Ga0207694_10000004 | 3300025924 | Bacteria | 967075 |
| 100 | Ga0207694_11264284 | 3300025924 | Unclassified | 624 |
| 101 | Ga0207687_10030006 | 3300025927 | Bacteria | 3662 |
| 102 | Ga0207700_10340486 | 3300025928 | Bacteria | 1304 |
| 103 | Ga0207664_10018436 | 3300025929 | Bacteria | 5139 |
| 104 | Ga0207664_10726053 | 3300025929 | Bacteria | 893 |
| 105 | Ga0207686_10756220 | 3300025934 | Bacteria | 776 |
| 106 | Ga0207686_10883572 | 3300025934 | Bacteria | 720 |
| 107 | Ga0207709_10119115 | 3300025935 | Bacteria | 1779 |
| 108 | Ga0207670_10113637 | 3300025936 | Bacteria | 1956 |
| 109 | Ga0207669_10000018 | 3300025937 | Bacteria | 114254 |
| 110 | Ga0207669_10000096 | 3300025937 | Bacteria | 44213 |
| 111 | Ga0207704_10668678 | 3300025938 | Unclassified | 857 |
| 112 | Ga0207665_10926948 | 3300025939 | Bacteria | 691 |
| 113 | Ga0207689_10646434 | 3300025942 | Bacteria | 891 |
| 114 | Ga0207661_10048479 | 3300025944 | Bacteria | 3376 |
| 115 | Ga0207661_10168464 | 3300025944 | Bacteria | 1905 |
| 116 | Ga0207667_11593527 | 3300025949 | Bacteria | 622 |
| 117 | Ga0207651_10010460 | 3300025960 | Bacteria | 5144 |
| 118 | Ga0207712_10000007 | 3300025961 | Bacteria | 539589 |
| 119 | Ga0207712_11007625 | 3300025961 | Bacteria | 739 |
| 120 | Ga0207668_11321414 | 3300025972 | Unclassified | 649 |
| 121 | Ga0207668_11366971 | 3300025972 | Unclassified | 638 |
| 122 | Ga0207703_10000018 | 3300026035 | Bacteria | 271377 |
| 123 | Ga0207703_10000023 | 3300026035 | Bacteria | 222018 |
| 124 | Ga0207639_10161229 | 3300026041 | Bacteria | 1890 |
| 125 | Ga0207708_11202019 | 3300026075 | Bacteria | 663 |
| 126 | Ga0207702_10004391 | 3300026078 | Bacteria | 12560 |
| 127 | Ga0207702_10976976 | 3300026078 | Bacteria | 840 |
| 128 | Ga0207641_10000238 | 3300026088 | Bacteria | 71152 |
| 129 | Ga0207641_10703158 | 3300026088 | Bacteria | 995 |
| 130 | Ga0207675_100228554 | 3300026118 | Bacteria | 1794 |
| 131 | Ga0207675_100313927 | 3300026118 | Bacteria | 1529 |
| 132 | Ga0207675_100325148 | 3300026118 | Bacteria | 1502 |
| 133 | Ga0207683_10391973 | 3300026121 | Bacteria | 1277 |
| 134 | Ga0268266_10000047 | 3300028379 | Bacteria | 310996 |
| 135 | Ga0268264_10013989 | 3300028381 | Bacteria | 6596 |
| 136 | Ga0265319_1000020 | 3300028563 | Bacteria | 153921 |
| 137 | Ga0265338_10001248 | 3300028800 | Bacteria | 41926 |
| 138 | Ga0265324_10068409 | 3300029957 | Bacteria | 1211 |
| 139 | Ga0265325_10001706 | 3300031241 | Bacteria | 15281 |
| 140 | Ga0265331_10026526 | 3300031250 | Bacteria | 2911 |
| 141 | Ga0265327_10496809 | 3300031251 | Bacteria | 526 |
| 142 | Ga0316583_10256155 | 3300032133 | Bacteria | 606 |
| 143 | Ga0373953_0042219 | 3300035117 | Bacteria | 1817 |
| 144 | Ga0373956_0218447 | 3300035119 | Bacteria | 905 |
| 145 | Ga0373956_0580469 | 3300035119 | Unclassified | 535 |
| 146 | Ga0373957_0023038 | 3300035120 | Bacteria | 2224 |
| 147 | Ga0373946_0452038 | 3300035171 | Bacteria | 654 |
| 148 | Ga0373955_0297406 | 3300035172 | Bacteria | 973 |
| 149 | Ga0373955_0370973 | 3300035172 | Bacteria | 868 |
| 150 | Ga0373935_0623489 | 3300035692 | Bacteria | 790 |
| 151 | Ga0373937_0073027 | 3300036401 | Bacteria | 3164 |
| 152 | Ga0373937_0102584 | 3300036401 | Unclassified | 2656 |
| 153 | Ga0451800_1003097 | 3300041459 | Bacteria | 522 |
| 154 | Ga0451845_0396799 | 3300041501 | Bacteria | 1340 |
| 155 | Ga0451849_1458149 | 3300041505 | Bacteria | 709 |
| 156 | Ga0451853_0974378 | 3300041512 | Bacteria | 2739 |
| 157 | Ga0451853_1580302 | 3300041512 | Bacteria | 1328 |
| 158 | Ga0451853_3776184 | 3300041512 | Bacteria | 2473 |
| 159 | Ga0466960_0176150 | 3300044901 | Bacteria | 1157 |
| 160 | Ga0466967_1845549 | 3300045976 | Bacteria | 601 |
| 161 | Ga0495592_0001452 | 3300046454 | Bacteria | 16469 |
| 162 | Ga0495592_0350930 | 3300046454 | Bacteria | 946 |
| 163 | Ga0495592_0824433 | 3300046454 | Unclassified | 550 |
| 164 | Ga0495603_0002944 | 3300046455 | Bacteria | 10072 |
| 165 | Ga0495603_0004199 | 3300046455 | Bacteria | 8579 |
| 166 | Ga0495629_0270599 | 3300046459 | Bacteria | 1167 |
| 167 | Ga0495641_0000228 | 3300046461 | Bacteria | 43671 |
| 168 | Ga0495641_0352629 | 3300046461 | Bacteria | 665 |
| 169 | Ga0495651_0051484 | 3300046462 | Bacteria | 3174 |
| 170 | Ga0495651_0232517 | 3300046462 | Bacteria | 1269 |
| 171 | Ga0495653_0045841 | 3300046463 | Bacteria | 3388 |
| 172 | Ga0495653_0073825 | 3300046463 | Bacteria | 2544 |
| 173 | Ga0495582_0000081 | 3300046473 | Bacteria | 48557 |
| 174 | Ga0495639_0113936 | 3300046475 | Bacteria | 1285 |
| 175 | Ga0495662_0000019 | 3300046476 | Bacteria | 55148 |
| 176 | Ga0495664_0316124 | 3300046477 | Bacteria | 942 |
| 177 | Ga0495664_0610544 | 3300046477 | Bacteria | 648 |
| 178 | Ga0495584_0596863 | 3300046491 | Unclassified | 563 |
| 179 | Ga0495594_0000029 | 3300046499 | Bacteria | 66789 |
| 180 | Ga0495608_0000125 | 3300046511 | Bacteria | 54881 |
| 181 | Ga0495608_0000529 | 3300046511 | Bacteria | 26174 |
| 182 | Ga0495608_0066289 | 3300046511 | Bacteria | 2364 |
