F409992

General Info

Members Datasets Scaffolds Average Seq Length
330 166 329 192

Family's Representative Sequence

Representative Sequence 3300005456|Ga0070678_100569977|Ga0070678_1005699772
Length 215
Sequence MASSLPSTDGYLYSTNSIEQQTKSMNDSIVLNIPVEYRKIKEASDELQFNMASDLYTGSLLKTLAASKPSARLLELGTGTGLATAWIVAGMDANSSLVTVENNELLIEVARKNINDSRVEFVLTDGYEWLKNYDGEKFDFIFADAMPGKYDLFEETINLLNSGGLYIIDDMLPQPNWPEGHDKKAEAFIQQLEERNDLLVTKLNWSTGIMIVVKK

Samples

Sample ID Description Type Environment
1 2914759650 Rhizosphaericola mali Isolate Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
139 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
140 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
141 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
145 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
146 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
147 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
148 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
149 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
150 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
151 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
152 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
153 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
154 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
155 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
156 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
157 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
158 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
163 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
164 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
165 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
166 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.12
Nodule 0
Rhizoplane 2.12
Rhizosphere 94.85
Stem 0
Stem Tuber 0
Unclassified 0.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10109676 3300003323 Bacteria 2914
2 JGI25160J50197_1000687 3300003354 Bacteria 18745
3 Ga0065704_10120273 3300005289 Bacteria 1785
4 Ga0065712_10017963 3300005290 Bacteria 1590
5 Ga0065712_10074461 3300005290 Bacteria 4088
6 Ga0065712_10186141 3300005290 Bacteria 1169
7 Ga0070676_10004504 3300005328 Bacteria 7335
8 Ga0070676_10017396 3300005328 Bacteria 3980
9 Ga0070676_10239943 3300005328 Bacteria 1205
10 Ga0070683_100045602 3300005329 Bacteria 4046
11 Ga0070683_100165536 3300005329 Bacteria 2098
12 Ga0070683_100246250 3300005329 Unclassified 1700
13 Ga0070683_100405713 3300005329 Bacteria 1300
14 Ga0070670_100060575 3300005331 Bacteria 3250
15 Ga0070670_100086010 3300005331 Bacteria 2702
16 Ga0070670_100602750 3300005331 Bacteria 983
17 Ga0070670_101219393 3300005331 Bacteria 688
18 Ga0070677_10018575 3300005333 Bacteria 2505
19 Ga0070677_10355546 3300005333 Unclassified 760
20 Ga0068869_100003787 3300005334 Bacteria 9318
21 Ga0068869_100012493 3300005334 Bacteria 5615
22 Ga0068869_100012922 3300005334 Bacteria 5532
23 Ga0068869_100286270 3300005334 Bacteria 1326
24 Ga0068869_100326127 3300005334 Bacteria 1246
25 Ga0070666_10032000 3300005335 Bacteria 3474
26 Ga0070680_100000323 3300005336 Bacteria 32103
27 Ga0070682_100029587 3300005337 Bacteria 3299
28 Ga0070682_100062210 3300005337 Bacteria 2364
29 Ga0070682_100274504 3300005337 Bacteria 1226
30 Ga0068868_100013211 3300005338 Bacteria 6048
31 Ga0070660_100524141 3300005339 Bacteria 987
32 Ga0070660_100782730 3300005339 Bacteria 802
33 Ga0070689_100125284 3300005340 Bacteria 2055
34 Ga0070689_100262998 3300005340 Bacteria 1426
35 Ga0070691_10011305 3300005341 Bacteria 4074
36 Ga0070687_100169784 3300005343 Bacteria 1297
37 Ga0070661_100002466 3300005344 Bacteria 12693
38 Ga0070668_100054811 3300005347 Bacteria 3076
39 Ga0070668_100100454 3300005347 Bacteria 2292
40 Ga0070668_100115290 3300005347 Bacteria 2142
41 Ga0070669_100060358 3300005353 Bacteria 2786
42 Ga0070669_100068759 3300005353 Bacteria 2615
43 Ga0070669_100074535 3300005353 Bacteria 2516
44 Ga0070669_100260752 3300005353 Bacteria 1383
45 Ga0070675_100018422 3300005354 Bacteria 5557
46 Ga0070675_100524456 3300005354 Unclassified 1069
47 Ga0070671_100117500 3300005355 Bacteria 2236
48 Ga0070671_100319781 3300005355 Bacteria 1322
49 Ga0070674_100026680 3300005356 Bacteria 3777
50 Ga0070674_100165941 3300005356 Bacteria 1679
51 Ga0070674_100629364 3300005356 Unclassified 910
52 Ga0070673_100012946 3300005364 Bacteria 5749
53 Ga0070688_100002056 3300005365 Bacteria 10157
54 Ga0070688_100165654 3300005365 Bacteria 1521
55 Ga0070688_100229116 3300005365 Unclassified 1313
56 Ga0070659_100470697 3300005366 Bacteria 1068
57 Ga0070667_100062831 3300005367 Bacteria 3146
58 Ga0070701_10343205 3300005438 Bacteria 931
59 Ga0070678_100008016 3300005456 Bacteria 6297
60 Ga0070678_100045879 3300005456 Bacteria 3129
61 Ga0070678_100569977 3300005456 Bacteria 1007
62 Ga0070662_100089190 3300005457 Bacteria 2313
63 Ga0070662_100117127 3300005457 Bacteria 2037
64 Ga0070681_10039612 3300005458 Bacteria 4723
65 Ga0070681_10500513 3300005458 Bacteria 1128
66 Ga0068867_100046131 3300005459 Bacteria 3199
67 Ga0068867_100061228 3300005459 Bacteria 2794
68 Ga0068867_100133063 3300005459 Bacteria 1935
69 Ga0068867_100139712 3300005459 Bacteria 1892
70 Ga0070685_10113381 3300005466 Bacteria 1673
71 Ga0070685_10153468 3300005466 Unclassified 1461
72 Ga0070685_10521597 3300005466 Bacteria 844
73 Ga0070698_100004441 3300005471 Bacteria 15416
74 Ga0070698_100112852 3300005471 Bacteria 2683
75 Ga0070679_100000397 3300005530 Bacteria 37025
76 Ga0070684_100000172 3300005535 Bacteria 44308
77 Ga0068853_100004535 3300005539 Bacteria 10775
78 Ga0068853_100134164 3300005539 Bacteria 2218
79 Ga0070672_100027741 3300005543 Bacteria 4227
80 Ga0070672_100206892 3300005543 Bacteria 1642
81 Ga0070693_100003549 3300005547 Bacteria 7274
82 Ga0070665_100095708 3300005548 Bacteria 2974
83 Ga0068855_100110513 3300005563 Bacteria 3156
84 Ga0070664_100001323 3300005564 Bacteria 19756
