F411088

General Info

Members Datasets Scaffolds Average Seq Length
332 201 332 97

Family's Representative Sequence

Representative Sequence 3300048088|Ga0495602_0040615|Ga0495602_0040615_3511_3861
Length 116
Sequence MIEVCRLDWHIAPFRADRWLDLWEPAAAKMPAYGAKSWSLTRSIDDPLAFQQTATWEKRSDFERYWYSEEIETARASVIDLYDLPLRLRLFALQGGHGESGGLKLVPVVLGGLAGA

Samples

Sample ID Description Type Environment
1 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
95 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
96 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
97 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
98 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
99 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
100 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
101 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
102 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
103 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
104 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
105 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
106 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
107 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
108 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
109 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
110 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
111 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
112 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
113 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
114 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
115 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
116 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
117 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
118 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
119 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
120 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
121 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
122 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
123 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
124 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
125 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
126 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
127 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
128 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
129 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
130 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
131 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
132 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
133 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
134 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
135 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
136 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
137 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
138 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
139 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
140 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
141 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
142 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
143 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
144 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
145 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
146 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
147 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
148 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
149 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
150 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
151 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
152 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
153 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
154 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
155 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
156 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
157 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
158 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
159 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
160 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
161 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
162 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
163 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
164 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
165 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
166 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
167 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
171 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
172 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
173 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
190 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
191 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
192 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
193 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
194 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
195 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
196 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
197 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
198 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
199 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