| 183 | Ga0495618_0000008 | 3300046514 | Bacteria | 204578 |
| 184 | Ga0495618_0251286 | 3300046514 | Bacteria | 1109 |
| 185 | Ga0495618_0358367 | 3300046514 | Bacteria | 898 |
| 186 | Ga0495620_0000824 | 3300046515 | Bacteria | 19119 |
| 187 | Ga0495628_0013407 | 3300046516 | Bacteria | 6897 |
| 188 | Ga0495628_0023428 | 3300046516 | Bacteria | 5068 |
| 189 | Ga0495628_0029017 | 3300046516 | Bacteria | 4491 |
| 190 | Ga0495628_0064038 | 3300046516 | Bacteria | 2879 |
| 191 | Ga0495628_0076615 | 3300046516 | Bacteria | 2602 |
| 192 | Ga0495628_0318506 | 3300046516 | Bacteria | 1148 |
| 193 | Ga0495630_0009955 | 3300046517 | Bacteria | 6845 |
| 194 | Ga0495630_0020498 | 3300046517 | Bacteria | 4874 |
| 195 | Ga0495630_0417732 | 3300046517 | Bacteria | 1028 |
| 196 | Ga0495630_0520206 | 3300046517 | Bacteria | 912 |
| 197 | Ga0495630_1383227 | 3300046517 | Unclassified | 529 |
| 198 | Ga0495652_0000407 | 3300046529 | Bacteria | 50232 |
| 199 | Ga0495652_0023500 | 3300046529 | Bacteria | 5465 |
| 200 | Ga0495640_0075063 | 3300046533 | Bacteria | 2258 |
| 201 | Ga0495640_0098804 | 3300046533 | Bacteria | 1918 |
| 202 | Ga0495586_0000161 | 3300046535 | Bacteria | 43544 |
| 203 | Ga0495587_0020731 | 3300046536 | Bacteria | 4055 |
| 204 | Ga0495587_0072183 | 3300046536 | Bacteria | 2007 |
| 205 | Ga0495587_0161031 | 3300046536 | Bacteria | 1277 |
| 206 | Ga0495587_0530322 | 3300046536 | Unclassified | 650 |
| 207 | Ga0495621_0000576 | 3300046539 | Bacteria | 9156 |
| 208 | Ga0495621_0138961 | 3300046539 | Bacteria | 949 |
| 209 | Ga0495645_0126231 | 3300046543 | Bacteria | 1798 |
| 210 | Ga0495622_0000550 | 3300046557 | Bacteria | 22511 |
| 211 | Ga0495667_0075296 | 3300046559 | Bacteria | 2197 |
| 212 | Ga0495656_0046026 | 3300046615 | Bacteria | 1845 |
| 213 | Ga0495634_0000059 | 3300046642 | Bacteria | 88314 |
| 214 | Ga0495634_0283600 | 3300046642 | Bacteria | 1005 |
| 215 | Ga0495625_0000756 | 3300046660 | Bacteria | 45145 |
| 216 | Ga0495635_0000044 | 3300046663 | Bacteria | 83945 |
| 217 | Ga0495635_0444971 | 3300046663 | Unclassified | 857 |
| 218 | Ga0495588_0096597 | 3300046674 | Bacteria | 1550 |
| 219 | Ga0495657_0000004 | 3300046675 | Bacteria | 266465 |
| 220 | Ga0495657_0006919 | 3300046675 | Bacteria | 8815 |
| 221 | Ga0495657_0067893 | 3300046675 | Bacteria | 2338 |
| 222 | Ga0495623_0359130 | 3300046679 | Bacteria | 792 |
| 223 | Ga0495647_0000018 | 3300046681 | Bacteria | 81701 |
| 224 | Ga0495647_0065668 | 3300046681 | Bacteria | 1441 |
| 225 | Ga0495658_0000034 | 3300046683 | Bacteria | 69176 |
| 226 | Ga0495669_0000033 | 3300046684 | Bacteria | 98629 |
| 227 | Ga0495669_0174920 | 3300046684 | Bacteria | 1022 |
| 228 | Ga0495613_0004320 | 3300046689 | Bacteria | 10639 |
| 229 | Ga0495613_0009782 | 3300046689 | Bacteria | 7127 |
| 230 | Ga0495613_0214661 | 3300046689 | Bacteria | 1352 |
| 231 | Ga0495624_0000097 | 3300046690 | Bacteria | 58715 |
| 232 | Ga0495624_0145724 | 3300046690 | Unclassified | 1449 |
| 233 | Ga0495649_0005110 | 3300046694 | Bacteria | 8421 |
| 234 | Ga0495600_0005795 | 3300046809 | Bacteria | 7463 |
| 235 | Ga0495600_0007876 | 3300046809 | Bacteria | 6525 |
| 236 | Ga0495600_0189785 | 3300046809 | Bacteria | 1322 |
| 237 | Ga0495581_0369804 | 3300047315 | Unclassified | 837 |
| 238 | Ga0495604_0000055 | 3300047317 | Bacteria | 100430 |
| 239 | Ga0495604_0000137 | 3300047317 | Bacteria | 62542 |
| 240 | Ga0495604_0095577 | 3300047317 | Bacteria | 2195 |
| 241 | Ga0495604_0108473 | 3300047317 | Bacteria | 2028 |
| 242 | Ga0495674_0000064 | 3300047319 | Bacteria | 71275 |
| 243 | Ga0495674_0090784 | 3300047319 | Bacteria | 2610 |
| 244 | Ga0495672_0060363 | 3300047320 | Bacteria | 2191 |
| 245 | Ga0495676_0000130 | 3300047321 | Bacteria | 56693 |
| 246 | Ga0495676_0002521 | 3300047321 | Bacteria | 16308 |
| 247 | Ga0495676_0319030 | 3300047321 | Bacteria | 1044 |
| 248 | Ga0495680_0000550 | 3300047322 | Bacteria | 42291 |
| 249 | Ga0495680_0003958 | 3300047322 | Bacteria | 14324 |
| 250 | Ga0495680_0419149 | 3300047322 | Bacteria | 921 |
| 251 | Ga0495680_0614174 | 3300047322 | Bacteria | 726 |
| 252 | Ga0495675_0000842 | 3300047444 | Bacteria | 18758 |
| 253 | Ga0495675_0038105 | 3300047444 | Bacteria | 3062 |
| 254 | Ga0495679_033543 | 3300047446 | Bacteria | 1639 |
| 255 | Ga0495673_0159348 | 3300047469 | Bacteria | 867 |
| 256 | Ga0495684_0119228 | 3300047471 | Bacteria | 1988 |
| 257 | Ga0495684_0181492 | 3300047471 | Bacteria | 1560 |
| 258 | Ga0495686_0046322 | 3300047472 | Bacteria | 2749 |
| 259 | Ga0495593_0082300 | 3300047673 | Bacteria | 1664 |
| 260 | Ga0495593_0259332 | 3300047673 | Bacteria | 870 |
| 261 | Ga0495602_0000041 | 3300048088 | Bacteria | 126954 |
| 262 | Ga0495602_0040615 | 3300048088 | Bacteria | 4262 |
| 263 | Ga0495614_0357863 | 3300048089 | Bacteria | 681 |
| 264 | Ga0496100_0000005 | 3300048903 | Bacteria | 312112 |
| 265 | Ga0496101_0000101 | 3300048904 | Bacteria | 89424 |
| 266 | Ga0496101_1149025 | 3300048904 | Bacteria | 609 |