85 Ga0070664_100207223 3300005564 Bacteria 1751
86 Ga0070664_100502591 3300005564 Bacteria 1117
87 Ga0068857_100005435 3300005577 Bacteria 10861
88 Ga0068857_100070466 3300005577 Bacteria 3115
89 Ga0068854_100227095 3300005578 Bacteria 1480
90 Ga0068856_100842969 3300005614 Bacteria 936
91 Ga0068852_100122497 3300005616 Bacteria 2384
92 Ga0068859_100049322 3300005617 Bacteria 4228
93 Ga0068859_100727155 3300005617 Bacteria 1082
94 Ga0068864_100122280 3300005618 Bacteria 2329
95 Ga0068864_100534034 3300005618 Bacteria 1132
96 Ga0068861_100022281 3300005719 Bacteria 4562
97 Ga0068861_100124956 3300005719 Bacteria 2080
98 Ga0068861_100187586 3300005719 Bacteria 1726
99 Ga0068861_100670602 3300005719 Unclassified 960
100 Ga0068870_10049149 3300005840 Bacteria 2224
101 Ga0068870_10238938 3300005840 Bacteria 1120
102 Ga0068863_100000546 3300005841 Bacteria 38297
103 Ga0068863_100056437 3300005841 Bacteria 3718
104 Ga0068863_100485471 3300005841 Bacteria 1215
105 Ga0068863_100699213 3300005841 Bacteria 1007
106 Ga0068858_100025646 3300005842 Bacteria 5485
107 Ga0068860_100086591 3300005843 Bacteria 2982
108 Ga0068860_100111574 3300005843 Bacteria 2615
109 Ga0068860_100766475 3300005843 Bacteria 977
110 Ga0068862_100033664 3300005844 Bacteria 4333
111 Ga0075363_100478663 3300006048 Bacteria 738
112 Ga0070715_10179242 3300006163 Bacteria 1061
113 Ga0075366_10005157 3300006195 Bacteria 7068
114 Ga0097621_100008505 3300006237 Bacteria 7390
115 Ga0097621_100039988 3300006237 Bacteria 3768
116 Ga0097621_100123678 3300006237 Bacteria 2196
117 Ga0068871_100020832 3300006358 Bacteria 5029
118 Ga0068871_100029893 3300006358 Bacteria 4285
119 Ga0068871_100308656 3300006358 Bacteria 1390
120 Ga0068871_100854193 3300006358 Bacteria 841
121 Ga0068871_100954269 3300006358 Bacteria 797
122 Ga0068865_100034732 3300006881 Bacteria 3385
123 Ga0097620_100049324 3300006931 Bacteria 4228
124 Ga0097620_100114196 3300006931 Bacteria 2764
125 Ga0097620_100727111 3300006931 Bacteria 1082
126 Ga0105240_10062426 3300009093 Bacteria 4639
127 Ga0105240_10455714 3300009093 Bacteria 1430
128 Ga0111539_10544737 3300009094 Unclassified 1352
129 Ga0105245_10607862 3300009098 Unclassified 1120
130 Ga0105247_10552824 3300009101 Bacteria 847
131 Ga0105241_10000105 3300009174 Bacteria 60020
132 Ga0105242_10016361 3300009176 Bacteria 5765
133 Ga0105242_10081599 3300009176 Bacteria 2705
134 Ga0105242_10257767 3300009176 Bacteria 1574
135 Ga0105242_11461574 3300009176 Unclassified 713
136 Ga0105248_10726979 3300009177 Bacteria 1120
137 Ga0105237_10157519 3300009545 Unclassified 2268
138 Ga0105237_10361633 3300009545 Bacteria 1456
139 Ga0105249_10026641 3300009553 Bacteria 5212
140 Ga0105249_10029238 3300009553 Bacteria 4976
141 Ga0105249_10074873 3300009553 Bacteria 3135
142 Ga0105239_10748575 3300010375 Bacteria 1118
143 Ga0105239_11009236 3300010375 Bacteria 957
144 Ga0105246_10006351 3300011119 Bacteria 7213
145 Ga0105246_10229885 3300011119 Bacteria 1460
146 Ga0105246_10307529 3300011119 Bacteria 1282
147 Ga0157370_10004025 3300013104 Bacteria 17075
148 Ga0157370_10449453 3300013104 Unclassified 1185
149 Ga0157370_10901675 3300013104 Unclassified 802
150 Ga0157369_10510665 3300013105 Unclassified 1243
151 Ga0157374_10171545 3300013296 Bacteria 2116
152 Ga0157374_10396045 3300013296 Unclassified 1377
153 Ga0157374_10547458 3300013296 Unclassified 1165
154 Ga0157378_10106955 3300013297 Bacteria 2559
155 Ga0157378_10197563 3300013297 Bacteria 1901
156 Ga0157378_10325675 3300013297 Bacteria 1494
157 Ga0157378_10402536 3300013297 Bacteria 1349
158 Ga0163162_10019461 3300013306 Bacteria 6659
159 Ga0163162_10037865 3300013306 Bacteria 4813
160 Ga0163162_10308043 3300013306 Bacteria 1716
161 Ga0163162_10729292 3300013306 Bacteria 1111
162 Ga0163162_10832629 3300013306 Bacteria 1039
163 Ga0163162_11877933 3300013306 Unclassified 685
164 Ga0157372_10669599 3300013307 Bacteria 1208
165 Ga0157375_10450254 3300013308 Bacteria 1453
166 Ga0157375_10610821 3300013308 Bacteria 1249
167 Ga0157375_10624039 3300013308 Bacteria 1236
168 Ga0157375_11548514 3300013308 Bacteria 783
169 Ga0157375_12542121 3300013308 Unclassified 612
170 Ga0163163_10120893 3300014325 Bacteria 2653
171 Ga0157380_10002354 3300014326 Bacteria 12706
172 Ga0157380_10206801 3300014326 Bacteria 1746
173 Ga0157380_11413498 3300014326 Bacteria 746
174 Ga0157377_10015331 3300014745 Bacteria 3918
175 Ga0157377_10167553 3300014745 Bacteria 1371
176 Ga0157377_10253144 3300014745 Bacteria 1142
177 Ga0157377_10257936 3300014745 Bacteria 1133
178 Ga0157377_10339580 3300014745 Unclassified 1004
179 Ga0157379_10155209 3300014968 Bacteria 2065
180 Ga0157379_10170256 3300014968 Bacteria 1966
181 Ga0157379_10271693 3300014968 Unclassified 1542
182 Ga0157379_10483799 3300014968 Bacteria 1146
183 Ga0157379_11104308 3300014968 Bacteria 760
184 Ga0157376_10048470 3300014969 Bacteria 3513
185 Ga0157376_10180907 3300014969 Bacteria 1927
186 Ga0157376_11088832 3300014969 Unclassified 824
187 Ga0157376_11670978 3300014969 Unclassified 672
188 Ga0163161_10004913 3300017792 Bacteria 9305
189 Ga0163161_10216044 3300017792 Bacteria 1483
190 Ga0163161_10772623 3300017792 Unclassified 805
191 Ga0163161_10829436 3300017792 Bacteria 779
192 Ga0163161_11234033 3300017792 Bacteria 648
193 Ga0207426_1000132 3300025302 Bacteria 209623
194 Ga0207697_10086423 3300025315 Bacteria 1326
195 Ga0207682_10024896 3300025893 Bacteria 2373
196 Ga0207642_10023271 3300025899 Bacteria 2472
197 Ga0207642_10274534 3300025899 Bacteria 967
198 Ga0207688_10048470 3300025901 Bacteria 2374
199 Ga0207688_10128500 3300025901 Bacteria 1484
200 Ga0207680_10097760 3300025903 Bacteria 1880
201 Ga0207685_10158674 3300025905 Bacteria 1031
202 Ga0207645_10000306 3300025907 Bacteria 41222
203 Ga0207645_10061821 3300025907 Bacteria 2392
204 Ga0207643_10032598 3300025908 Bacteria 2911
205 Ga0207643_10054407 3300025908 Bacteria 2275
206 Ga0207654_10001230 3300025911 Bacteria 13682