200 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
201 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.6
Nodule 0
Rhizoplane 10.24
Rhizosphere 87.65
Stem 0
Stem Tuber 0
Unclassified 1.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24748J21848_1000328 3300002074 Bacteria 5472
2 JGI24034J26672_10001750 3300002239 Bacteria 2921
3 JGI24742J22300_10001636 3300002244 Bacteria 3561
4 JGI25406J46586_10050854 3300003203 Bacteria 1390
5 Ga0058862_12562150 3300004803 Bacteria 735
6 Ga0070677_10000022 3300005333 Bacteria 45355
7 Ga0070680_100033504 3300005336 Bacteria 4142
8 Ga0070682_100000099 3300005337 Bacteria 77574
9 Ga0070689_100333145 3300005340 Bacteria 1270
10 Ga0070691_10002218 3300005341 Bacteria 8594
11 Ga0070691_10572365 3300005341 Unclassified 663
12 Ga0070668_101474945 3300005347 Unclassified 621
13 Ga0070669_100035869 3300005353 Bacteria 3593
14 Ga0070675_102249177 3300005354 Unclassified 502
15 Ga0070674_100000683 3300005356 Bacteria 17159
16 Ga0070673_100005169 3300005364 Bacteria 8331
17 Ga0070688_100085494 3300005365 Bacteria 2050
18 Ga0070667_100864549 3300005367 Unclassified 841
19 Ga0070667_101403671 3300005367 Bacteria 655
20 Ga0070714_100089298 3300005435 Bacteria 2698
21 Ga0070713_100051856 3300005436 Bacteria 3395
22 Ga0070711_100290994 3300005439 Bacteria 1295
23 Ga0070705_100430607 3300005440 Bacteria 985
24 Ga0070685_10333149 3300005466 Bacteria 1032
25 Ga0070679_100003306 3300005530 Bacteria 14762
26 Ga0070684_100008707 3300005535 Bacteria 7954
27 Ga0070684_100042946 3300005535 Bacteria 3904
28 Ga0070684_100179931 3300005535 Bacteria 1922
29 Ga0068853_100050462 3300005539 Bacteria 3579
30 Ga0068853_100933698 3300005539 Unclassified 834
31 Ga0070696_101116846 3300005546 Bacteria 663
32 Ga0070693_101445642 3300005547 Bacteria 536
33 Ga0070665_100000106 3300005548 Bacteria 157315
34 Ga0070665_100559987 3300005548 Bacteria 1155
35 Ga0070704_100772399 3300005549 Bacteria 857
36 Ga0068855_100728549 3300005563 Bacteria 1059
37 Ga0068855_100816850 3300005563 Bacteria 990
38 Ga0068856_100036865 3300005614 Bacteria 4795
39 Ga0068856_100923310 3300005614 Bacteria 892
40 Ga0068856_101970295 3300005614 Unclassified 595
41 Ga0070702_100057234 3300005615 Bacteria 2255
42 Ga0068866_10000001 3300005718 Bacteria 519680
43 Ga0068866_10001215 3300005718 Bacteria 11198
44 Ga0068861_100191468 3300005719 Bacteria 1710
45 Ga0068861_100280513 3300005719 Bacteria 1435
46 Ga0068861_100427141 3300005719 Bacteria 1182
47 Ga0068870_11433162 3300005840 Bacteria 507
48 Ga0068863_100000342 3300005841 Bacteria 47536
49 Ga0068863_100159772 3300005841 Bacteria 2159
50 Ga0068858_100000009 3300005842 Bacteria 237748
51 Ga0068858_100000065 3300005842 Bacteria 108233
52 Ga0081539_10001097 3300005985 Bacteria 49223
53 Ga0070715_10000001 3300006163 Bacteria 693690
54 Ga0070712_100873071 3300006175 Bacteria 775
55 Ga0075430_100008674 3300006846 Bacteria 8577
56 Ga0075433_10000900 3300006852 Bacteria 20958
57 Ga0075433_10019456 3300006852 Bacteria 5657
58 Ga0068865_100931721 3300006881 Bacteria 757
59 Ga0105245_10014785 3300009098 Bacteria 6798
60 Ga0105245_12679043 3300009098 Bacteria 552
61 Ga0105247_10000316 3300009101 Bacteria 43374
62 Ga0105243_10069078 3300009148 Bacteria 2849
63 Ga0105242_10062200 3300009176 Bacteria 3071
64 Ga0105242_11070652 3300009176 Bacteria 818
65 Ga0105238_10000011 3300009551 Bacteria 261080
66 Ga0105238_10769707 3300009551 Bacteria 977
67 Ga0105249_10000080 3300009553 Bacteria 138080
68 Ga0105249_10140426 3300009553 Bacteria 2316
69 Ga0105249_11123207 3300009553 Bacteria 856
70 Ga0105239_10124615 3300010375 Bacteria 2863
71 Ga0105246_11495513 3300011119 Bacteria 634
72 Ga0157370_10019163 3300013104 Bacteria 6876
73 Ga0157370_11157241 3300013104 Unclassified 698
74 Ga0157370_11381082 3300013104 Bacteria 634
75 Ga0157374_10103698 3300013296 Bacteria 2729
76 Ga0157374_10211088 3300013296 Bacteria 1903
77 Ga0163162_10647451 3300013306 Unclassified 1180
78 Ga0157375_10003707 3300013308 Bacteria 13266
79 Ga0157375_10056465 3300013308 Bacteria 3876
80 Ga0157375_10173261 3300013308 Bacteria 2306
81 Ga0157375_10401382 3300013308 Bacteria 1537
82 Ga0163163_11205822 3300014325 Bacteria 819
83 Ga0157380_10002003 3300014326 Bacteria 13578
84 Ga0157379_10003159 3300014968 Bacteria 13936
85 Ga0163161_10002086 3300017792 Bacteria 14485
86 Ga0163161_10035900 3300017792 Bacteria 3549
87 Ga0207682_10000005 3300025893 Bacteria 95617
88 Ga0207642_10000002 3300025899 Bacteria 658166
89 Ga0207642_10003653 3300025899 Bacteria 4884
90 Ga0207710_10000458 3300025900 Bacteria 26155
91 Ga0207710_10068743 3300025900 Bacteria 1620
92 Ga0207710_10165069 3300025900 Bacteria 1080
93 Ga0207685_10000027 3300025905 Bacteria 102101
94 Ga0207693_10664357 3300025915 Bacteria 809
95 Ga0207663_10022110 3300025916 Bacteria 3632
96 Ga0207660_10134079 3300025917 Unclassified 1888
97 Ga0207652_10000044 3300025921 Bacteria 127779
98 Ga0207681_10124737 3300025923 Bacteria 1894
99 Ga0207694_10000004 3300025924 Bacteria 967075
100 Ga0207694_11264284 3300025924 Unclassified 624
101 Ga0207687_10030006 3300025927 Bacteria 3662
102 Ga0207700_10340486 3300025928 Bacteria 1304
103 Ga0207664_10018436 3300025929 Bacteria 5139
104 Ga0207664_10726053 3300025929 Bacteria 893
105 Ga0207686_10756220 3300025934 Bacteria 776
106 Ga0207686_10883572 3300025934 Bacteria 720
107 Ga0207709_10119115 3300025935 Bacteria 1779
108 Ga0207670_10113637 3300025936 Bacteria 1956