| 267 | Ga0496102_1021099 | 3300048905 | Unclassified | 747 |
| 268 | Ga0496104_0006952 | 3300048907 | Bacteria | 9977 |
| 269 | Ga0496105_0000650 | 3300048908 | Bacteria | 23286 |
| 270 | Ga0496105_0308255 | 3300048908 | Bacteria | 1271 |
| 271 | Ga0496106_0000151 | 3300048909 | Bacteria | 51430 |
| 272 | Ga0496106_0000682 | 3300048909 | Bacteria | 24335 |
| 273 | Ga0496106_0545561 | 3300048909 | Bacteria | 930 |
| 274 | Ga0496107_0000011 | 3300048910 | Bacteria | 201631 |
| 275 | Ga0496108_0000001 | 3300048911 | Bacteria | 919044 |
| 276 | Ga0496108_0000281 | 3300048911 | Bacteria | 43637 |
| 277 | Ga0496108_1022358 | 3300048911 | Unclassified | 705 |
| 278 | Ga0496109_0000003 | 3300048912 | Bacteria | 420862 |
| 279 | Ga0496109_0001118 | 3300048912 | Bacteria | 22284 |
| 280 | Ga0496110_0004679 | 3300048913 | Bacteria | 10644 |
| 281 | Ga0496110_0011255 | 3300048913 | Bacteria | 7314 |
| 282 | Ga0496110_0059030 | 3300048913 | Bacteria | 3380 |
| 283 | Ga0496110_0649554 | 3300048913 | Bacteria | 955 |
| 284 | Ga0496111_0185752 | 3300048914 | Bacteria | 1545 |
| 285 | Ga0496111_0384726 | 3300048914 | Bacteria | 1037 |
| 286 | Ga0496112_0000006 | 3300048915 | Bacteria | 365227 |
| 287 | Ga0496112_0007591 | 3300048915 | Bacteria | 9637 |
| 288 | Ga0496112_0421312 | 3300048915 | Bacteria | 1274 |
| 289 | Ga0496113_0003552 | 3300048916 | Bacteria | 9354 |
| 290 | Ga0496113_0007799 | 3300048916 | Bacteria | 6917 |
| 291 | Ga0496113_0243558 | 3300048916 | Bacteria | 1435 |
| 292 | Ga0496113_0457707 | 3300048916 | Unclassified | 1025 |
| 293 | Ga0496113_0673853 | 3300048916 | Bacteria | 826 |
| 294 | Ga0496114_0000101 | 3300048917 | Bacteria | 61589 |
| 295 | Ga0496115_0000003 | 3300048918 | Bacteria | 354994 |
| 296 | Ga0496115_0000200 | 3300048918 | Bacteria | 55755 |
| 297 | Ga0501034_0365781 | 3300049571 | Bacteria | 1369 |
| 298 | Ga0501039_0162965 | 3300049575 | Bacteria | 1753 |
| 299 | Ga0501040_0261083 | 3300049576 | Bacteria | 1236 |
| 300 | Ga0501042_0441792 | 3300049578 | Unclassified | 943 |
| 301 | Ga0501047_0115425 | 3300049581 | Bacteria | 2567 |
| 302 | Ga0501068_0682535 | 3300049584 | Bacteria | 671 |
| 303 | Ga0501070_0443368 | 3300049586 | Bacteria | 1047 |
| 304 | Ga0501072_0115179 | 3300049588 | Bacteria | 2140 |
| 305 | Ga0501075_0546991 | 3300049591 | Bacteria | 884 |
| 306 | Ga0501076_1192194 | 3300049592 | Bacteria | 627 |
| 307 | Ga0501079_0337354 | 3300049741 | Bacteria | 1181 |
| 308 | nmdc:mga0qj67_18640_c2 | 3300050509 | Bacteria | 3942 |
| 309 | nmdc:mga0a205_1483_c2 | 3300050515 | Bacteria | 8882 |
| 310 | nmdc:mga0a205_6_c1 | 3300050515 | Bacteria | 129758 |
| 311 | Ga0495601_0000855 | 3300053077 | Bacteria | 16586 |
| 312 | Ga0495601_0003138 | 3300053077 | Bacteria | 9455 |
| 313 | Ga0495601_0003577 | 3300053077 | Bacteria | 8940 |
| 314 | Ga0495601_0102306 | 3300053077 | Bacteria | 1851 |
| 315 | Ga0495601_0194189 | 3300053077 | Unclassified | 1327 |
| 316 | Ga0495612_0000164 | 3300053078 | Bacteria | 27579 |
| 317 | Ga0495612_0023805 | 3300053078 | Bacteria | 2458 |
| 318 | Ga0495612_0042843 | 3300053078 | Bacteria | 1848 |
| 319 | Ga0495612_0200501 | 3300053078 | Bacteria | 880 |
| 320 | Ga0495655_0179404 | 3300053083 | Bacteria | 682 |
| 321 | Ga0495595_0000003 | 3300053084 | Bacteria | 266465 |
| 322 | Ga0495595_0001270 | 3300053084 | Bacteria | 9828 |
| 323 | Ga0495595_0706484 | 3300053084 | Bacteria | 517 |
| 324 | Ga0495619_0000025 | 3300053085 | Bacteria | 167905 |
| 325 | Ga0495619_0000116 | 3300053085 | Bacteria | 58748 |
| 326 | Ga0495619_0001204 | 3300053085 | Bacteria | 16989 |
| 327 | Ga0495619_0011172 | 3300053085 | Bacteria | 5649 |
| 328 | Ga0495619_0031549 | 3300053085 | Bacteria | 3434 |
| 329 | Ga0495619_0384913 | 3300053085 | Bacteria | 969 |
| 330 | Ga0495619_1120355 | 3300053085 | Bacteria | 523 |
| 331 | Ga0500641_0007193 | 3300053096 | Bacteria | 3968 |
| 332 | Ga0500614_000451 | 3300053123 | Bacteria | 10624 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005340 | Ga0070689_100333145 | Ga0070689_1003331452 | 96 |
| 2 | 3300005365 | Ga0070688_100085494 | Ga0070688_1000854941 | 96 |
| 3 | 3300005436 | Ga0070713_100051856 | Ga0070713_1000518564 | 96 |
| 4 | 3300005439 | Ga0070711_100290994 | Ga0070711_1002909942 | 96 |
| 5 | 3300005466 | Ga0070685_10333149 | Ga0070685_103331492 | 96 |
| 6 | 3300005615 | Ga0070702_100057234 | Ga0070702_1000572343 | 96 |
| 7 | 3300025916 | Ga0207663_10022110 | Ga0207663_100221103 | 96 |
| 8 | 3300025928 | Ga0207700_10340486 | Ga0207700_103404862 | 96 |
| 9 | 3300025929 | Ga0207664_10726053 | Ga0207664_107260532 | 96 |
| 10 | 3300025936 | Ga0207670_10113637 | Ga0207670_101136372 | 96 |
| 11 | 3300046511 | Ga0495608_0000125 | Ga0495608_0000125_50392_50682 | 96 |
| 12 | 3300046675 | Ga0495657_0000004 | Ga0495657_0000004_173813_174103 | 96 |
| 13 | 3300047444 | Ga0495675_0000842 | Ga0495675_0000842_12382_12672 | 96 |
| 14 | 3300048088 | Ga0495602_0000041 | Ga0495602_0000041_75977_76267 | 96 |
| 15 | 3300053084 | Ga0495595_0000003 | Ga0495595_0000003_173813_174103 | 96 |