207 Ga0207707_10000205 3300025912 Bacteria 62610
208 Ga0207707_10418049 3300025912 Bacteria 1150
209 Ga0207695_10003840 3300025913 Bacteria 20797
210 Ga0207671_10140243 3300025914 Bacteria 1862
211 Ga0207671_10265194 3300025914 Bacteria 1352
212 Ga0207660_10000843 3300025917 Bacteria 20195
213 Ga0207657_10253238 3300025919 Bacteria 1403
214 Ga0207652_10000186 3300025921 Bacteria 65493
215 Ga0207681_10056045 3300025923 Bacteria 2687
216 Ga0207681_10119866 3300025923 Bacteria 1928
217 Ga0207650_10034456 3300025925 Bacteria 3672
218 Ga0207650_10208991 3300025925 Bacteria 1567
219 Ga0207650_10345870 3300025925 Bacteria 1222
220 Ga0207659_10047170 3300025926 Bacteria 3046
221 Ga0207659_10239955 3300025926 Bacteria 1466
222 Ga0207659_10485486 3300025926 Bacteria 1044
223 Ga0207644_10374533 3300025931 Bacteria 1160
224 Ga0207644_10689079 3300025931 Unclassified 852
225 Ga0207690_10303552 3300025932 Bacteria 1250
226 Ga0207706_10002722 3300025933 Bacteria 17218
227 Ga0207706_10014390 3300025933 Bacteria 7170
228 Ga0207706_10027852 3300025933 Bacteria 5051
229 Ga0207706_10110832 3300025933 Bacteria 2414
230 Ga0207686_10057610 3300025934 Bacteria 2446
231 Ga0207686_10448070 3300025934 Bacteria 992
232 Ga0207670_10079915 3300025936 Bacteria 2284
233 Ga0207670_10110098 3300025936 Bacteria 1983
234 Ga0207669_10175544 3300025937 Bacteria 1530
235 Ga0207669_10329062 3300025937 Bacteria 1172
236 Ga0207704_10442459 3300025938 Unclassified 1035
237 Ga0207691_10041579 3300025940 Bacteria 4242
238 Ga0207691_10190344 3300025940 Bacteria 1789
239 Ga0207689_10002574 3300025942 Bacteria 16801
240 Ga0207689_10003632 3300025942 Bacteria 14091
241 Ga0207689_10008304 3300025942 Bacteria 9046
242 Ga0207689_10021494 3300025942 Bacteria 5425
243 Ga0207689_10044800 3300025942 Bacteria 3659
244 Ga0207661_10026855 3300025944 Bacteria 4392
245 Ga0207661_10179763 3300025944 Bacteria 1847
246 Ga0207679_10006471 3300025945 Bacteria 7408
247 Ga0207679_10171488 3300025945 Bacteria 1787
248 Ga0207667_10049053 3300025949 Bacteria 4461
249 Ga0207651_10327606 3300025960 Bacteria 1282
250 Ga0207651_10718753 3300025960 Bacteria 881
251 Ga0207712_10018504 3300025961 Bacteria 4539
252 Ga0207712_10057893 3300025961 Bacteria 2736
253 Ga0207668_10036181 3300025972 Bacteria 3294
254 Ga0207668_10086658 3300025972 Bacteria 2288
255 Ga0207668_10231409 3300025972 Bacteria 1490
256 Ga0207668_10775839 3300025972 Unclassified 847
257 Ga0207640_10002163 3300025981 Bacteria 10567
258 Ga0207640_10222727 3300025981 Bacteria 1445
259 Ga0207640_10552718 3300025981 Unclassified 967
260 Ga0207658_10345550 3300025986 Unclassified 1294
261 Ga0207658_10526060 3300025986 Unclassified 1056
262 Ga0207658_10532796 3300025986 Bacteria 1049
263 Ga0207677_10096569 3300026023 Bacteria 2162
264 Ga0207677_10149227 3300026023 Bacteria 1801
265 Ga0207703_10290684 3300026035 Bacteria 1487
266 Ga0207703_10473098 3300026035 Bacteria 1173
267 Ga0207639_10080173 3300026041 Bacteria 2582
268 Ga0207678_10788110 3300026067 Bacteria 839
269 Ga0207702_11020455 3300026078 Unclassified 821
270 Ga0207641_10000539 3300026088 Bacteria 42499
271 Ga0207641_10102891 3300026088 Bacteria 2519
272 Ga0207641_10782005 3300026088 Unclassified 943
273 Ga0207648_10003171 3300026089 Bacteria 17337
274 Ga0207648_10015000 3300026089 Bacteria 7137
275 Ga0207648_10059941 3300026089 Bacteria 3319
276 Ga0207648_10585624 3300026089 Bacteria 1027
277 Ga0207676_10057057 3300026095 Bacteria 3074
278 Ga0207676_10483421 3300026095 Bacteria 1173
279 Ga0207674_10019660 3300026116 Bacteria 7313
280 Ga0207674_10026118 3300026116 Bacteria 6213
281 Ga0207675_100004088 3300026118 Bacteria 14122
282 Ga0207675_100013718 3300026118 Bacteria 7561
283 Ga0207675_100036756 3300026118 Bacteria 4567
284 Ga0207675_100040221 3300026118 Bacteria 4365
285 Ga0207675_100207854 3300026118 Bacteria 1882
286 Ga0207675_100294968 3300026118 Bacteria 1578
287 Ga0207675_100752692 3300026118 Bacteria 986
288 Ga0207683_10004166 3300026121 Bacteria 12518
289 Ga0207683_10004426 3300026121 Bacteria 12145
290 Ga0207683_10086946 3300026121 Bacteria 2780
291 Ga0207428_10018183 3300027907 Bacteria 6010
292 Ga0268266_10777340 3300028379 Bacteria 924
293 Ga0268265_10036100 3300028380 Bacteria 3618
294 Ga0268265_10177784 3300028380 Bacteria 1826
295 Ga0268265_11226612 3300028380 Unclassified 748
296 Ga0268264_10289996 3300028381 Bacteria 1536
297 Ga0265327_10000152 3300031251 Bacteria 149065
298 Ga0265313_10157570 3300031595 Bacteria 966
299 Ga0373955_0642077 3300035172 Bacteria 651
300 Ga0373935_0303968 3300035692 Bacteria 1128
301 Ga0373937_0270008 3300036401 Bacteria 1605
302 Ga0373925_0362898 3300037068 Unclassified 1178
303 Ga0436364_0678490 3300037853 Bacteria 1679
304 Ga0436364_0881793 3300037853 Unclassified 1441
305 Ga0451807_0954051 3300041486 Bacteria 895
306 Ga0495662_0173744 3300046476 Unclassified 1062
307 Ga0495628_0037066 3300046516 Bacteria 3910
308 Ga0495630_0015761 3300046517 Bacteria 5523
309 Ga0495598_0132084 3300046537 Bacteria 857
310 Ga0495598_0152006 3300046537 Unclassified 809
311 Ga0495621_0027600 3300046539 Bacteria 1924
312 Ga0495645_0163183 3300046543 Unclassified 1539
313 Ga0495634_0014817 3300046642 Bacteria 5607
314 Ga0495657_0144600 3300046675 Bacteria 1480
315 Ga0495599_0421784 3300046678 Unclassified 793
316 Ga0495613_0059149 3300046689 Bacteria 2810
317 Ga0495600_0062246 3300046809 Bacteria 2438
318 Ga0495680_0152898 3300047322 Bacteria 1681
319 Ga0495675_0333282 3300047444 Bacteria 896
320 Ga0496101_0170530 3300048904 Bacteria 1673
321 Ga0496104_0507678 3300048907 Bacteria 1117
322 Ga0496110_0349613 3300048913 Bacteria 1347
323 Ga0496114_0176994 3300048917 Bacteria 1862
324 Ga0496114_0346486 3300048917 Bacteria 1314
325 Ga0496114_0433814 3300048917 Bacteria 1164
326 nmdc:mga03n38_92587_c1 3300050490 Bacteria 1442
327 nmdc:mga0k408_89479_c1 3300050493 Bacteria 1808
328 nmdc:mga07m45_421363_c1 3300050496 Bacteria 774
329 nmdc:mga08y16_850698_c1 3300050511 Unclassified 901