109 Ga0207669_10000018 3300025937 Bacteria 114254
110 Ga0207669_10000096 3300025937 Bacteria 44213
111 Ga0207704_10668678 3300025938 Unclassified 857
112 Ga0207665_10926948 3300025939 Bacteria 691
113 Ga0207689_10646434 3300025942 Bacteria 891
114 Ga0207661_10048479 3300025944 Bacteria 3376
115 Ga0207661_10168464 3300025944 Bacteria 1905
116 Ga0207667_11593527 3300025949 Bacteria 622
117 Ga0207651_10010460 3300025960 Bacteria 5144
118 Ga0207712_10000007 3300025961 Bacteria 539589
119 Ga0207712_11007625 3300025961 Bacteria 739
120 Ga0207668_11321414 3300025972 Unclassified 649
121 Ga0207668_11366971 3300025972 Unclassified 638
122 Ga0207703_10000018 3300026035 Bacteria 271377
123 Ga0207703_10000023 3300026035 Bacteria 222018
124 Ga0207639_10161229 3300026041 Bacteria 1890
125 Ga0207708_11202019 3300026075 Bacteria 663
126 Ga0207702_10004391 3300026078 Bacteria 12560
127 Ga0207702_10976976 3300026078 Bacteria 840
128 Ga0207641_10000238 3300026088 Bacteria 71152
129 Ga0207641_10703158 3300026088 Bacteria 995
130 Ga0207675_100228554 3300026118 Bacteria 1794
131 Ga0207675_100313927 3300026118 Bacteria 1529
132 Ga0207675_100325148 3300026118 Bacteria 1502
133 Ga0207683_10391973 3300026121 Bacteria 1277
134 Ga0268266_10000047 3300028379 Bacteria 310996
135 Ga0268264_10013989 3300028381 Bacteria 6596
136 Ga0265319_1000020 3300028563 Bacteria 153921
137 Ga0265338_10001248 3300028800 Bacteria 41926
138 Ga0265324_10068409 3300029957 Bacteria 1211
139 Ga0265325_10001706 3300031241 Bacteria 15281
140 Ga0265331_10026526 3300031250 Bacteria 2911
141 Ga0265327_10496809 3300031251 Bacteria 526
142 Ga0316583_10256155 3300032133 Bacteria 606
143 Ga0373953_0042219 3300035117 Bacteria 1817
144 Ga0373956_0218447 3300035119 Bacteria 905
145 Ga0373956_0580469 3300035119 Unclassified 535
146 Ga0373957_0023038 3300035120 Bacteria 2224
147 Ga0373946_0452038 3300035171 Bacteria 654
148 Ga0373955_0297406 3300035172 Bacteria 973
149 Ga0373955_0370973 3300035172 Bacteria 868
150 Ga0373935_0623489 3300035692 Bacteria 790
151 Ga0373937_0073027 3300036401 Bacteria 3164
152 Ga0373937_0102584 3300036401 Unclassified 2656
153 Ga0451800_1003097 3300041459 Bacteria 522
154 Ga0451845_0396799 3300041501 Bacteria 1340
155 Ga0451849_1458149 3300041505 Bacteria 709
156 Ga0451853_0974378 3300041512 Bacteria 2739
157 Ga0451853_1580302 3300041512 Bacteria 1328
158 Ga0451853_3776184 3300041512 Bacteria 2473
159 Ga0466960_0176150 3300044901 Bacteria 1157
160 Ga0466967_1845549 3300045976 Bacteria 601
161 Ga0495592_0001452 3300046454 Bacteria 16469
162 Ga0495592_0350930 3300046454 Bacteria 946
163 Ga0495592_0824433 3300046454 Unclassified 550
164 Ga0495603_0002944 3300046455 Bacteria 10072
165 Ga0495603_0004199 3300046455 Bacteria 8579
166 Ga0495629_0270599 3300046459 Bacteria 1167
167 Ga0495641_0000228 3300046461 Bacteria 43671
168 Ga0495641_0352629 3300046461 Bacteria 665
169 Ga0495651_0051484 3300046462 Bacteria 3174
170 Ga0495651_0232517 3300046462 Bacteria 1269
171 Ga0495653_0045841 3300046463 Bacteria 3388
172 Ga0495653_0073825 3300046463 Bacteria 2544
173 Ga0495582_0000081 3300046473 Bacteria 48557
174 Ga0495639_0113936 3300046475 Bacteria 1285
175 Ga0495662_0000019 3300046476 Bacteria 55148
176 Ga0495664_0316124 3300046477 Bacteria 942
177 Ga0495664_0610544 3300046477 Bacteria 648
178 Ga0495584_0596863 3300046491 Unclassified 563
179 Ga0495594_0000029 3300046499 Bacteria 66789
180 Ga0495608_0000125 3300046511 Bacteria 54881
181 Ga0495608_0000529 3300046511 Bacteria 26174
182 Ga0495608_0066289 3300046511 Bacteria 2364
183 Ga0495618_0000008 3300046514 Bacteria 204578
184 Ga0495618_0251286 3300046514 Bacteria 1109
185 Ga0495618_0358367 3300046514 Bacteria 898
186 Ga0495620_0000824 3300046515 Bacteria 19119
187 Ga0495628_0013407 3300046516 Bacteria 6897
188 Ga0495628_0023428 3300046516 Bacteria 5068
189 Ga0495628_0029017 3300046516 Bacteria 4491
190 Ga0495628_0064038 3300046516 Bacteria 2879
191 Ga0495628_0076615 3300046516 Bacteria 2602
192 Ga0495628_0318506 3300046516 Bacteria 1148
193 Ga0495630_0009955 3300046517 Bacteria 6845
194 Ga0495630_0020498 3300046517 Bacteria 4874
195 Ga0495630_0417732 3300046517 Bacteria 1028
196 Ga0495630_0520206 3300046517 Bacteria 912
197 Ga0495630_1383227 3300046517 Unclassified 529
198 Ga0495652_0000407 3300046529 Bacteria 50232
199 Ga0495652_0023500 3300046529 Bacteria 5465
200 Ga0495640_0075063 3300046533 Bacteria 2258
201 Ga0495640_0098804 3300046533 Bacteria 1918
202 Ga0495586_0000161 3300046535 Bacteria 43544
203 Ga0495587_0020731 3300046536 Bacteria 4055
204 Ga0495587_0072183 3300046536 Bacteria 2007
205 Ga0495587_0161031 3300046536 Bacteria 1277
206 Ga0495587_0530322 3300046536 Unclassified 650
207 Ga0495621_0000576 3300046539 Bacteria 9156
208 Ga0495621_0138961 3300046539 Bacteria 949
209 Ga0495645_0126231 3300046543 Bacteria 1798
210 Ga0495622_0000550 3300046557 Bacteria 22511
211 Ga0495667_0075296 3300046559 Bacteria 2197
212 Ga0495656_0046026 3300046615 Bacteria 1845
213 Ga0495634_0000059 3300046642 Bacteria 88314
214 Ga0495634_0283600 3300046642 Bacteria 1005
215 Ga0495625_0000756 3300046660 Bacteria 45145
216 Ga0495635_0000044 3300046663 Bacteria 83945
217 Ga0495635_0444971 3300046663 Unclassified 857
218 Ga0495588_0096597 3300046674 Bacteria 1550
219 Ga0495657_0000004 3300046675 Bacteria 266465
220 Ga0495657_0006919 3300046675 Bacteria 8815
221 Ga0495657_0067893 3300046675 Bacteria 2338
222 Ga0495623_0359130 3300046679 Bacteria 792
223 Ga0495647_0000018 3300046681 Bacteria 81701