| 16 | 3300053085 | Ga0495619_0000116 | Ga0495619_0000116_20580_20870 | 96 |
| 17 | 3300053096 | Ga0500641_0007193 | Ga0500641_0007193_113_403 | 96 |
| 18 | 3300002074 | JGI24748J21848_1000328 | JGI24748J21848_10003287 | 97 |
| 19 | 3300002239 | JGI24034J26672_10001750 | JGI24034J26672_100017503 | 97 |
| 20 | 3300002244 | JGI24742J22300_10001636 | JGI24742J22300_100016364 | 97 |
| 21 | 3300003203 | JGI25406J46586_10050854 | JGI25406J46586_100508541 | 97 |
| 22 | 3300004803 | Ga0058862_12562150 | Ga0058862_125621502 | 97 |
| 23 | 3300005333 | Ga0070677_10000022 | Ga0070677_1000002229 | 97 |
| 24 | 3300005336 | Ga0070680_100033504 | Ga0070680_1000335042 | 97 |
| 25 | 3300005337 | Ga0070682_100000099 | Ga0070682_10000009994 | 97 |
| 26 | 3300005341 | Ga0070691_10002218 | Ga0070691_1000221810 | 97 |
| 27 | 3300005341 | Ga0070691_10572365 | Ga0070691_105723652 | 97 |
| 28 | 3300005347 | Ga0070668_101474945 | Ga0070668_1014749452 | 97 |
| 29 | 3300005353 | Ga0070669_100035869 | Ga0070669_1000358693 | 97 |
| 30 | 3300005354 | Ga0070675_102249177 | Ga0070675_1022491771 | 97 |
| 31 | 3300005356 | Ga0070674_100000683 | Ga0070674_10000068312 | 97 |
| 32 | 3300005364 | Ga0070673_100005169 | Ga0070673_1000051692 | 97 |
| 33 | 3300005367 | Ga0070667_100864549 | Ga0070667_1008645492 | 97 |
| 34 | 3300005367 | Ga0070667_101403671 | Ga0070667_1014036711 | 97 |
| 35 | 3300005435 | Ga0070714_100089298 | Ga0070714_1000892982 | 97 |
| 36 | 3300005440 | Ga0070705_100430607 | Ga0070705_1004306072 | 97 |
| 37 | 3300005530 | Ga0070679_100003306 | Ga0070679_1000033066 | 97 |
| 38 | 3300005535 | Ga0070684_100008707 | Ga0070684_1000087072 | 97 |
| 39 | 3300005535 | Ga0070684_100042946 | Ga0070684_1000429462 | 97 |
| 40 | 3300005535 | Ga0070684_100179931 | Ga0070684_1001799312 | 97 |
| 41 | 3300005539 | Ga0068853_100050462 | Ga0068853_1000504622 | 97 |
| 42 | 3300005539 | Ga0068853_100933698 | Ga0068853_1009336981 | 97 |
| 43 | 3300005546 | Ga0070696_101116846 | Ga0070696_1011168462 | 97 |
| 44 | 3300005547 | Ga0070693_101445642 | Ga0070693_1014456421 | 97 |
| 45 | 3300005548 | Ga0070665_100000106 | Ga0070665_10000010622 | 97 |
| 46 | 3300005548 | Ga0070665_100559987 | Ga0070665_1005599872 | 97 |
| 47 | 3300005549 | Ga0070704_100772399 | Ga0070704_1007723992 | 97 |
| 48 | 3300005563 | Ga0068855_100728549 | Ga0068855_1007285492 | 97 |
| 49 | 3300005563 | Ga0068855_100816850 | Ga0068855_1008168502 | 97 |
| 50 | 3300005614 | Ga0068856_100036865 | Ga0068856_1000368655 | 97 |
| 51 | 3300005614 | Ga0068856_100923310 | Ga0068856_1009233102 | 97 |
| 52 | 3300005614 | Ga0068856_101970295 | Ga0068856_1019702951 | 97 |
| 53 | 3300005718 | Ga0068866_10000001 | Ga0068866_10000001415 | 97 |
| 54 | 3300005718 | Ga0068866_10001215 | Ga0068866_100012156 | 97 |
| 55 | 3300005719 | Ga0068861_100191468 | Ga0068861_1001914682 | 97 |
| 56 | 3300005719 | Ga0068861_100280513 | Ga0068861_1002805132 | 97 |
| 57 | 3300005719 | Ga0068861_100427141 | Ga0068861_1004271412 | 97 |
| 58 | 3300005840 | Ga0068870_11433162 | Ga0068870_114331621 | 97 |
| 59 | 3300005841 | Ga0068863_100000342 | Ga0068863_10000034249 | 97 |
| 60 | 3300005841 | Ga0068863_100159772 | Ga0068863_1001597722 | 97 |
| 61 | 3300005842 | Ga0068858_100000009 | Ga0068858_100000009177 | 97 |
| 62 | 3300005842 | Ga0068858_100000065 | Ga0068858_10000006535 | 97 |
| 63 | 3300005985 | Ga0081539_10001097 | Ga0081539_1000109710 | 97 |
| 64 | 3300006163 | Ga0070715_10000001 | Ga0070715_10000001382 | 97 |
| 65 | 3300006175 | Ga0070712_100873071 | Ga0070712_1008730712 | 97 |
| 66 | 3300006846 | Ga0075430_100008674 | Ga0075430_1000086748 | 97 |
| 67 | 3300006852 | Ga0075433_10000900 | Ga0075433_1000090022 | 97 |
| 68 | 3300006852 | Ga0075433_10019456 | Ga0075433_100194564 | 97 |
| 69 | 3300006881 | Ga0068865_100931721 | Ga0068865_1009317212 | 97 |
| 70 | 3300009098 | Ga0105245_10014785 | Ga0105245_100147855 | 97 |
| 71 | 3300009098 | Ga0105245_12679043 | Ga0105245_126790431 | 97 |
| 72 | 3300009101 | Ga0105247_10000316 | Ga0105247_1000031636 | 97 |
| 73 | 3300009148 | Ga0105243_10069078 | Ga0105243_100690782 | 97 |
| 74 | 3300009176 | Ga0105242_10062200 | Ga0105242_100622002 | 97 |
| 75 | 3300009176 | Ga0105242_11070652 | Ga0105242_110706522 | 97 |
| 76 | 3300009551 | Ga0105238_10000011 | Ga0105238_10000011211 | 97 |
| 77 | 3300009551 | Ga0105238_10769707 | Ga0105238_107697072 | 97 |
| 78 | 3300009553 | Ga0105249_10000080 | Ga0105249_1000008032 | 97 |
| 79 | 3300009553 | Ga0105249_10140426 | Ga0105249_101404262 | 97 |
| 80 | 3300009553 | Ga0105249_11123207 | Ga0105249_111232072 | 97 |
| 81 | 3300010375 | Ga0105239_10124615 | Ga0105239_101246152 | 97 |
| 82 | 3300011119 | Ga0105246_11495513 | Ga0105246_114955131 | 97 |
| 83 | 3300013104 | Ga0157370_10019163 | Ga0157370_100191636 | 97 |
| 84 | 3300013104 | Ga0157370_11157241 | Ga0157370_111572412 | 97 |
| 85 | 3300013104 | Ga0157370_11381082 | Ga0157370_113810821 | 97 |
| 86 | 3300013296 | Ga0157374_10103698 | Ga0157374_101036982 | 97 |