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050496 nmdc:mga07m45_421363_c1 nmdc:mga07m45_421363_c1_203_676 156
2 3300005329 Ga0070683_100246250 Ga0070683_1002462502 167
3 3300013308 Ga0157375_10624039 Ga0157375_106240392 171
4 3300025925 Ga0207650_10208991 Ga0207650_102089913 171
5 3300005329 Ga0070683_100405713 Ga0070683_1004057132 172
6 3300005334 Ga0068869_100326127 Ga0068869_1003261272 172
7 3300005466 Ga0070685_10521597 Ga0070685_105215971 172
8 3300005564 Ga0070664_100207223 Ga0070664_1002072232 172
9 3300005618 Ga0068864_100534034 Ga0068864_1005340341 172
10 3300025944 Ga0207661_10179763 Ga0207661_101797632 172
11 3300025945 Ga0207679_10171488 Ga0207679_101714882 172
12 3300026095 Ga0207676_10483421 Ga0207676_104834211 172
13 3300009098 Ga0105245_10607862 Ga0105245_106078621 178
14 3300017792 Ga0163161_11234033 Ga0163161_112340331 179
15 3300005471 Ga0070698_100112852 Ga0070698_1001128523 181
16 iso_pu_bacteria 2914759650 2914761971 181
17 3300046476 Ga0495662_0173744 Ga0495662_0173744_23_571 182
18 3300014969 Ga0157376_10048470 Ga0157376_100484703 187
19 3300006048 Ga0075363_100478663 Ga0075363_1004786632 188
20 3300050490 nmdc:mga03n38_92587_c1 nmdc:mga03n38_92587_c1_679_1275 188
21 3300005328 Ga0070676_10017396 Ga0070676_100173964 190
22 3300005331 Ga0070670_100086010 Ga0070670_1000860102 190
23 3300005331 Ga0070670_100602750 Ga0070670_1006027501 190
24 3300005333 Ga0070677_10018575 Ga0070677_100185752 190
25 3300005333 Ga0070677_10355546 Ga0070677_103555461 190
26 3300005334 Ga0068869_100286270 Ga0068869_1002862702 190
27 3300005347 Ga0070668_100054811 Ga0070668_1000548112 190
28 3300005353 Ga0070669_100060358 Ga0070669_1000603584 190
29 3300005353 Ga0070669_100074535 Ga0070669_1000745354 190
30 3300005354 Ga0070675_100018422 Ga0070675_1000184221 190
31 3300005355 Ga0070671_100319781 Ga0070671_1003197812 190
32 3300005364 Ga0070673_100012946 Ga0070673_1000129465 190
33 3300005365 Ga0070688_100002056 Ga0070688_1000020566 190
34 3300005456 Ga0070678_100045879 Ga0070678_1000458794 190
35 3300005459 Ga0068867_100061228 Ga0068867_1000612282 190
36 3300005471 Ga0070698_100004441 Ga0070698_1000044412 190
37 3300005543 Ga0070672_100027741 Ga0070672_1000277413 190
38 3300005548 Ga0070665_100095708 Ga0070665_1000957082 190
39 3300005577 Ga0068857_100070466 Ga0068857_1000704662 190
40 3300005617 Ga0068859_100049322 Ga0068859_1000493225 190
41 3300005617 Ga0068859_100727155 Ga0068859_1007271552 190
42 3300005618 Ga0068864_100122280 Ga0068864_1001222802 190
43 3300005840 Ga0068870_10049149 Ga0068870_100491492 190
44 3300005840 Ga0068870_10238938 Ga0068870_102389382 190
45 3300005843 Ga0068860_100086591 Ga0068860_1000865912 190
46 3300005844 Ga0068862_100033664 Ga0068862_1000336645 190
47 3300006237 Ga0097621_100123678 Ga0097621_1001236782 190
48 3300006358 Ga0068871_100029893 Ga0068871_1000298934 190
49 3300006358 Ga0068871_100308656 Ga0068871_1003086562 190
50 3300006881 Ga0068865_100034732 Ga0068865_1000347323 190
51 3300006931 Ga0097620_100049324 Ga0097620_1000493245 190
52 3300006931 Ga0097620_100727111 Ga0097620_1007271112 190
53 3300009553 Ga0105249_10026641 Ga0105249_100266413 190
54 3300011119 Ga0105246_10006351 Ga0105246_100063513 190
55 3300013296 Ga0157374_10171545 Ga0157374_101715452 190
56 3300013297 Ga0157378_10402536 Ga0157378_104025362 190
57 3300013306 Ga0163162_10729292 Ga0163162_107292922 190
58 3300014326 Ga0157380_10002354 Ga0157380_100023549 190
59 3300014745 Ga0157377_10015331 Ga0157377_100153315 190
60 3300014745 Ga0157377_10167553 Ga0157377_101675532 190
61 3300017792 Ga0163161_10829436 Ga0163161_108294362 190
62 3300025315 Ga0207697_10086423 Ga0207697_100864232 190
63 3300025907 Ga0207645_10000306 Ga0207645_1000030627 190
64 3300025908 Ga0207643_10032598 Ga0207643_100325984 190
65 3300025908 Ga0207643_10054407 Ga0207643_100544072 190
66 3300025923 Ga0207681_10119866 Ga0207681_101198662 190
67 3300025925 Ga0207650_10034456 Ga0207650_100344562 190
68 3300025926 Ga0207659_10047170 Ga0207659_100471702 190
69 3300025931 Ga0207644_10374533 Ga0207644_103745332 190
70 3300025933 Ga0207706_10027852 Ga0207706_100278523 190
71 3300025940 Ga0207691_10190344 Ga0207691_101903443 190
72 3300025942 Ga0207689_10044800 Ga0207689_100448002 190
73 3300025960 Ga0207651_10327606 Ga0207651_103276062 190
74 3300025961 Ga0207712_10057893 Ga0207712_100578932 190
75 3300025972 Ga0207668_10086658 Ga0207668_100866581 190
76 3300025972 Ga0207668_10231409 Ga0207668_102314093 190
77 3300025981 Ga0207640_10552718 Ga0207640_105527182 190
78 3300025986 Ga0207658_10532796 Ga0207658_105327962 190
79 3300026023 Ga0207677_10149227 Ga0207677_101492272 190
80 3300026067 Ga0207678_10788110 Ga0207678_107881102 190
81 3300026089 Ga0207648_10003171 Ga0207648_1000317112 190
82 3300026116 Ga0207674_10019660 Ga0207674_100196602 190
83 3300026118 Ga0207675_100004088 Ga0207675_1000040889 190