224 Ga0495647_0065668 3300046681 Bacteria 1441
225 Ga0495658_0000034 3300046683 Bacteria 69176
226 Ga0495669_0000033 3300046684 Bacteria 98629
227 Ga0495669_0174920 3300046684 Bacteria 1022
228 Ga0495613_0004320 3300046689 Bacteria 10639
229 Ga0495613_0009782 3300046689 Bacteria 7127
230 Ga0495613_0214661 3300046689 Bacteria 1352
231 Ga0495624_0000097 3300046690 Bacteria 58715
232 Ga0495624_0145724 3300046690 Unclassified 1449
233 Ga0495649_0005110 3300046694 Bacteria 8421
234 Ga0495600_0005795 3300046809 Bacteria 7463
235 Ga0495600_0007876 3300046809 Bacteria 6525
236 Ga0495600_0189785 3300046809 Bacteria 1322
237 Ga0495581_0369804 3300047315 Unclassified 837
238 Ga0495604_0000055 3300047317 Bacteria 100430
239 Ga0495604_0000137 3300047317 Bacteria 62542
240 Ga0495604_0095577 3300047317 Bacteria 2195
241 Ga0495604_0108473 3300047317 Bacteria 2028
242 Ga0495674_0000064 3300047319 Bacteria 71275
243 Ga0495674_0090784 3300047319 Bacteria 2610
244 Ga0495672_0060363 3300047320 Bacteria 2191
245 Ga0495676_0000130 3300047321 Bacteria 56693
246 Ga0495676_0002521 3300047321 Bacteria 16308
247 Ga0495676_0319030 3300047321 Bacteria 1044
248 Ga0495680_0000550 3300047322 Bacteria 42291
249 Ga0495680_0003958 3300047322 Bacteria 14324
250 Ga0495680_0419149 3300047322 Bacteria 921
251 Ga0495680_0614174 3300047322 Bacteria 726
252 Ga0495675_0000842 3300047444 Bacteria 18758
253 Ga0495675_0038105 3300047444 Bacteria 3062
254 Ga0495679_033543 3300047446 Bacteria 1639
255 Ga0495673_0159348 3300047469 Bacteria 867
256 Ga0495684_0119228 3300047471 Bacteria 1988
257 Ga0495684_0181492 3300047471 Bacteria 1560
258 Ga0495686_0046322 3300047472 Bacteria 2749
259 Ga0495593_0082300 3300047673 Bacteria 1664
260 Ga0495593_0259332 3300047673 Bacteria 870
261 Ga0495602_0000041 3300048088 Bacteria 126954
262 Ga0495602_0040615 3300048088 Bacteria 4262
263 Ga0495614_0357863 3300048089 Bacteria 681
264 Ga0496100_0000005 3300048903 Bacteria 312112
265 Ga0496101_0000101 3300048904 Bacteria 89424
266 Ga0496101_1149025 3300048904 Bacteria 609
267 Ga0496102_1021099 3300048905 Unclassified 747
268 Ga0496104_0006952 3300048907 Bacteria 9977
269 Ga0496105_0000650 3300048908 Bacteria 23286
270 Ga0496105_0308255 3300048908 Bacteria 1271
271 Ga0496106_0000151 3300048909 Bacteria 51430
272 Ga0496106_0000682 3300048909 Bacteria 24335
273 Ga0496106_0545561 3300048909 Bacteria 930
274 Ga0496107_0000011 3300048910 Bacteria 201631
275 Ga0496108_0000001 3300048911 Bacteria 919044
276 Ga0496108_0000281 3300048911 Bacteria 43637
277 Ga0496108_1022358 3300048911 Unclassified 705
278 Ga0496109_0000003 3300048912 Bacteria 420862
279 Ga0496109_0001118 3300048912 Bacteria 22284
280 Ga0496110_0004679 3300048913 Bacteria 10644
281 Ga0496110_0011255 3300048913 Bacteria 7314
282 Ga0496110_0059030 3300048913 Bacteria 3380
283 Ga0496110_0649554 3300048913 Bacteria 955
284 Ga0496111_0185752 3300048914 Bacteria 1545
285 Ga0496111_0384726 3300048914 Bacteria 1037
286 Ga0496112_0000006 3300048915 Bacteria 365227
287 Ga0496112_0007591 3300048915 Bacteria 9637
288 Ga0496112_0421312 3300048915 Bacteria 1274
289 Ga0496113_0003552 3300048916 Bacteria 9354
290 Ga0496113_0007799 3300048916 Bacteria 6917
291 Ga0496113_0243558 3300048916 Bacteria 1435
292 Ga0496113_0457707 3300048916 Unclassified 1025
293 Ga0496113_0673853 3300048916 Bacteria 826
294 Ga0496114_0000101 3300048917 Bacteria 61589
295 Ga0496115_0000003 3300048918 Bacteria 354994
296 Ga0496115_0000200 3300048918 Bacteria 55755
297 Ga0501034_0365781 3300049571 Bacteria 1369
298 Ga0501039_0162965 3300049575 Bacteria 1753
299 Ga0501040_0261083 3300049576 Bacteria 1236
300 Ga0501042_0441792 3300049578 Unclassified 943
301 Ga0501047_0115425 3300049581 Bacteria 2567
302 Ga0501068_0682535 3300049584 Bacteria 671
303 Ga0501070_0443368 3300049586 Bacteria 1047
304 Ga0501072_0115179 3300049588 Bacteria 2140
305 Ga0501075_0546991 3300049591 Bacteria 884
306 Ga0501076_1192194 3300049592 Bacteria 627
307 Ga0501079_0337354 3300049741 Bacteria 1181
308 nmdc:mga0qj67_18640_c2 3300050509 Bacteria 3942
309 nmdc:mga0a205_1483_c2 3300050515 Bacteria 8882
310 nmdc:mga0a205_6_c1 3300050515 Bacteria 129758
311 Ga0495601_0000855 3300053077 Bacteria 16586
312 Ga0495601_0003138 3300053077 Bacteria 9455
313 Ga0495601_0003577 3300053077 Bacteria 8940
314 Ga0495601_0102306 3300053077 Bacteria 1851
315 Ga0495601_0194189 3300053077 Unclassified 1327
316 Ga0495612_0000164 3300053078 Bacteria 27579
317 Ga0495612_0023805 3300053078 Bacteria 2458
318 Ga0495612_0042843 3300053078 Bacteria 1848
319 Ga0495612_0200501 3300053078 Bacteria 880
320 Ga0495655_0179404 3300053083 Bacteria 682
321 Ga0495595_0000003 3300053084 Bacteria 266465
322 Ga0495595_0001270 3300053084 Bacteria 9828
323 Ga0495595_0706484 3300053084 Bacteria 517
324 Ga0495619_0000025 3300053085 Bacteria 167905
325 Ga0495619_0000116 3300053085 Bacteria 58748
326 Ga0495619_0001204 3300053085 Bacteria 16989
327 Ga0495619_0011172 3300053085 Bacteria 5649
328 Ga0495619_0031549 3300053085 Bacteria 3434
329 Ga0495619_0384913 3300053085 Bacteria 969
330 Ga0495619_1120355 3300053085 Bacteria 523
331 Ga0500641_0007193 3300053096 Bacteria 3968
332 Ga0500614_000451 3300053123 Bacteria 10624

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005340 Ga0070689_100333145 Ga0070689_1003331452 96
2 3300005365 Ga0070688_100085494 Ga0070688_1000854941 96
3 3300005436 Ga0070713_100051856 Ga0070713_1000518564 96