| 87 | 3300013296 | Ga0157374_10211088 | Ga0157374_102110882 | 97 |
| 88 | 3300013306 | Ga0163162_10647451 | Ga0163162_106474512 | 97 |
| 89 | 3300013308 | Ga0157375_10003707 | Ga0157375_100037072 | 97 |
| 90 | 3300013308 | Ga0157375_10056465 | Ga0157375_100564652 | 97 |
| 91 | 3300013308 | Ga0157375_10173261 | Ga0157375_101732614 | 97 |
| 92 | 3300013308 | Ga0157375_10401382 | Ga0157375_104013824 | 97 |
| 93 | 3300014325 | Ga0163163_11205822 | Ga0163163_112058222 | 97 |
| 94 | 3300014326 | Ga0157380_10002003 | Ga0157380_1000200313 | 97 |
| 95 | 3300014968 | Ga0157379_10003159 | Ga0157379_100031598 | 97 |
| 96 | 3300017792 | Ga0163161_10002086 | Ga0163161_100020864 | 97 |
| 97 | 3300017792 | Ga0163161_10035900 | Ga0163161_100359002 | 97 |
| 98 | 3300025893 | Ga0207682_10000005 | Ga0207682_1000000538 | 97 |
| 99 | 3300025899 | Ga0207642_10000002 | Ga0207642_10000002134 | 97 |
| 100 | 3300025899 | Ga0207642_10003653 | Ga0207642_100036532 | 97 |
| 101 | 3300025900 | Ga0207710_10000458 | Ga0207710_1000045817 | 97 |
| 102 | 3300025900 | Ga0207710_10068743 | Ga0207710_100687432 | 97 |
| 103 | 3300025900 | Ga0207710_10165069 | Ga0207710_101650692 | 97 |
| 104 | 3300025905 | Ga0207685_10000027 | Ga0207685_1000002775 | 97 |
| 105 | 3300025915 | Ga0207693_10664357 | Ga0207693_106643572 | 97 |
| 106 | 3300025917 | Ga0207660_10134079 | Ga0207660_101340792 | 97 |
| 107 | 3300025921 | Ga0207652_10000044 | Ga0207652_1000004482 | 97 |
| 108 | 3300025923 | Ga0207681_10124737 | Ga0207681_101247372 | 97 |
| 109 | 3300025924 | Ga0207694_10000004 | Ga0207694_10000004411 | 97 |
| 110 | 3300025924 | Ga0207694_11264284 | Ga0207694_112642842 | 97 |
| 111 | 3300025927 | Ga0207687_10030006 | Ga0207687_100300065 | 97 |
| 112 | 3300025929 | Ga0207664_10018436 | Ga0207664_100184365 | 97 |
| 113 | 3300025934 | Ga0207686_10756220 | Ga0207686_107562202 | 97 |
| 114 | 3300025934 | Ga0207686_10883572 | Ga0207686_108835721 | 97 |
| 115 | 3300025935 | Ga0207709_10119115 | Ga0207709_101191152 | 97 |
| 116 | 3300025937 | Ga0207669_10000018 | Ga0207669_1000001812 | 97 |
| 117 | 3300025937 | Ga0207669_10000096 | Ga0207669_1000009633 | 97 |
| 118 | 3300025938 | Ga0207704_10668678 | Ga0207704_106686782 | 97 |
| 119 | 3300025939 | Ga0207665_10926948 | Ga0207665_109269482 | 97 |
| 120 | 3300025942 | Ga0207689_10646434 | Ga0207689_106464342 | 97 |
| 121 | 3300025944 | Ga0207661_10048479 | Ga0207661_100484792 | 97 |
| 122 | 3300025944 | Ga0207661_10168464 | Ga0207661_101684642 | 97 |
| 123 | 3300025949 | Ga0207667_11593527 | Ga0207667_115935272 | 97 |
| 124 | 3300025960 | Ga0207651_10010460 | Ga0207651_100104605 | 97 |
| 125 | 3300025961 | Ga0207712_10000007 | Ga0207712_10000007425 | 97 |
| 126 | 3300025961 | Ga0207712_11007625 | Ga0207712_110076252 | 97 |
| 127 | 3300025972 | Ga0207668_11321414 | Ga0207668_113214142 | 97 |
| 128 | 3300025972 | Ga0207668_11366971 | Ga0207668_113669712 | 97 |
| 129 | 3300026035 | Ga0207703_10000018 | Ga0207703_1000001835 | 97 |
| 130 | 3300026035 | Ga0207703_10000023 | Ga0207703_1000002384 | 97 |
| 131 | 3300026041 | Ga0207639_10161229 | Ga0207639_101612292 | 97 |
| 132 | 3300026075 | Ga0207708_11202019 | Ga0207708_112020192 | 97 |
| 133 | 3300026078 | Ga0207702_10004391 | Ga0207702_1000439113 | 97 |
| 134 | 3300026078 | Ga0207702_10976976 | Ga0207702_109769762 | 97 |
| 135 | 3300026088 | Ga0207641_10000238 | Ga0207641_1000023883 | 97 |
| 136 | 3300026088 | Ga0207641_10703158 | Ga0207641_107031582 | 97 |
| 137 | 3300026118 | Ga0207675_100228554 | Ga0207675_1002285542 | 97 |
| 138 | 3300026118 | Ga0207675_100313927 | Ga0207675_1003139272 | 97 |
| 139 | 3300026118 | Ga0207675_100325148 | Ga0207675_1003251483 | 97 |
| 140 | 3300026121 | Ga0207683_10391973 | Ga0207683_103919732 | 97 |
| 141 | 3300028379 | Ga0268266_10000047 | Ga0268266_10000047174 | 97 |
| 142 | 3300028381 | Ga0268264_10013989 | Ga0268264_100139893 | 97 |
| 143 | 3300028563 | Ga0265319_1000020 | Ga0265319_1000020145 | 97 |
| 144 | 3300028800 | Ga0265338_10001248 | Ga0265338_100012488 | 97 |
| 145 | 3300029957 | Ga0265324_10068409 | Ga0265324_100684093 | 97 |
| 146 | 3300031241 | Ga0265325_10001706 | Ga0265325_1000170614 | 97 |
| 147 | 3300031250 | Ga0265331_10026526 | Ga0265331_100265263 | 97 |
| 148 | 3300031251 | Ga0265327_10496809 | Ga0265327_104968092 | 97 |
| 149 | 3300032133 | Ga0316583_10256155 | Ga0316583_102561551 | 97 |
| 150 | 3300035117 | Ga0373953_0042219 | Ga0373953_0042219_471_764 | 97 |
| 151 | 3300035119 | Ga0373956_0218447 | Ga0373956_0218447_58_351 | 97 |
| 152 | 3300035119 | Ga0373956_0580469 | Ga0373956_0580469_169_462 | 97 |
| 153 | 3300035120 | Ga0373957_0023038 | Ga0373957_0023038_233_526 | 97 |
| 154 | 3300035171 | Ga0373946_0452038 | Ga0373946_0452038_17_310 | 97 |
| 155 | 3300035172 | Ga0373955_0297406 | Ga0373955_0297406_74_367 | 97 |
| 156 | 3300035172 | Ga0373955_0370973 | Ga0373955_0370973_213_506 | 97 |
| 157 | 3300035692 | Ga0373935_0623489 | Ga0373935_0623489_457_750 | 97 |
| 158 | 3300036401 | Ga0373937_0073027 | Ga0373937_0073027_92_385 | 97 |