84 3300026118 Ga0207675_100040221 Ga0207675_1000402213 190
85 3300026121 Ga0207683_10004426 Ga0207683_100044269 190
86 3300027907 Ga0207428_10018183 Ga0207428_100181835 190
87 3300028379 Ga0268266_10777340 Ga0268266_107773401 190
88 3300028380 Ga0268265_10036100 Ga0268265_100361001 190
89 3300028381 Ga0268264_10289996 Ga0268264_102899962 190
90 3300035172 Ga0373955_0642077 Ga0373955_0642077_43_615 190
91 3300005289 Ga0065704_10120273 Ga0065704_101202732 191
92 3300005290 Ga0065712_10017963 Ga0065712_100179632 191
93 3300005290 Ga0065712_10074461 Ga0065712_100744614 191
94 3300005328 Ga0070676_10239943 Ga0070676_102399431 191
95 3300005331 Ga0070670_100060575 Ga0070670_1000605752 191
96 3300005334 Ga0068869_100012493 Ga0068869_1000124934 191
97 3300005340 Ga0070689_100125284 Ga0070689_1001252842 191
98 3300005340 Ga0070689_100262998 Ga0070689_1002629982 191
99 3300005343 Ga0070687_100169784 Ga0070687_1001697842 191
100 3300005347 Ga0070668_100100454 Ga0070668_1001004542 191
101 3300005347 Ga0070668_100115290 Ga0070668_1001152902 191
102 3300005353 Ga0070669_100068759 Ga0070669_1000687592 191
103 3300005356 Ga0070674_100026680 Ga0070674_1000266802 191
104 3300005356 Ga0070674_100629364 Ga0070674_1006293642 191
105 3300005365 Ga0070688_100165654 Ga0070688_1001656542 191
106 3300005365 Ga0070688_100229116 Ga0070688_1002291162 191
107 3300005438 Ga0070701_10343205 Ga0070701_103432051 191
108 3300005456 Ga0070678_100569977 Ga0070678_1005699772 191
109 3300005459 Ga0068867_100133063 Ga0068867_1001330631 191
110 3300005466 Ga0070685_10113381 Ga0070685_101133812 191
111 3300005466 Ga0070685_10153468 Ga0070685_101534682 191
112 3300005543 Ga0070672_100206892 Ga0070672_1002068922 191
113 3300005719 Ga0068861_100022281 Ga0068861_1000222812 191
114 3300005719 Ga0068861_100124956 Ga0068861_1001249562 191
115 3300005719 Ga0068861_100670602 Ga0068861_1006706022 191
116 3300005841 Ga0068863_100000546 Ga0068863_1000005462 191
117 3300005841 Ga0068863_100699213 Ga0068863_1006992132 191
118 3300005843 Ga0068860_100111574 Ga0068860_1001115742 191
119 3300005843 Ga0068860_100766475 Ga0068860_1007664752 191
120 3300006163 Ga0070715_10179242 Ga0070715_101792422 191
121 3300006195 Ga0075366_10005157 Ga0075366_100051572 191
122 3300006237 Ga0097621_100008505 Ga0097621_1000085056 191
123 3300006237 Ga0097621_100039988 Ga0097621_1000399883 191
124 3300006358 Ga0068871_100020832 Ga0068871_1000208325 191
125 3300006931 Ga0097620_100114196 Ga0097620_1001141961 191
126 3300009094 Ga0111539_10544737 Ga0111539_105447372 191
127 3300009101 Ga0105247_10552824 Ga0105247_105528241 191
128 3300009176 Ga0105242_10016361 Ga0105242_100163615 191
129 3300009176 Ga0105242_10081599 Ga0105242_100815994 191
130 3300009176 Ga0105242_11461574 Ga0105242_114615742 191
131 3300009553 Ga0105249_10029238 Ga0105249_100292382 191
132 3300009553 Ga0105249_10074873 Ga0105249_100748732 191
133 3300011119 Ga0105246_10229885 Ga0105246_102298852 191
134 3300013297 Ga0157378_10325675 Ga0157378_103256752 191
135 3300013306 Ga0163162_10037865 Ga0163162_100378653 191
136 3300013306 Ga0163162_10308043 Ga0163162_103080433 191
137 3300013308 Ga0157375_10450254 Ga0157375_104502543 191
138 3300013308 Ga0157375_10610821 Ga0157375_106108212 191
139 3300013308 Ga0157375_11548514 Ga0157375_115485142 191
140 3300013308 Ga0157375_12542121 Ga0157375_125421211 191
141 3300014326 Ga0157380_10206801 Ga0157380_102068012 191
142 3300014326 Ga0157380_11413498 Ga0157380_114134981 191
143 3300014745 Ga0157377_10257936 Ga0157377_102579362 191
144 3300014968 Ga0157379_10155209 Ga0157379_101552092 191
145 3300014968 Ga0157379_10170256 Ga0157379_101702563 191
146 3300014968 Ga0157379_10483799 Ga0157379_104837992 191
147 3300014969 Ga0157376_11088832 Ga0157376_110888321 191
148 3300014969 Ga0157376_11670978 Ga0157376_116709781 191
149 3300017792 Ga0163161_10216044 Ga0163161_102160442 191
150 3300017792 Ga0163161_10772623 Ga0163161_107726232 191
151 3300025893 Ga0207682_10024896 Ga0207682_100248963 191
152 3300025923 Ga0207681_10056045 Ga0207681_100560452 191
153 3300025926 Ga0207659_10485486 Ga0207659_104854862 191
154 3300025931 Ga0207644_10689079 Ga0207644_106890792 191
155 3300025934 Ga0207686_10057610 Ga0207686_100576102 191
156 3300025936 Ga0207670_10079915 Ga0207670_100799153 191
157 3300025936 Ga0207670_10110098 Ga0207670_101100982 191
158 3300025937 Ga0207669_10175544 Ga0207669_101755442 191
159 3300025938 Ga0207704_10442459 Ga0207704_104424591 191
160 3300025940 Ga0207691_10041579 Ga0207691_100415793 191
161 3300025942 Ga0207689_10002574 Ga0207689_100025741 191
162 3300025942 Ga0207689_10008304 Ga0207689_100083045 191
163 3300025961 Ga0207712_10018504 Ga0207712_100185044 191
164 3300025972 Ga0207668_10036181 Ga0207668_100361812 191
165 3300025972 Ga0207668_10775839 Ga0207668_107758391 191
166 3300025986 Ga0207658_10345550 Ga0207658_103455502 191
167 3300025986 Ga0207658_10526060 Ga0207658_105260602 191