4 3300005439 Ga0070711_100290994 Ga0070711_1002909942 96
5 3300005466 Ga0070685_10333149 Ga0070685_103331492 96
6 3300005615 Ga0070702_100057234 Ga0070702_1000572343 96
7 3300025916 Ga0207663_10022110 Ga0207663_100221103 96
8 3300025928 Ga0207700_10340486 Ga0207700_103404862 96
9 3300025929 Ga0207664_10726053 Ga0207664_107260532 96
10 3300025936 Ga0207670_10113637 Ga0207670_101136372 96
11 3300046511 Ga0495608_0000125 Ga0495608_0000125_50392_50682 96
12 3300046675 Ga0495657_0000004 Ga0495657_0000004_173813_174103 96
13 3300047444 Ga0495675_0000842 Ga0495675_0000842_12382_12672 96
14 3300048088 Ga0495602_0000041 Ga0495602_0000041_75977_76267 96
15 3300053084 Ga0495595_0000003 Ga0495595_0000003_173813_174103 96
16 3300053085 Ga0495619_0000116 Ga0495619_0000116_20580_20870 96
17 3300053096 Ga0500641_0007193 Ga0500641_0007193_113_403 96
18 3300002074 JGI24748J21848_1000328 JGI24748J21848_10003287 97
19 3300002239 JGI24034J26672_10001750 JGI24034J26672_100017503 97
20 3300002244 JGI24742J22300_10001636 JGI24742J22300_100016364 97
21 3300003203 JGI25406J46586_10050854 JGI25406J46586_100508541 97
22 3300004803 Ga0058862_12562150 Ga0058862_125621502 97
23 3300005333 Ga0070677_10000022 Ga0070677_1000002229 97
24 3300005336 Ga0070680_100033504 Ga0070680_1000335042 97
25 3300005337 Ga0070682_100000099 Ga0070682_10000009994 97
26 3300005341 Ga0070691_10002218 Ga0070691_1000221810 97
27 3300005341 Ga0070691_10572365 Ga0070691_105723652 97
28 3300005347 Ga0070668_101474945 Ga0070668_1014749452 97
29 3300005353 Ga0070669_100035869 Ga0070669_1000358693 97
30 3300005354 Ga0070675_102249177 Ga0070675_1022491771 97
31 3300005356 Ga0070674_100000683 Ga0070674_10000068312 97
32 3300005364 Ga0070673_100005169 Ga0070673_1000051692 97
33 3300005367 Ga0070667_100864549 Ga0070667_1008645492 97
34 3300005367 Ga0070667_101403671 Ga0070667_1014036711 97
35 3300005435 Ga0070714_100089298 Ga0070714_1000892982 97
36 3300005440 Ga0070705_100430607 Ga0070705_1004306072 97
37 3300005530 Ga0070679_100003306 Ga0070679_1000033066 97
38 3300005535 Ga0070684_100008707 Ga0070684_1000087072 97
39 3300005535 Ga0070684_100042946 Ga0070684_1000429462 97
40 3300005535 Ga0070684_100179931 Ga0070684_1001799312 97
41 3300005539 Ga0068853_100050462 Ga0068853_1000504622 97
42 3300005539 Ga0068853_100933698 Ga0068853_1009336981 97
43 3300005546 Ga0070696_101116846 Ga0070696_1011168462 97
44 3300005547 Ga0070693_101445642 Ga0070693_1014456421 97
45 3300005548 Ga0070665_100000106 Ga0070665_10000010622 97
46 3300005548 Ga0070665_100559987 Ga0070665_1005599872 97
47 3300005549 Ga0070704_100772399 Ga0070704_1007723992 97
48 3300005563 Ga0068855_100728549 Ga0068855_1007285492 97
49 3300005563 Ga0068855_100816850 Ga0068855_1008168502 97
50 3300005614 Ga0068856_100036865 Ga0068856_1000368655 97
51 3300005614 Ga0068856_100923310 Ga0068856_1009233102 97
52 3300005614 Ga0068856_101970295 Ga0068856_1019702951 97
53 3300005718 Ga0068866_10000001 Ga0068866_10000001415 97
54 3300005718 Ga0068866_10001215 Ga0068866_100012156 97
55 3300005719 Ga0068861_100191468 Ga0068861_1001914682 97
56 3300005719 Ga0068861_100280513 Ga0068861_1002805132 97
57 3300005719 Ga0068861_100427141 Ga0068861_1004271412 97
58 3300005840 Ga0068870_11433162 Ga0068870_114331621 97
59 3300005841 Ga0068863_100000342 Ga0068863_10000034249 97
60 3300005841 Ga0068863_100159772 Ga0068863_1001597722 97
61 3300005842 Ga0068858_100000009 Ga0068858_100000009177 97
62 3300005842 Ga0068858_100000065 Ga0068858_10000006535 97
63 3300005985 Ga0081539_10001097 Ga0081539_1000109710 97
64 3300006163 Ga0070715_10000001 Ga0070715_10000001382 97
65 3300006175 Ga0070712_100873071 Ga0070712_1008730712 97
66 3300006846 Ga0075430_100008674 Ga0075430_1000086748 97
67 3300006852 Ga0075433_10000900 Ga0075433_1000090022 97
68 3300006852 Ga0075433_10019456 Ga0075433_100194564 97
69 3300006881 Ga0068865_100931721 Ga0068865_1009317212 97
70 3300009098 Ga0105245_10014785 Ga0105245_100147855 97
71 3300009098 Ga0105245_12679043 Ga0105245_126790431 97
72 3300009101 Ga0105247_10000316 Ga0105247_1000031636 97
73 3300009148 Ga0105243_10069078 Ga0105243_100690782 97
74 3300009176 Ga0105242_10062200 Ga0105242_100622002 97
75 3300009176 Ga0105242_11070652 Ga0105242_110706522 97
76 3300009551 Ga0105238_10000011 Ga0105238_10000011211 97
77 3300009551 Ga0105238_10769707 Ga0105238_107697072 97
78 3300009553 Ga0105249_10000080 Ga0105249_1000008032 97
79 3300009553 Ga0105249_10140426 Ga0105249_101404262 97
80 3300009553 Ga0105249_11123207 Ga0105249_111232072 97
81 3300010375 Ga0105239_10124615 Ga0105239_101246152 97
82 3300011119 Ga0105246_11495513 Ga0105246_114955131 97
83 3300013104 Ga0157370_10019163 Ga0157370_100191636 97
84 3300013104 Ga0157370_11157241 Ga0157370_111572412 97
85 3300013104 Ga0157370_11381082 Ga0157370_113810821 97
86 3300013296 Ga0157374_10103698 Ga0157374_101036982 97
87 3300013296 Ga0157374_10211088 Ga0157374_102110882 97
88 3300013306 Ga0163162_10647451 Ga0163162_106474512 97
89 3300013308 Ga0157375_10003707 Ga0157375_100037072 97
90 3300013308 Ga0157375_10056465 Ga0157375_100564652 97
91 3300013308 Ga0157375_10173261 Ga0157375_101732614 97
92 3300013308 Ga0157375_10401382 Ga0157375_104013824 97
93 3300014325 Ga0163163_11205822 Ga0163163_112058222 97
94 3300014326 Ga0157380_10002003 Ga0157380_1000200313 97
95 3300014968 Ga0157379_10003159 Ga0157379_100031598 97
96 3300017792 Ga0163161_10002086 Ga0163161_100020864 97
97 3300017792 Ga0163161_10035900 Ga0163161_100359002 97
98 3300025893 Ga0207682_10000005 Ga0207682_1000000538 97
99 3300025899 Ga0207642_10000002 Ga0207642_10000002134 97
100 3300025899 Ga0207642_10003653 Ga0207642_100036532 97
101 3300025900 Ga0207710_10000458 Ga0207710_1000045817 97
102 3300025900 Ga0207710_10068743 Ga0207710_100687432 97
103 3300025900 Ga0207710_10165069 Ga0207710_101650692 97
104 3300025905 Ga0207685_10000027 Ga0207685_1000002775 97
105 3300025915 Ga0207693_10664357 Ga0207693_106643572 97
106 3300025917 Ga0207660_10134079 Ga0207660_101340792 97
107 3300025921 Ga0207652_10000044 Ga0207652_1000004482 97
108 3300025923 Ga0207681_10124737 Ga0207681_101247372 97
109 3300025924 Ga0207694_10000004 Ga0207694_10000004411 97
110 3300025924 Ga0207694_11264284 Ga0207694_112642842 97
111 3300025927 Ga0207687_10030006 Ga0207687_100300065 97
112 3300025929 Ga0207664_10018436 Ga0207664_100184365 97
113 3300025934 Ga0207686_10756220 Ga0207686_107562202 97
114 3300025934 Ga0207686_10883572 Ga0207686_108835721 97
115 3300025935 Ga0207709_10119115 Ga0207709_101191152 97
116 3300025937 Ga0207669_10000018 Ga0207669_1000001812 97
117 3300025937 Ga0207669_10000096 Ga0207669_1000009633 97
118 3300025938 Ga0207704_10668678 Ga0207704_106686782 97
119 3300025939 Ga0207665_10926948 Ga0207665_109269482 97
120 3300025942 Ga0207689_10646434 Ga0207689_106464342 97
121 3300025944 Ga0207661_10048479 Ga0207661_100484792 97
122 3300025944 Ga0207661_10168464 Ga0207661_101684642 97
123 3300025949 Ga0207667_11593527 Ga0207667_115935272 97
124 3300025960 Ga0207651_10010460 Ga0207651_100104605 97
125 3300025961 Ga0207712_10000007 Ga0207712_10000007425 97
126 3300025961 Ga0207712_11007625 Ga0207712_110076252 97
127 3300025972 Ga0207668_11321414 Ga0207668_113214142 97
128 3300025972 Ga0207668_11366971 Ga0207668_113669712 97
129 3300026035 Ga0207703_10000018 Ga0207703_1000001835 97
130 3300026035 Ga0207703_10000023 Ga0207703_1000002384 97
131 3300026041 Ga0207639_10161229 Ga0207639_101612292 97
132 3300026075 Ga0207708_11202019 Ga0207708_112020192 97
133 3300026078 Ga0207702_10004391 Ga0207702_1000439113 97
134 3300026078 Ga0207702_10976976 Ga0207702_109769762 97
135 3300026088 Ga0207641_10000238 Ga0207641_1000023883 97
136 3300026088 Ga0207641_10703158 Ga0207641_107031582 97
137 3300026118 Ga0207675_100228554 Ga0207675_1002285542 97
138 3300026118 Ga0207675_100313927 Ga0207675_1003139272 97
139 3300026118 Ga0207675_100325148 Ga0207675_1003251483 97
140 3300026121 Ga0207683_10391973 Ga0207683_103919732 97
141 3300028379 Ga0268266_10000047 Ga0268266_10000047174 97
142 3300028381 Ga0268264_10013989 Ga0268264_100139893 97
143 3300028563 Ga0265319_1000020 Ga0265319_1000020145 97
144 3300028800 Ga0265338_10001248 Ga0265338_100012488 97
145 3300029957 Ga0265324_10068409 Ga0265324_100684093 97
146 3300031241 Ga0265325_10001706 Ga0265325_1000170614 97
147 3300031250 Ga0265331_10026526 Ga0265331_100265263 97
148 3300031251 Ga0265327_10496809 Ga0265327_104968092 97
149 3300032133 Ga0316583_10256155 Ga0316583_102561551 97
150 3300035117 Ga0373953_0042219 Ga0373953_0042219_471_764 97
151 3300035119 Ga0373956_0218447 Ga0373956_0218447_58_351 97
152 3300035119 Ga0373956_0580469 Ga0373956_0580469_169_462 97
153 3300035120 Ga0373957_0023038 Ga0373957_0023038_233_526 97
154 3300035171 Ga0373946_0452038 Ga0373946_0452038_17_310 97
155 3300035172 Ga0373955_0297406 Ga0373955_0297406_74_367 97
156 3300035172 Ga0373955_0370973 Ga0373955_0370973_213_506 97
157 3300035692 Ga0373935_0623489 Ga0373935_0623489_457_750 97
158 3300036401 Ga0373937_0073027 Ga0373937_0073027_92_385 97
159 3300036401 Ga0373937_0102584 Ga0373937_0102584_2307_2600 97
160 3300041459 Ga0451800_1003097 Ga0451800_1003097_112_405 97
161 3300041501 Ga0451845_0396799 Ga0451845_0396799_779_1072 97
162 3300041505 Ga0451849_1458149 Ga0451849_1458149_212_505 97
163 3300041512 Ga0451853_0974378 Ga0451853_0974378_1936_2229 97
164 3300041512 Ga0451853_1580302 Ga0451853_1580302_601_894 97
165 3300041512 Ga0451853_3776184 Ga0451853_3776184_1726_2019 97
166 3300044901 Ga0466960_0176150 Ga0466960_0176150_574_870 97
167 3300045976 Ga0466967_1845549 Ga0466967_1845549_131_427 97
168 3300046454 Ga0495592_0001452 Ga0495592_0001452_12146_12439 97
169 3300046454 Ga0495592_0350930 Ga0495592_0350930_638_934 97
170 3300046454 Ga0495592_0824433 Ga0495592_0824433_57_350 97
171 3300046455 Ga0495603_0002944 Ga0495603_0002944_8972_9265 97
172 3300046455 Ga0495603_0004199 Ga0495603_0004199_3880_4173 97
173 3300046459 Ga0495629_0270599 Ga0495629_0270599_280_573 97
174 3300046461 Ga0495641_0000228 Ga0495641_0000228_7947_8240 97
175 3300046461 Ga0495641_0352629 Ga0495641_0352629_301_594 97
176 3300046462 Ga0495651_0051484 Ga0495651_0051484_1109_1402 97
177 3300046462 Ga0495651_0232517 Ga0495651_0232517_400_693 97
178 3300046463 Ga0495653_0045841 Ga0495653_0045841_640_933 97
179 3300046463 Ga0495653_0073825 Ga0495653_0073825_1312_1605 97
180 3300046473 Ga0495582_0000081 Ga0495582_0000081_42180_42473 97
181 3300046475 Ga0495639_0113936 Ga0495639_0113936_37_330 97
182 3300046476 Ga0495662_0000019 Ga0495662_0000019_51473_51766 97
183 3300046477 Ga0495664_0316124 Ga0495664_0316124_258_551 97
184 3300046477 Ga0495664_0610544 Ga0495664_0610544_129_422 97
185 3300046491 Ga0495584_0596863 Ga0495584_0596863_169_462 97
186 3300046499 Ga0495594_0000029 Ga0495594_0000029_41624_41917 97
187 3300046511 Ga0495608_0000529 Ga0495608_0000529_17308_17601 97
188 3300046511 Ga0495608_0066289 Ga0495608_0066289_451_744 97
189 3300046514 Ga0495618_0000008 Ga0495618_0000008_3677_3970 97
190 3300046514 Ga0495618_0251286 Ga0495618_0251286_672_965 97
191 3300046514 Ga0495618_0358367 Ga0495618_0358367_358_651 97
192 3300046515 Ga0495620_0000824 Ga0495620_0000824_8536_8829 97
193 3300046516 Ga0495628_0013407 Ga0495628_0013407_2065_2358 97
194 3300046516 Ga0495628_0023428 Ga0495628_0023428_3590_3883 97
195 3300046516 Ga0495628_0029017 Ga0495628_0029017_1525_1818 97
196 3300046516 Ga0495628_0064038 Ga0495628_0064038_403_696 97
197 3300046516 Ga0495628_0076615 Ga0495628_0076615_1971_2264 97
198 3300046516 Ga0495628_0318506 Ga0495628_0318506_517_810 97
199 3300046517 Ga0495630_0009955 Ga0495630_0009955_2485_2778 97
200 3300046517 Ga0495630_0020498 Ga0495630_0020498_528_824 97
201 3300046517 Ga0495630_0417732 Ga0495630_0417732_350_643 97
202 3300046517 Ga0495630_0520206 Ga0495630_0520206_319_612 97
203 3300046517 Ga0495630_1383227 Ga0495630_1383227_179_472 97
204 3300046529 Ga0495652_0000407 Ga0495652_0000407_31143_31436 97
205 3300046529 Ga0495652_0023500 Ga0495652_0023500_568_861 97
206 3300046533 Ga0495640_0075063 Ga0495640_0075063_255_548 97
207 3300046533 Ga0495640_0098804 Ga0495640_0098804_1070_1363 97
208 3300046535 Ga0495586_0000161 Ga0495586_0000161_330_623 97
209 3300046536 Ga0495587_0020731 Ga0495587_0020731_1727_2020 97
210 3300046536 Ga0495587_0072183 Ga0495587_0072183_358_651 97
211 3300046536 Ga0495587_0161031 Ga0495587_0161031_279_572 97
212 3300046536 Ga0495587_0530322 Ga0495587_0530322_142_435 97
213 3300046539 Ga0495621_0000576 Ga0495621_0000576_6339_6632 97
214 3300046539 Ga0495621_0138961 Ga0495621_0138961_523_816 97
215 3300046543 Ga0495645_0126231 Ga0495645_0126231_1182_1475 97
216 3300046557 Ga0495622_0000550 Ga0495622_0000550_11417_11710 97
217 3300046559 Ga0495667_0075296 Ga0495667_0075296_1480_1773 97
218 3300046615 Ga0495656_0046026 Ga0495656_0046026_59_352 97
219 3300046642 Ga0495634_0000059 Ga0495634_0000059_45122_45415 97
220 3300046642 Ga0495634_0283600 Ga0495634_0283600_345_638 97
221 3300046660 Ga0495625_0000756 Ga0495625_0000756_13330_13623 97
222 3300046663 Ga0495635_0000044 Ga0495635_0000044_77661_77954 97
223 3300046663 Ga0495635_0444971 Ga0495635_0444971_174_467 97
224 3300046674 Ga0495588_0096597 Ga0495588_0096597_477_770 97
225 3300046675 Ga0495657_0006919 Ga0495657_0006919_3930_4223 97
226 3300046675 Ga0495657_0067893 Ga0495657_0067893_672_968 97
227 3300046679 Ga0495623_0359130 Ga0495623_0359130_159_452 97
228 3300046681 Ga0495647_0000018 Ga0495647_0000018_75361_75654 97
229 3300046681 Ga0495647_0065668 Ga0495647_0065668_356_649 97
230 3300046683 Ga0495658_0000034 Ga0495658_0000034_44680_44973 97
231 3300046684 Ga0495669_0000033 Ga0495669_0000033_92952_93245 97
232 3300046684 Ga0495669_0174920 Ga0495669_0174920_65_358 97
233 3300046689 Ga0495613_0004320 Ga0495613_0004320_846_1139 97
234 3300046689 Ga0495613_0009782 Ga0495613_0009782_5122_5415 97
235 3300046689 Ga0495613_0214661 Ga0495613_0214661_752_1045 97
236 3300046690 Ga0495624_0000097 Ga0495624_0000097_57977_58270 97
237 3300046690 Ga0495624_0145724 Ga0495624_0145724_846_1139 97
238 3300046694 Ga0495649_0005110 Ga0495649_0005110_879_1172 97
239 3300046809 Ga0495600_0005795 Ga0495600_0005795_3600_3893 97
240 3300046809 Ga0495600_0007876 Ga0495600_0007876_602_895 97
241 3300046809 Ga0495600_0189785 Ga0495600_0189785_146_439 97
242 3300047315 Ga0495581_0369804 Ga0495581_0369804_241_534 97
243 3300047317 Ga0495604_0000055 Ga0495604_0000055_55435_55728 97
244 3300047317 Ga0495604_0000137 Ga0495604_0000137_51602_51895 97
245 3300047317 Ga0495604_0095577 Ga0495604_0095577_1732_2025 97
246 3300047317 Ga0495604_0108473 Ga0495604_0108473_1015_1308 97
247 3300047319 Ga0495674_0000064 Ga0495674_0000064_36899_37192 97
248 3300047319 Ga0495674_0090784 Ga0495674_0090784_593_886 97
249 3300047320 Ga0495672_0060363 Ga0495672_0060363_385_678 97
250 3300047321 Ga0495676_0000130 Ga0495676_0000130_28559_28852 97
251 3300047321 Ga0495676_0002521 Ga0495676_0002521_11779_12072 97
252 3300047321 Ga0495676_0319030 Ga0495676_0319030_272_565 97
253 3300047322 Ga0495680_0000550 Ga0495680_0000550_37342_37635 97
254 3300047322 Ga0495680_0003958 Ga0495680_0003958_10348_10641 97
255 3300047322 Ga0495680_0419149 Ga0495680_0419149_307_603 97
256 3300047322 Ga0495680_0614174 Ga0495680_0614174_109_402 97
257 3300047444 Ga0495675_0038105 Ga0495675_0038105_345_638 97
258 3300047446 Ga0495679_033543 Ga0495679_033543_1010_1303 97
259 3300047469 Ga0495673_0159348 Ga0495673_0159348_519_812 97
260 3300047471 Ga0495684_0119228 Ga0495684_0119228_970_1266 97
261 3300047471 Ga0495684_0181492 Ga0495684_0181492_644_937 97
262 3300047472 Ga0495686_0046322 Ga0495686_0046322_2015_2308 97
263 3300047673 Ga0495593_0082300 Ga0495593_0082300_494_787 97
264 3300047673 Ga0495593_0259332 Ga0495593_0259332_334_627 97
265 3300048088 Ga0495602_0040615 Ga0495602_0040615_3511_3861 97
266 3300048089 Ga0495614_0357863 Ga0495614_0357863_110_403 97
267 3300048903 Ga0496100_0000005 Ga0496100_0000005_278172_278465 97
268 3300048904 Ga0496101_0000101 Ga0496101_0000101_52589_52882 97
269 3300048904 Ga0496101_1149025 Ga0496101_1149025_208_501 97
270 3300048905 Ga0496102_1021099 Ga0496102_1021099_148_441 97
271 3300048907 Ga0496104_0006952 Ga0496104_0006952_8578_8871 97
272 3300048908 Ga0496105_0000650 Ga0496105_0000650_8020_8313 97
273 3300048908 Ga0496105_0308255 Ga0496105_0308255_253_546 97
274 3300048909 Ga0496106_0000151 Ga0496106_0000151_4742_5035 97
275 3300048909 Ga0496106_0000682 Ga0496106_0000682_16365_16658 97
276 3300048909 Ga0496106_0545561 Ga0496106_0545561_186_479 97
277 3300048910 Ga0496107_0000011 Ga0496107_0000011_33418_33711 97
278 3300048911 Ga0496108_0000001 Ga0496108_0000001_726786_727079 97
279 3300048911 Ga0496108_0000281 Ga0496108_0000281_38558_38851 97
280 3300048911 Ga0496108_1022358 Ga0496108_1022358_131_427 97
281 3300048912 Ga0496109_0000003 Ga0496109_0000003_401332_401625 97
282 3300048912 Ga0496109_0001118 Ga0496109_0001118_18815_19108 97
283 3300048913 Ga0496110_0004679 Ga0496110_0004679_2396_2692 97
284 3300048913 Ga0496110_0011255 Ga0496110_0011255_2175_2468 97
285 3300048913 Ga0496110_0059030 Ga0496110_0059030_2501_2794 97
286 3300048913 Ga0496110_0649554 Ga0496110_0649554_409_702 97
287 3300048914 Ga0496111_0185752 Ga0496111_0185752_292_588 97
288 3300048914 Ga0496111_0384726 Ga0496111_0384726_110_403 97
289 3300048915 Ga0496112_0000006 Ga0496112_0000006_283946_284239 97
290 3300048915 Ga0496112_0007591 Ga0496112_0007591_5519_5812 97
291 3300048915 Ga0496112_0421312 Ga0496112_0421312_666_959 97
292 3300048916 Ga0496113_0003552 Ga0496113_0003552_5166_5459 97
293 3300048916 Ga0496113_0007799 Ga0496113_0007799_5501_5794 97
294 3300048916 Ga0496113_0243558 Ga0496113_0243558_921_1214 97
295 3300048916 Ga0496113_0457707 Ga0496113_0457707_595_888 97
296 3300048916 Ga0496113_0673853 Ga0496113_0673853_230_523 97
297 3300048917 Ga0496114_0000101 Ga0496114_0000101_19364_19657 97
298 3300048918 Ga0496115_0000003 Ga0496115_0000003_118089_118382 97
299 3300048918 Ga0496115_0000200 Ga0496115_0000200_36099_36392 97
300 3300049571 Ga0501034_0365781 Ga0501034_0365781_848_1162 97
301 3300049575 Ga0501039_0162965 Ga0501039_0162965_173_466 97
302 3300049576 Ga0501040_0261083 Ga0501040_0261083_725_1021 97
303 3300049578 Ga0501042_0441792 Ga0501042_0441792_241_534 97
304 3300049581 Ga0501047_0115425 Ga0501047_0115425_1360_1674 97
305 3300049584 Ga0501068_0682535 Ga0501068_0682535_306_599 97
306 3300049586 Ga0501070_0443368 Ga0501070_0443368_477_770 97
307 3300049588 Ga0501072_0115179 Ga0501072_0115179_1376_1693 97
308 3300049591 Ga0501075_0546991 Ga0501075_0546991_418_711 97
309 3300049592 Ga0501076_1192194 Ga0501076_1192194_193_486 97
310 3300049741 Ga0501079_0337354 Ga0501079_0337354_273_590 97
311 3300050509 nmdc:mga0qj67_18640_c2 nmdc:mga0qj67_18640_c2_1768_2061 97
312 3300050515 nmdc:mga0a205_1483_c2 nmdc:mga0a205_1483_c2_5020_5313 97
313 3300050515 nmdc:mga0a205_6_c1 nmdc:mga0a205_6_c1_120812_121105 97
314 3300053077 Ga0495601_0000855 Ga0495601_0000855_9052_9345 97
315 3300053077 Ga0495601_0003138 Ga0495601_0003138_5068_5361 97
316 3300053077 Ga0495601_0003577 Ga0495601_0003577_8299_8595 97
317 3300053077 Ga0495601_0102306 Ga0495601_0102306_231_524 97
318 3300053077 Ga0495601_0194189 Ga0495601_0194189_164_457 97
319 3300053078 Ga0495612_0000164 Ga0495612_0000164_15261_15554 97
320 3300053078 Ga0495612_0023805 Ga0495612_0023805_752_1045 97
321 3300053078 Ga0495612_0042843 Ga0495612_0042843_269_562 97
322 3300053078 Ga0495612_0200501 Ga0495612_0200501_534_827 97
323 3300053083 Ga0495655_0179404 Ga0495655_0179404_200_493 97
324 3300053084 Ga0495595_0001270 Ga0495595_0001270_5986_6279 97
325 3300053084 Ga0495595_0706484 Ga0495595_0706484_17_310 97
326 3300053085 Ga0495619_0000025 Ga0495619_0000025_120936_121229 97
327 3300053085 Ga0495619_0001204 Ga0495619_0001204_5940_6233 97
328 3300053085 Ga0495619_0011172 Ga0495619_0011172_1291_1584 97
329 3300053085 Ga0495619_0031549 Ga0495619_0031549_1955_2248 97
330 3300053085 Ga0495619_0384913 Ga0495619_0384913_449_745 97
331 3300053085 Ga0495619_1120355 Ga0495619_1120355_66_359 97
332 3300053123 Ga0500614_000451 Ga0500614_000451_1948_2241 97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2omo-assembly2.cif.gz_C putative antibiotic biosynthesis monooxygenase from nitrosomonas europaea 0.9222 2 96
4zos-assembly1.cif.gz_C 2.20 angstrom resolution crystal structure of protein ye0340 of unidentified function from yersinia enterocolitica subsp. enterocolitica 8081] 0.9147 2 95
4zos-assembly2.cif.gz_B 2.20 angstrom resolution crystal structure of protein ye0340 of unidentified function from yersinia enterocolitica subsp. enterocolitica 8081] 0.9132 2 95
4dpo-assembly1.cif.gz_B crystal structure of a conserved protein mm_1583 from methanosarcina mazei go1 0.9114 1 91
2omo-assembly4.cif.gz_E putative antibiotic biosynthesis monooxygenase from nitrosomonas europaea 0.9106 3 94
ID Description Score Start End Superfamily
4zosB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9132 2 95 3.30.70.100
3qmqB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9023 1 94 3.30.70.100
4dpoB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8887 2 94 3.30.70.100
af_Q8BG18_205_343_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8836 2 91 3.30.70.100
af_O33291_1_95_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8807 1 97 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A838V4U8-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.9749 1 97
AF-A0A7V9S2F7-F1-model_v4 ABM domain-containing protein 0.9491 3 97
AF-A0A7W0RCL5-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.94 3 97
AF-A0A0Q6S9B2-F1-model_v4 ABM domain-containing protein 0.9344 2 95 GO:0003824
AF-A0A6J7CXM4-F1-model_v4 Unannotated protein 0.9326 1 97

Feature Viewer

pLDDT pTM Quality
92.37 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map