| 159 | 3300036401 | Ga0373937_0102584 | Ga0373937_0102584_2307_2600 | 97 |
| 160 | 3300041459 | Ga0451800_1003097 | Ga0451800_1003097_112_405 | 97 |
| 161 | 3300041501 | Ga0451845_0396799 | Ga0451845_0396799_779_1072 | 97 |
| 162 | 3300041505 | Ga0451849_1458149 | Ga0451849_1458149_212_505 | 97 |
| 163 | 3300041512 | Ga0451853_0974378 | Ga0451853_0974378_1936_2229 | 97 |
| 164 | 3300041512 | Ga0451853_1580302 | Ga0451853_1580302_601_894 | 97 |
| 165 | 3300041512 | Ga0451853_3776184 | Ga0451853_3776184_1726_2019 | 97 |
| 166 | 3300044901 | Ga0466960_0176150 | Ga0466960_0176150_574_870 | 97 |
| 167 | 3300045976 | Ga0466967_1845549 | Ga0466967_1845549_131_427 | 97 |
| 168 | 3300046454 | Ga0495592_0001452 | Ga0495592_0001452_12146_12439 | 97 |
| 169 | 3300046454 | Ga0495592_0350930 | Ga0495592_0350930_638_934 | 97 |
| 170 | 3300046454 | Ga0495592_0824433 | Ga0495592_0824433_57_350 | 97 |
| 171 | 3300046455 | Ga0495603_0002944 | Ga0495603_0002944_8972_9265 | 97 |
| 172 | 3300046455 | Ga0495603_0004199 | Ga0495603_0004199_3880_4173 | 97 |
| 173 | 3300046459 | Ga0495629_0270599 | Ga0495629_0270599_280_573 | 97 |
| 174 | 3300046461 | Ga0495641_0000228 | Ga0495641_0000228_7947_8240 | 97 |
| 175 | 3300046461 | Ga0495641_0352629 | Ga0495641_0352629_301_594 | 97 |
| 176 | 3300046462 | Ga0495651_0051484 | Ga0495651_0051484_1109_1402 | 97 |
| 177 | 3300046462 | Ga0495651_0232517 | Ga0495651_0232517_400_693 | 97 |
| 178 | 3300046463 | Ga0495653_0045841 | Ga0495653_0045841_640_933 | 97 |
| 179 | 3300046463 | Ga0495653_0073825 | Ga0495653_0073825_1312_1605 | 97 |
| 180 | 3300046473 | Ga0495582_0000081 | Ga0495582_0000081_42180_42473 | 97 |
| 181 | 3300046475 | Ga0495639_0113936 | Ga0495639_0113936_37_330 | 97 |
| 182 | 3300046476 | Ga0495662_0000019 | Ga0495662_0000019_51473_51766 | 97 |
| 183 | 3300046477 | Ga0495664_0316124 | Ga0495664_0316124_258_551 | 97 |
| 184 | 3300046477 | Ga0495664_0610544 | Ga0495664_0610544_129_422 | 97 |
| 185 | 3300046491 | Ga0495584_0596863 | Ga0495584_0596863_169_462 | 97 |
| 186 | 3300046499 | Ga0495594_0000029 | Ga0495594_0000029_41624_41917 | 97 |
| 187 | 3300046511 | Ga0495608_0000529 | Ga0495608_0000529_17308_17601 | 97 |
| 188 | 3300046511 | Ga0495608_0066289 | Ga0495608_0066289_451_744 | 97 |
| 189 | 3300046514 | Ga0495618_0000008 | Ga0495618_0000008_3677_3970 | 97 |
| 190 | 3300046514 | Ga0495618_0251286 | Ga0495618_0251286_672_965 | 97 |
| 191 | 3300046514 | Ga0495618_0358367 | Ga0495618_0358367_358_651 | 97 |
| 192 | 3300046515 | Ga0495620_0000824 | Ga0495620_0000824_8536_8829 | 97 |
| 193 | 3300046516 | Ga0495628_0013407 | Ga0495628_0013407_2065_2358 | 97 |
| 194 | 3300046516 | Ga0495628_0023428 | Ga0495628_0023428_3590_3883 | 97 |
| 195 | 3300046516 | Ga0495628_0029017 | Ga0495628_0029017_1525_1818 | 97 |
| 196 | 3300046516 | Ga0495628_0064038 | Ga0495628_0064038_403_696 | 97 |
| 197 | 3300046516 | Ga0495628_0076615 | Ga0495628_0076615_1971_2264 | 97 |
| 198 | 3300046516 | Ga0495628_0318506 | Ga0495628_0318506_517_810 | 97 |
| 199 | 3300046517 | Ga0495630_0009955 | Ga0495630_0009955_2485_2778 | 97 |
| 200 | 3300046517 | Ga0495630_0020498 | Ga0495630_0020498_528_824 | 97 |
| 201 | 3300046517 | Ga0495630_0417732 | Ga0495630_0417732_350_643 | 97 |
| 202 | 3300046517 | Ga0495630_0520206 | Ga0495630_0520206_319_612 | 97 |
| 203 | 3300046517 | Ga0495630_1383227 | Ga0495630_1383227_179_472 | 97 |
| 204 | 3300046529 | Ga0495652_0000407 | Ga0495652_0000407_31143_31436 | 97 |
| 205 | 3300046529 | Ga0495652_0023500 | Ga0495652_0023500_568_861 | 97 |
| 206 | 3300046533 | Ga0495640_0075063 | Ga0495640_0075063_255_548 | 97 |
| 207 | 3300046533 | Ga0495640_0098804 | Ga0495640_0098804_1070_1363 | 97 |
| 208 | 3300046535 | Ga0495586_0000161 | Ga0495586_0000161_330_623 | 97 |
| 209 | 3300046536 | Ga0495587_0020731 | Ga0495587_0020731_1727_2020 | 97 |
| 210 | 3300046536 | Ga0495587_0072183 | Ga0495587_0072183_358_651 | 97 |
| 211 | 3300046536 | Ga0495587_0161031 | Ga0495587_0161031_279_572 | 97 |
| 212 | 3300046536 | Ga0495587_0530322 | Ga0495587_0530322_142_435 | 97 |
| 213 | 3300046539 | Ga0495621_0000576 | Ga0495621_0000576_6339_6632 | 97 |
| 214 | 3300046539 | Ga0495621_0138961 | Ga0495621_0138961_523_816 | 97 |
| 215 | 3300046543 | Ga0495645_0126231 | Ga0495645_0126231_1182_1475 | 97 |
| 216 | 3300046557 | Ga0495622_0000550 | Ga0495622_0000550_11417_11710 | 97 |
| 217 | 3300046559 | Ga0495667_0075296 | Ga0495667_0075296_1480_1773 | 97 |
| 218 | 3300046615 | Ga0495656_0046026 | Ga0495656_0046026_59_352 | 97 |
| 219 | 3300046642 | Ga0495634_0000059 | Ga0495634_0000059_45122_45415 | 97 |
| 220 | 3300046642 | Ga0495634_0283600 | Ga0495634_0283600_345_638 | 97 |
| 221 | 3300046660 | Ga0495625_0000756 | Ga0495625_0000756_13330_13623 | 97 |
| 222 | 3300046663 | Ga0495635_0000044 | Ga0495635_0000044_77661_77954 | 97 |
| 223 | 3300046663 | Ga0495635_0444971 | Ga0495635_0444971_174_467 | 97 |
| 224 | 3300046674 | Ga0495588_0096597 | Ga0495588_0096597_477_770 | 97 |
| 225 | 3300046675 | Ga0495657_0006919 | Ga0495657_0006919_3930_4223 | 97 |