168 3300026035 Ga0207703_10473098 Ga0207703_104730982 191
169 3300026088 Ga0207641_10000539 Ga0207641_100005393 191
170 3300026088 Ga0207641_10782005 Ga0207641_107820052 191
171 3300026118 Ga0207675_100013718 Ga0207675_1000137184 191
172 3300026118 Ga0207675_100036756 Ga0207675_1000367562 191
173 3300026118 Ga0207675_100207854 Ga0207675_1002078542 191
174 3300026118 Ga0207675_100752692 Ga0207675_1007526922 191
175 3300026121 Ga0207683_10086946 Ga0207683_100869462 191
176 3300028380 Ga0268265_10177784 Ga0268265_101777842 191
177 3300028380 Ga0268265_11226612 Ga0268265_112266121 191
178 3300036401 Ga0373937_0270008 Ga0373937_0270008_776_1351 191
179 3300046537 Ga0495598_0152006 Ga0495598_0152006_68_643 191
180 3300046539 Ga0495621_0027600 Ga0495621_0027600_432_1007 191
181 3300048913 Ga0496110_0349613 Ga0496110_0349613_743_1318 191
182 3300048917 Ga0496114_0433814 Ga0496114_0433814_157_732 191
183 3300050493 nmdc:mga0k408_89479_c1 nmdc:mga0k408_89479_c1_1084_1659 191
184 3300050511 nmdc:mga08y16_850698_c1 nmdc:mga08y16_850698_c1_258_833 191
185 3300005290 Ga0065712_10186141 Ga0065712_101861412 192
186 3300005328 Ga0070676_10004504 Ga0070676_100045046 192
187 3300005329 Ga0070683_100045602 Ga0070683_1000456025 192
188 3300005329 Ga0070683_100165536 Ga0070683_1001655363 192
189 3300005331 Ga0070670_101219393 Ga0070670_1012193931 192
190 3300005334 Ga0068869_100003787 Ga0068869_1000037874 192
191 3300005334 Ga0068869_100012922 Ga0068869_1000129226 192
192 3300005335 Ga0070666_10032000 Ga0070666_100320002 192
193 3300005337 Ga0070682_100029587 Ga0070682_1000295873 192
194 3300005337 Ga0070682_100274504 Ga0070682_1002745042 192
195 3300005338 Ga0068868_100013211 Ga0068868_1000132113 192
196 3300005339 Ga0070660_100782730 Ga0070660_1007827301 192
197 3300005344 Ga0070661_100002466 Ga0070661_10000246610 192
198 3300005353 Ga0070669_100260752 Ga0070669_1002607522 192
199 3300005354 Ga0070675_100524456 Ga0070675_1005244561 192
200 3300005355 Ga0070671_100117500 Ga0070671_1001175002 192
201 3300005356 Ga0070674_100165941 Ga0070674_1001659412 192
202 3300005366 Ga0070659_100470697 Ga0070659_1004706972 192
203 3300005367 Ga0070667_100062831 Ga0070667_1000628312 192
204 3300005456 Ga0070678_100008016 Ga0070678_1000080163 192
205 3300005457 Ga0070662_100089190 Ga0070662_1000891903 192
206 3300005457 Ga0070662_100117127 Ga0070662_1001171272 192
207 3300005458 Ga0070681_10500513 Ga0070681_105005132 192
208 3300005459 Ga0068867_100046131 Ga0068867_1000461313 192
209 3300005459 Ga0068867_100139712 Ga0068867_1001397122 192
210 3300005535 Ga0070684_100000172 Ga0070684_10000017214 192
211 3300005539 Ga0068853_100004535 Ga0068853_1000045357 192
212 3300005564 Ga0070664_100001323 Ga0070664_1000013235 192
213 3300005564 Ga0070664_100502591 Ga0070664_1005025912 192
214 3300005577 Ga0068857_100005435 Ga0068857_1000054358 192
215 3300005578 Ga0068854_100227095 Ga0068854_1002270951 192
216 3300005614 Ga0068856_100842969 Ga0068856_1008429691 192
217 3300005616 Ga0068852_100122497 Ga0068852_1001224971 192
218 3300005719 Ga0068861_100187586 Ga0068861_1001875863 192
219 3300005841 Ga0068863_100056437 Ga0068863_1000564374 192
220 3300005841 Ga0068863_100485471 Ga0068863_1004854712 192
221 3300005842 Ga0068858_100025646 Ga0068858_1000256461 192
222 3300006358 Ga0068871_100854193 Ga0068871_1008541931 192
223 3300006358 Ga0068871_100954269 Ga0068871_1009542692 192
224 3300009093 Ga0105240_10455714 Ga0105240_104557142 192
225 3300009176 Ga0105242_10257767 Ga0105242_102577672 192
226 3300009177 Ga0105248_10726979 Ga0105248_107269792 192
227 3300010375 Ga0105239_11009236 Ga0105239_110092362 192
228 3300011119 Ga0105246_10307529 Ga0105246_103075292 192
229 3300013297 Ga0157378_10197563 Ga0157378_101975633 192
230 3300013306 Ga0163162_10019461 Ga0163162_100194615 192
231 3300013306 Ga0163162_10832629 Ga0163162_108326292 192
232 3300013307 Ga0157372_10669599 Ga0157372_106695991 192
233 3300014325 Ga0163163_10120893 Ga0163163_101208934 192
234 3300014745 Ga0157377_10253144 Ga0157377_102531442 192
235 3300014745 Ga0157377_10339580 Ga0157377_103395802 192
236 3300014969 Ga0157376_10180907 Ga0157376_101809072 192
237 3300017792 Ga0163161_10004913 Ga0163161_100049136 192
238 3300025899 Ga0207642_10023271 Ga0207642_100232713 192
239 3300025899 Ga0207642_10274534 Ga0207642_102745341 192
240 3300025901 Ga0207688_10048470 Ga0207688_100484702 192
241 3300025901 Ga0207688_10128500 Ga0207688_101285002 192
242 3300025903 Ga0207680_10097760 Ga0207680_100977603 192
243 3300025905 Ga0207685_10158674 Ga0207685_101586742 192
244 3300025907 Ga0207645_10061821 Ga0207645_100618214 192
245 3300025912 Ga0207707_10418049 Ga0207707_104180492 192
246 3300025926 Ga0207659_10239955 Ga0207659_102399551 192
247 3300025932 Ga0207690_10303552 Ga0207690_103035522 192
248 3300025933 Ga0207706_10002722 Ga0207706_100027228 192
249 3300025933 Ga0207706_10014390 Ga0207706_100143903 192
250 3300025933 Ga0207706_10110832 Ga0207706_101108323 192
251 3300025934 Ga0207686_10448070 Ga0207686_104480702 192
252 3300025937 Ga0207669_10329062 Ga0207669_103290622 192
253 3300025942 Ga0207689_10003632 Ga0207689_100036325 192
254 3300025942 Ga0207689_10021494 Ga0207689_100214942 192
255 3300025944 Ga0207661_10026855 Ga0207661_100268552 192
256 3300025945 Ga0207679_10006471 Ga0207679_100064711 192
257 3300025960 Ga0207651_10718753 Ga0207651_107187531 192
258 3300025981 Ga0207640_10002163 Ga0207640_100021636 192
259 3300026023 Ga0207677_10096569 Ga0207677_100965691 192
260 3300026035 Ga0207703_10290684 Ga0207703_102906843 192
261 3300026088 Ga0207641_10102891 Ga0207641_101028912 192
262 3300026089 Ga0207648_10015000 Ga0207648_100150004 192
263 3300026089 Ga0207648_10059941 Ga0207648_100599413 192
264 3300026095 Ga0207676_10057057 Ga0207676_100570574 192
265 3300026116 Ga0207674_10026118 Ga0207674_100261183 192
266 3300026118 Ga0207675_100294968 Ga0207675_1002949682 192
267 3300026121 Ga0207683_10004166 Ga0207683_100041667 192
268 3300035692 Ga0373935_0303968 Ga0373935_0303968_250_828 192
269 3300037068 Ga0373925_0362898 Ga0373925_0362898_72_650 192
270 3300037853 Ga0436364_0678490 Ga0436364_0678490_438_1049 192
271 3300037853 Ga0436364_0881793 Ga0436364_0881793_640_1248 192
272 3300041486 Ga0451807_0954051 Ga0451807_0954051_184_765 192
273 3300046516 Ga0495628_0037066 Ga0495628_0037066_1694_2272 192
274 3300046517 Ga0495630_0015761 Ga0495630_0015761_4058_4636 192
275 3300046537 Ga0495598_0132084 Ga0495598_0132084_245_826 192
276 3300046642 Ga0495634_0014817 Ga0495634_0014817_3156_3734 192
277 3300046675 Ga0495657_0144600 Ga0495657_0144600_790_1368 192
278 3300046678 Ga0495599_0421784 Ga0495599_0421784_188_766 192
279 3300046689 Ga0495613_0059149 Ga0495613_0059149_130_708 192
280 3300046809 Ga0495600_0062246 Ga0495600_0062246_1178_1756 192
281 3300047322 Ga0495680_0152898 Ga0495680_0152898_466_1044 192
282 3300047444 Ga0495675_0333282 Ga0495675_0333282_160_738 192
283 3300048904 Ga0496101_0170530 Ga0496101_0170530_805_1386 192
284 3300048917 Ga0496114_0346486 Ga0496114_0346486_237_818 192
285 3300003354 JGI25160J50197_1000687 JGI25160J50197_10006873 193
286 3300014968 Ga0157379_10271693 Ga0157379_102716931 193
287 3300025302 Ga0207426_1000132 Ga0207426_100013249 193
288 3300026078 Ga0207702_11020455 Ga0207702_110204551 193
289 3300009545 Ga0105237_10157519 Ga0105237_101575192 194
290 3300010375 Ga0105239_10748575 Ga0105239_107485752 194
291 3300013104 Ga0157370_10449453 Ga0157370_104494532 194
292 3300013104 Ga0157370_10901675 Ga0157370_109016752 194
293 3300013105 Ga0157369_10510665 Ga0157369_105106652 194
294 3300013296 Ga0157374_10396045 Ga0157374_103960451 194
295 3300013296 Ga0157374_10547458 Ga0157374_105474582 194
296 3300013297 Ga0157378_10106955 Ga0157378_101069553 194
297 3300014968 Ga0157379_11104308 Ga0157379_111043081 194
298 3300025914 Ga0207671_10140243 Ga0207671_101402432 194
299 3300025925 Ga0207650_10345870 Ga0207650_103458702 194
300 3300046543 Ga0495645_0163183 Ga0495645_0163183_809_1393 194
301 3300048907 Ga0496104_0507678 Ga0496104_0507678_432_1016 194
302 3300048917 Ga0496114_0176994 Ga0496114_0176994_1200_1784 194
303 3300005336 Ga0070680_100000323 Ga0070680_1000003239 195
304 3300005337 Ga0070682_100062210 Ga0070682_1000622102 195
305 3300005339 Ga0070660_100524141 Ga0070660_1005241412 195
306 3300005341 Ga0070691_10011305 Ga0070691_100113052 195
307 3300005458 Ga0070681_10039612 Ga0070681_100396123 195
308 3300005530 Ga0070679_100000397 Ga0070679_10000039713 195
309 3300005539 Ga0068853_100134164 Ga0068853_1001341642 195
310 3300005547 Ga0070693_100003549 Ga0070693_1000035496 195
311 3300005563 Ga0068855_100110513 Ga0068855_1001105135 195
312 3300009093 Ga0105240_10062426 Ga0105240_100624266 195
313 3300009174 Ga0105241_10000105 Ga0105241_1000010532 195
314 3300009545 Ga0105237_10361633 Ga0105237_103616333 195
315 3300013104 Ga0157370_10004025 Ga0157370_1000402513 195
316 3300013306 Ga0163162_11877933 Ga0163162_118779331 195
317 3300025911 Ga0207654_10001230 Ga0207654_100012302 195
318 3300025912 Ga0207707_10000205 Ga0207707_1000020523 195
319 3300025913 Ga0207695_10003840 Ga0207695_100038407 195
320 3300025914 Ga0207671_10265194 Ga0207671_102651943 195
321 3300025917 Ga0207660_10000843 Ga0207660_1000084312 195
322 3300025919 Ga0207657_10253238 Ga0207657_102532383 195
323 3300025921 Ga0207652_10000186 Ga0207652_1000018646 195
324 3300025949 Ga0207667_10049053 Ga0207667_100490535 195
325 3300026041 Ga0207639_10080173 Ga0207639_100801733 195
326 3300031595 Ga0265313_10157570 Ga0265313_101575702 195
327 3300003323 rootH1_10109676 rootH1_101096764 197
328 3300025981 Ga0207640_10222727 Ga0207640_102227273 197
329 3300026089 Ga0207648_10585624 Ga0207648_105856241 197
330 3300031251 Ga0265327_10000152 Ga0265327_1000015253 197

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13578

Methyltransf_24

Methyltransferase domain

74

171

0.96

PF13649

Methyltransf_25

Methyltransferase domain

73

164

0.85

PF00398

RrnaAD

Ribosomal RNA adenine dimethylase

19

157

0.84

PF01135

PCMT

Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)

33

200

0.83

PF08241

Methyltransf_11

Methyltransferase domain

74

168

0.83

PF01596

Methyltransf_3

O-methyltransferase

21

215

0.81

PF13847

Methyltransf_31

Methyltransferase domain

67

209

0.8

PF05175

MTS

Methyltransferase small domain

48

145

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gxn-assembly1.cif.gz_B the crystal structure of csfaomt2 in complex with sah 0.8963 11 192
3tr6-assembly1.cif.gz_A-2 structure of a o-methyltransferase from coxiella burnetii 0.8936 4 192
8gxo-assembly1.cif.gz_B the crystal structure of csfaomt1 in complex with sah 0.8849 3 192
2hnk-assembly1.cif.gz_C crystal structure of sam-dependent o-methyltransferase from pathogenic bacterium leptospira interrogans 0.8844 4 193
6jcl-assembly1.cif.gz_A crystal structure of cofactor-bound rv0187 from mtb 0.8834 3 192
ID Description Score Start End Superfamily
af_Q86IC9_10_229_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8829 4 190 3.40.50.150
3cbgA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8773 4 191 3.40.50.150
af_A0A0R0K566_14_120_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8728 27 107 3.40.50.150
2hnkB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8717 4 194 3.40.50.150
af_Q965W3_3_225_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8701 11 190 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A6J6M8Z2-F1-model_v4 Unannotated protein 0.9828 7 190
AF-A0A7H0IRW3-F1-model_v4 Class I SAM-dependent methyltransferase 0.9786 28 190 GO:0008168
GO:0032259
AF-A0A553FLS6-F1-model_v4 Methyltransferase domain-containing protein 0.9711 1 192 GO:0008171
GO:0032259
AF-A0A1Z8SDV7-F1-model_v4 SAM-dependent methyltransferase 0.9711 5 191 GO:0008171
GO:0032259
AF-A0A1I3GP30-F1-model_v4 Predicted O-methyltransferase YrrM 0.9682 1 190 GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
91.67 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map