| 226 | 3300046675 | Ga0495657_0067893 | Ga0495657_0067893_672_968 | 97 |
| 227 | 3300046679 | Ga0495623_0359130 | Ga0495623_0359130_159_452 | 97 |
| 228 | 3300046681 | Ga0495647_0000018 | Ga0495647_0000018_75361_75654 | 97 |
| 229 | 3300046681 | Ga0495647_0065668 | Ga0495647_0065668_356_649 | 97 |
| 230 | 3300046683 | Ga0495658_0000034 | Ga0495658_0000034_44680_44973 | 97 |
| 231 | 3300046684 | Ga0495669_0000033 | Ga0495669_0000033_92952_93245 | 97 |
| 232 | 3300046684 | Ga0495669_0174920 | Ga0495669_0174920_65_358 | 97 |
| 233 | 3300046689 | Ga0495613_0004320 | Ga0495613_0004320_846_1139 | 97 |
| 234 | 3300046689 | Ga0495613_0009782 | Ga0495613_0009782_5122_5415 | 97 |
| 235 | 3300046689 | Ga0495613_0214661 | Ga0495613_0214661_752_1045 | 97 |
| 236 | 3300046690 | Ga0495624_0000097 | Ga0495624_0000097_57977_58270 | 97 |
| 237 | 3300046690 | Ga0495624_0145724 | Ga0495624_0145724_846_1139 | 97 |
| 238 | 3300046694 | Ga0495649_0005110 | Ga0495649_0005110_879_1172 | 97 |
| 239 | 3300046809 | Ga0495600_0005795 | Ga0495600_0005795_3600_3893 | 97 |
| 240 | 3300046809 | Ga0495600_0007876 | Ga0495600_0007876_602_895 | 97 |
| 241 | 3300046809 | Ga0495600_0189785 | Ga0495600_0189785_146_439 | 97 |
| 242 | 3300047315 | Ga0495581_0369804 | Ga0495581_0369804_241_534 | 97 |
| 243 | 3300047317 | Ga0495604_0000055 | Ga0495604_0000055_55435_55728 | 97 |
| 244 | 3300047317 | Ga0495604_0000137 | Ga0495604_0000137_51602_51895 | 97 |
| 245 | 3300047317 | Ga0495604_0095577 | Ga0495604_0095577_1732_2025 | 97 |
| 246 | 3300047317 | Ga0495604_0108473 | Ga0495604_0108473_1015_1308 | 97 |
| 247 | 3300047319 | Ga0495674_0000064 | Ga0495674_0000064_36899_37192 | 97 |
| 248 | 3300047319 | Ga0495674_0090784 | Ga0495674_0090784_593_886 | 97 |
| 249 | 3300047320 | Ga0495672_0060363 | Ga0495672_0060363_385_678 | 97 |
| 250 | 3300047321 | Ga0495676_0000130 | Ga0495676_0000130_28559_28852 | 97 |
| 251 | 3300047321 | Ga0495676_0002521 | Ga0495676_0002521_11779_12072 | 97 |
| 252 | 3300047321 | Ga0495676_0319030 | Ga0495676_0319030_272_565 | 97 |
| 253 | 3300047322 | Ga0495680_0000550 | Ga0495680_0000550_37342_37635 | 97 |
| 254 | 3300047322 | Ga0495680_0003958 | Ga0495680_0003958_10348_10641 | 97 |
| 255 | 3300047322 | Ga0495680_0419149 | Ga0495680_0419149_307_603 | 97 |
| 256 | 3300047322 | Ga0495680_0614174 | Ga0495680_0614174_109_402 | 97 |
| 257 | 3300047444 | Ga0495675_0038105 | Ga0495675_0038105_345_638 | 97 |
| 258 | 3300047446 | Ga0495679_033543 | Ga0495679_033543_1010_1303 | 97 |
| 259 | 3300047469 | Ga0495673_0159348 | Ga0495673_0159348_519_812 | 97 |
| 260 | 3300047471 | Ga0495684_0119228 | Ga0495684_0119228_970_1266 | 97 |
| 261 | 3300047471 | Ga0495684_0181492 | Ga0495684_0181492_644_937 | 97 |
| 262 | 3300047472 | Ga0495686_0046322 | Ga0495686_0046322_2015_2308 | 97 |
| 263 | 3300047673 | Ga0495593_0082300 | Ga0495593_0082300_494_787 | 97 |
| 264 | 3300047673 | Ga0495593_0259332 | Ga0495593_0259332_334_627 | 97 |
| 265 | 3300048088 | Ga0495602_0040615 | Ga0495602_0040615_3511_3861 | 97 |
| 266 | 3300048089 | Ga0495614_0357863 | Ga0495614_0357863_110_403 | 97 |
| 267 | 3300048903 | Ga0496100_0000005 | Ga0496100_0000005_278172_278465 | 97 |
| 268 | 3300048904 | Ga0496101_0000101 | Ga0496101_0000101_52589_52882 | 97 |
| 269 | 3300048904 | Ga0496101_1149025 | Ga0496101_1149025_208_501 | 97 |
| 270 | 3300048905 | Ga0496102_1021099 | Ga0496102_1021099_148_441 | 97 |
| 271 | 3300048907 | Ga0496104_0006952 | Ga0496104_0006952_8578_8871 | 97 |
| 272 | 3300048908 | Ga0496105_0000650 | Ga0496105_0000650_8020_8313 | 97 |
| 273 | 3300048908 | Ga0496105_0308255 | Ga0496105_0308255_253_546 | 97 |
| 274 | 3300048909 | Ga0496106_0000151 | Ga0496106_0000151_4742_5035 | 97 |
| 275 | 3300048909 | Ga0496106_0000682 | Ga0496106_0000682_16365_16658 | 97 |
| 276 | 3300048909 | Ga0496106_0545561 | Ga0496106_0545561_186_479 | 97 |
| 277 | 3300048910 | Ga0496107_0000011 | Ga0496107_0000011_33418_33711 | 97 |
| 278 | 3300048911 | Ga0496108_0000001 | Ga0496108_0000001_726786_727079 | 97 |
| 279 | 3300048911 | Ga0496108_0000281 | Ga0496108_0000281_38558_38851 | 97 |
| 280 | 3300048911 | Ga0496108_1022358 | Ga0496108_1022358_131_427 | 97 |
| 281 | 3300048912 | Ga0496109_0000003 | Ga0496109_0000003_401332_401625 | 97 |
| 282 | 3300048912 | Ga0496109_0001118 | Ga0496109_0001118_18815_19108 | 97 |
| 283 | 3300048913 | Ga0496110_0004679 | Ga0496110_0004679_2396_2692 | 97 |
| 284 | 3300048913 | Ga0496110_0011255 | Ga0496110_0011255_2175_2468 | 97 |
| 285 | 3300048913 | Ga0496110_0059030 | Ga0496110_0059030_2501_2794 | 97 |
| 286 | 3300048913 | Ga0496110_0649554 | Ga0496110_0649554_409_702 | 97 |
| 287 | 3300048914 | Ga0496111_0185752 | Ga0496111_0185752_292_588 | 97 |
| 288 | 3300048914 | Ga0496111_0384726 | Ga0496111_0384726_110_403 | 97 |
| 289 | 3300048915 | Ga0496112_0000006 | Ga0496112_0000006_283946_284239 | 97 |
| 290 | 3300048915 | Ga0496112_0007591 | Ga0496112_0007591_5519_5812 | 97 |
| 291 | 3300048915 | Ga0496112_0421312 | Ga0496112_0421312_666_959 | 97 |
| 292 | 3300048916 | Ga0496113_0003552 | Ga0496113_0003552_5166_5459 | 97 |
| 293 | 3300048916 | Ga0496113_0007799 | Ga0496113_0007799_5501_5794 | 97 |
| 294 | 3300048916 | Ga0496113_0243558 | Ga0496113_0243558_921_1214 | 97 |
| 295 | 3300048916 | Ga0496113_0457707 | Ga0496113_0457707_595_888 | 97 |
| 296 | 3300048916 | Ga0496113_0673853 | Ga0496113_0673853_230_523 | 97 |
| 297 | 3300048917 | Ga0496114_0000101 | Ga0496114_0000101_19364_19657 | 97 |
| 298 | 3300048918 | Ga0496115_0000003 | Ga0496115_0000003_118089_118382 | 97 |
| 299 | 3300048918 | Ga0496115_0000200 | Ga0496115_0000200_36099_36392 | 97 |
| 300 | 3300049571 | Ga0501034_0365781 | Ga0501034_0365781_848_1162 | 97 |
| 301 | 3300049575 | Ga0501039_0162965 | Ga0501039_0162965_173_466 | 97 |
| 302 | 3300049576 | Ga0501040_0261083 | Ga0501040_0261083_725_1021 | 97 |
| 303 | 3300049578 | Ga0501042_0441792 | Ga0501042_0441792_241_534 | 97 |
| 304 | 3300049581 | Ga0501047_0115425 | Ga0501047_0115425_1360_1674 | 97 |
| 305 | 3300049584 | Ga0501068_0682535 | Ga0501068_0682535_306_599 | 97 |
| 306 | 3300049586 | Ga0501070_0443368 | Ga0501070_0443368_477_770 | 97 |
| 307 | 3300049588 | Ga0501072_0115179 | Ga0501072_0115179_1376_1693 | 97 |
| 308 | 3300049591 | Ga0501075_0546991 | Ga0501075_0546991_418_711 | 97 |
| 309 | 3300049592 | Ga0501076_1192194 | Ga0501076_1192194_193_486 | 97 |
| 310 | 3300049741 | Ga0501079_0337354 | Ga0501079_0337354_273_590 | 97 |
| 311 | 3300050509 | nmdc:mga0qj67_18640_c2 | nmdc:mga0qj67_18640_c2_1768_2061 | 97 |
| 312 | 3300050515 | nmdc:mga0a205_1483_c2 | nmdc:mga0a205_1483_c2_5020_5313 | 97 |
| 313 | 3300050515 | nmdc:mga0a205_6_c1 | nmdc:mga0a205_6_c1_120812_121105 | 97 |
| 314 | 3300053077 | Ga0495601_0000855 | Ga0495601_0000855_9052_9345 | 97 |
| 315 | 3300053077 | Ga0495601_0003138 | Ga0495601_0003138_5068_5361 | 97 |
| 316 | 3300053077 | Ga0495601_0003577 | Ga0495601_0003577_8299_8595 | 97 |
| 317 | 3300053077 | Ga0495601_0102306 | Ga0495601_0102306_231_524 | 97 |
| 318 | 3300053077 | Ga0495601_0194189 | Ga0495601_0194189_164_457 | 97 |
| 319 | 3300053078 | Ga0495612_0000164 | Ga0495612_0000164_15261_15554 | 97 |
| 320 | 3300053078 | Ga0495612_0023805 | Ga0495612_0023805_752_1045 | 97 |
| 321 | 3300053078 | Ga0495612_0042843 | Ga0495612_0042843_269_562 | 97 |
| 322 | 3300053078 | Ga0495612_0200501 | Ga0495612_0200501_534_827 | 97 |
| 323 | 3300053083 | Ga0495655_0179404 | Ga0495655_0179404_200_493 | 97 |
| 324 | 3300053084 | Ga0495595_0001270 | Ga0495595_0001270_5986_6279 | 97 |
| 325 | 3300053084 | Ga0495595_0706484 | Ga0495595_0706484_17_310 | 97 |
| 326 | 3300053085 | Ga0495619_0000025 | Ga0495619_0000025_120936_121229 | 97 |
| 327 | 3300053085 | Ga0495619_0001204 | Ga0495619_0001204_5940_6233 | 97 |
| 328 | 3300053085 | Ga0495619_0011172 | Ga0495619_0011172_1291_1584 | 97 |
| 329 | 3300053085 | Ga0495619_0031549 | Ga0495619_0031549_1955_2248 | 97 |
| 330 | 3300053085 | Ga0495619_0384913 | Ga0495619_0384913_449_745 | 97 |
| 331 | 3300053085 | Ga0495619_1120355 | Ga0495619_1120355_66_359 | 97 |
| 332 | 3300053123 | Ga0500614_000451 | Ga0500614_000451_1948_2241 | 97 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2omo-assembly2.cif.gz_C | putative antibiotic biosynthesis monooxygenase from nitrosomonas europaea | 0.9222 | 2 | 96 |
| 4zos-assembly1.cif.gz_C | 2.20 angstrom resolution crystal structure of protein ye0340 of unidentified function from yersinia enterocolitica subsp. enterocolitica 8081] | 0.9147 | 2 | 95 |
| 4zos-assembly2.cif.gz_B | 2.20 angstrom resolution crystal structure of protein ye0340 of unidentified function from yersinia enterocolitica subsp. enterocolitica 8081] | 0.9132 | 2 | 95 |
| 4dpo-assembly1.cif.gz_B | crystal structure of a conserved protein mm_1583 from methanosarcina mazei go1 | 0.9114 | 1 | 91 |
| 2omo-assembly4.cif.gz_E | putative antibiotic biosynthesis monooxygenase from nitrosomonas europaea | 0.9106 | 3 | 94 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4zosB00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9132 | 2 | 95 | 3.30.70.100 |
| 3qmqB00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9023 | 1 | 94 | 3.30.70.100 |
| 4dpoB00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8887 | 2 | 94 | 3.30.70.100 |
| af_Q8BG18_205_343_3.30.70.100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8836 | 2 | 91 | 3.30.70.100 |
| af_O33291_1_95_3.30.70.100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8807 | 1 | 97 | 3.30.70.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A838V4U8-F1-model_v4 | Antibiotic biosynthesis monooxygenase | 0.9749 | 1 | 97 |
|
| AF-A0A7V9S2F7-F1-model_v4 | ABM domain-containing protein | 0.9491 | 3 | 97 |
|
| AF-A0A7W0RCL5-F1-model_v4 | Antibiotic biosynthesis monooxygenase | 0.94 | 3 | 97 |
|
| AF-A0A0Q6S9B2-F1-model_v4 | ABM domain-containing protein | 0.9344 | 2 | 95 |
GO:0003824
|
| AF-A0A6J7CXM4-F1-model_v4 | Unannotated protein | 0.9326 | 1 | 97 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar