F409389

General Info

Members Datasets Scaffolds Average Seq Length
328 251 656 471

Family's Representative Sequence

Representative Sequence 3300046516|Ga0495628_0004258|Ga0495628_0004258_6745_8286
Length 513
Sequence VPNIVIVHKYRRYQDRVIDFFYLKNRRASIAFGRASPEKEVTRESAIQAAADLYDSGAFLEDLRRRVAFRTESQEPESGPLLSAYLVDEIAPLLAELGFTSRLVDNPTPGAGPFLVAHRKEGDELPTVLTYGHGDVVRGYDAQWHEGLSPWDVTVVGDHWYGRGTADNKGQHSINLAALKAVLDARNGQLGFNLKLLFETGEEVGSPGLHAVCETLRDELKADVLIASDGPRLGAARPTIFLGSRGLVNFKLTVNLREGGHHSGNWGGLLRNPGVVLANAIASMVNQNGRILVEGLRPPEVPQAVRRALDGIIVGGNPGEPEVDTDYGEPGLTPSERVFGWNNLEVLAFRTGNPEKPVNAIPPHAFAYMQIRFVVGTNWEDLEQIVRRHLDERGFGMIEIDVDRGAPATRVDPDNAWVQWGLNSLAQTTGKKPVLLPNLGGTLPNDVFAEIIGMPTLWVPHSYPGCSQHAPDEHMLGPVVEEGLRIMAGLFWDLGEQGVPSAANTYQAPGNTR

Samples

Sample ID Description Type Environment
1 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
7 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
8 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
9 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
10 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
54 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
55 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
62 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
63 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
96 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
97 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
98 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
99 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
100 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
101 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
102 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
103 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
104 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
105 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
106 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
107 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
108 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
109 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
110 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
111 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
112 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
113 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
114 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
115 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
116 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
117 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
118 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
119 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
120 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
121 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
122 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
123 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
124 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
125 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
126 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
127 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
128 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
129 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
130 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
131 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
132 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
133 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
134 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
135 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
136 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
137 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
138 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
139 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
140 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
141 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
142 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
143 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
144 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
145 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
146 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
147 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
148 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
149 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
150 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
151 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
152 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
153 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
154 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
155 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
156 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
157 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
158 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
159 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
160 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
161 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
162 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
163 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
164 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
165 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
166 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
167 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
168 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
169 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
170 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
171 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
172 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
173 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
174 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
175 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
176 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
177 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
178 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
179 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
180 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
181 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
182 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
185 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
186 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
187 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
190 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
191 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
192 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
193 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
194 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
195 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
196 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
197 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
198 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
199 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
200 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
201 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
202 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
203 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
204 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
205 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
206 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
207 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
208 2508501050 Microvirga lupini Lut6 Isolate Nodule
209 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
210 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
211 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
212 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
213 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
214 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
215 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
216 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
217 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
218 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
219 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
220 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
221 2643221594 Achromobacter sp. Root170 Isolate Unclassified
222 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
223 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
224 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
225 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
226 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
227 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
228 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
229 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
230 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
231 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
232 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
233 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
234 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
235 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
236 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
237 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
238 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
239 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
240 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
241 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
242 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
243 641522639 Methylobacterium sp. 4-46 Isolate Nodule
244 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
245 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
246 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
247 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
248 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
249 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
250 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
251 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.37
Metatranscriptomes 0
Isolates 14.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.71
Nodule 3.96
Rhizoplane 4.57
Rhizosphere 71.95
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495628_0004258 3300046516 Bacteria 12723
2 JGI24740J21852_10008000 3300001979 Bacteria 4251
3 JGI24739J22299_10001626 3300001989 Bacteria 8531
4 JGI24738J21930_10002019 3300002075 Bacteria 5452
5 JGI24738J21930_10004057 3300002075 Bacteria 3627
6 JGI24738J21930_10010961 3300002075 Bacteria 2004
7 JGI25151J46595_10000028 3300003187 Bacteria 208373
8 Ga0055532_1000013 3300003758 Bacteria 380677
9 Ga0055527_1000010 3300003760 Bacteria 380677
10 Ga0055535_1000010 3300003761 Bacteria 380677
11 Ga0055542_1000016 3300003762 Bacteria 380677
12 Ga0055529_1000012 3300003763 Bacteria 380677
13 Ga0070658_10196272 3300005327 Bacteria 1702
14 Ga0070676_10000020 3300005328 Bacteria 48745
15 Ga0070670_100001819 3300005331 Bacteria 17374
16 Ga0070670_100039545 3300005331 Bacteria 4056
17 Ga0070670_100143822 3300005331 Bacteria 2063
18 Ga0070677_10000437 3300005333 Bacteria 14297
19 Ga0070666_10015709 3300005335 Bacteria 4833
20 Ga0068868_100000764 3300005338 Bacteria 21748
21 Ga0070668_100001542 3300005347 Bacteria 16621
22 Ga0070668_100009360 3300005347 Bacteria 7267
23 Ga0070668_100150804 3300005347 Bacteria 1880
24 Ga0070675_100008072 3300005354 Bacteria 8158
25 Ga0070675_100010686 3300005354 Bacteria 7179
26 Ga0070675_100056994 3300005354 Bacteria 3221
27 Ga0070671_100000345 3300005355 Bacteria 31787
28 Ga0070674_100000468 3300005356 Bacteria 20359
29 Ga0070673_100000918 3300005364 Bacteria 16658
30 Ga0070673_100061636 3300005364 Bacteria 2976
31 Ga0070667_100001333 3300005367 Bacteria 22168
32 Ga0070667_100098711 3300005367 Bacteria 2520
33 Ga0070667_100165102 3300005367 Bacteria 1952
34 Ga0070667_100187069 3300005367 Bacteria 1833
35 Ga0070701_10030735 3300005438 Bacteria 2659
36 Ga0070678_100000272 3300005456 Bacteria 24000
37 Ga0070678_100164767 3300005456 Bacteria 1800
38 Ga0068867_100000566 3300005459 Bacteria 24495
39 Ga0070672_100006354 3300005543 Bacteria 7935
40 Ga0070672_100119556 3300005543 Bacteria 2155
41 Ga0070665_100015372 3300005548 Bacteria 7686
42 Ga0070664_100036603 3300005564 Bacteria 4123
43 Ga0070664_100068389 3300005564 Bacteria 3036
44 Ga0068852_100000912 3300005616 Bacteria 19585
45 Ga0068864_100001419 3300005618 Bacteria 19801
46 Ga0068864_100161923 3300005618 Bacteria 2034
47 Ga0068851_10000230 3300005834 Bacteria 26994
48 Ga0068863_100107055 3300005841 Bacteria 2660
49 Ga0068863_100125091 3300005841 Bacteria 2453
50 Ga0068860_100016387 3300005843 Bacteria 7226
51 Ga0068860_100031556 3300005843 Bacteria 5093
52 Ga0068862_100012915 3300005844 Bacteria 6909
53 Ga0075365_10003476 3300006038 Bacteria 8125
54 Ga0097621_100024568 3300006237 Bacteria 4707
55 Ga0068871_100062896 3300006358 Bacteria 3034
56 Ga0075428_100000789 3300006844 Bacteria 32981
57 Ga0075429_100052313 3300006880 Bacteria 3553
58 Ga0068865_100132996 3300006881 Bacteria 1866
59 Ga0105240_10264129 3300009093 Bacteria 1985
60 Ga0111539_10092830 3300009094 Bacteria 3546
61 Ga0105245_10009898 3300009098 Bacteria 8303
62 Ga0105242_10067634 3300009176 Bacteria 2954
63 Ga0105248_10030186 3300009177 Bacteria 6051
64 Ga0105248_10136303 3300009177 Bacteria 2769
65 Ga0105248_10153262 3300009177 Bacteria 2600
66 Ga0157369_10047418 3300013105 Bacteria 4665
67 Ga0171462_1047 3300013250 Bacteria 46389
68 Ga0157374_10101556 3300013296 Bacteria 2758
69 Ga0157374_10154141 3300013296 Bacteria 2235
70 Ga0157378_10142453 3300013297 Bacteria 2227
71 Ga0163162_10001128 3300013306 Bacteria 24861
72 Ga0163162_10001733 3300013306 Bacteria 20438
73 Ga0163162_10116617 3300013306 Bacteria 2771
74 Ga0163162_10118283 3300013306 Bacteria 2752
75 Ga0163162_10134458 3300013306 Bacteria 2583
76 Ga0157375_10001058 3300013308 Bacteria 23752
77 Ga0157375_10042858 3300013308 Bacteria 4384
78 Ga0157375_10063795 3300013308 Bacteria 3667
79 Ga0157375_10086337 3300013308 Bacteria 3188
80 Ga0157379_10022379 3300014968 Bacteria 5599
81 Ga0163161_10042219 3300017792 Bacteria 3280
82 Ga0213875_10004455 3300021388 Bacteria 7681
83 Ga0209674_100011 3300025226 Bacteria 997175
84 Ga0209672_100002 3300025228 Bacteria 1733325
85 Ga0209147_100003 3300025229 Bacteria 1733325
86 Ga0209563_101885 3300025230 Bacteria 5084
87 Ga0209258_100042 3300025242 Bacteria 380729
88 Ga0209148_1000006 3300025254 Bacteria 1733325
89 Ga0209759_1000009 3300025256 Bacteria 446623
90 Ga0209233_1000033 3300025261 Bacteria 596094
91 Ga0209455_1000003 3300025272 Bacteria 1471893
92 Ga0209676_1006539 3300025292 Bacteria 5725
93 Ga0207697_10025384 3300025315 Bacteria 2422
94 Ga0207656_10001016 3300025321 Bacteria 9141
95 Ga0207682_10000846 3300025893 Bacteria 14190
96 Ga0207682_10000862 3300025893 Bacteria 14079
97 Ga0207680_10007303 3300025903 Bacteria 5378
98 Ga0207680_10064756 3300025903 Bacteria 2242
99 Ga0207645_10000499 3300025907 Bacteria 32449
100 Ga0207707_10045849 3300025912 Bacteria 3808
101 Ga0207662_10007631 3300025918 Bacteria 5896
102 Ga0207650_10072914 3300025925 Bacteria 2585
103 Ga0207659_10008446 3300025926 Bacteria 6391
104 Ga0207659_10036311 3300025926 Bacteria 3412
105 Ga0207644_10005560 3300025931 Bacteria 8203
106 Ga0207644_10010370 3300025931 Bacteria 6143
107 Ga0207706_10023445 3300025933 Bacteria 5541
108 Ga0207669_10004956 3300025937 Bacteria 5921
109 Ga0207691_10000152 3300025940 Bacteria 64344
110 Ga0207691_10035138 3300025940 Bacteria 4656
111 Ga0207691_10053813 3300025940 Bacteria 3673
112 Ga0207711_10021781 3300025941 Bacteria 5353
113 Ga0207689_10008301 3300025942 Bacteria 9049
114 Ga0207661_10035265 3300025944 Bacteria 3897
115 Ga0207651_10006419 3300025960 Bacteria 6154
116 Ga0207651_10019046 3300025960 Bacteria 4103
117 Ga0207658_10002215 3300025986 Bacteria 14429
118 Ga0207658_10079328 3300025986 Bacteria 2511
119 Ga0207677_10016140 3300026023 Bacteria 4414
120 Ga0207677_10049080 3300026023 Bacteria 2846
121 Ga0207678_10000793 3300026067 Bacteria 28952
122 Ga0207708_10015103 3300026075 Bacteria 5785
123 Ga0207641_10003484 3300026088 Bacteria 13939
124 Ga0207641_10024127 3300026088 Bacteria 5012
125 Ga0207641_10024153 3300026088 Bacteria 5010
126 Ga0207648_10001619 3300026089 Bacteria 24692
127 Ga0207648_10033513 3300026089 Bacteria 4530
128 Ga0207683_10000307 3300026121 Bacteria 44287
129 Ga0207683_10026822 3300026121 Bacteria 4976
130 Ga0207698_10010843 3300026142 Bacteria 5882
131 Ga0209995_1004402 3300027471 Bacteria 2251
132 Ga0207428_10016201 3300027907 Bacteria 6417
133 Ga0268266_10013418 3300028379 Bacteria 7056
134 Ga0268265_10239399 3300028380 Bacteria 1600
135 Ga0268264_10045089 3300028381 Bacteria 3660
136 Ga0307517_10024426 3300028786 Bacteria 7448
137 Ga0307515_10000694 3300028794 Bacteria 77618
138 Ga0265338_10000479 3300028800 Bacteria 71329
139 Ga0307511_10002189 3300030521 Bacteria 20503
140 Ga0265332_10015339 3300031238 Bacteria 3382
141 Ga0265328_10012586 3300031239 Bacteria 3365
142 Ga0265320_10019249 3300031240 Bacteria 3738
143 Ga0265331_10006034 3300031250 Bacteria 7215
144 Ga0265327_10012698 3300031251 Bacteria 5658
145 Ga0265316_10011858 3300031344 Bacteria 7840
146 Ga0307509_10126597 3300031507 Bacteria 2519
147 Ga0307508_10020294 3300031616 Bacteria 6034
148 Ga0307516_10009319 3300031730 Bacteria 10964
149 Ga0307412_10000002 3300031911 Bacteria 743446
150 Ga0307415_100049677 3300032126 Bacteria 2838
151 Ga0307507_10018901 3300033179 Bacteria 7802
152 Ga0307510_10009762 3300033180 Bacteria 11422
153 Ga0436364_0723260 3300037853 Bacteria 46751
154 Ga0400483_223410 3300039062 Bacteria 3635
155 Ga0466977_0000058 3300044666 Bacteria 20101
156 Ga0466961_0126296 3300044693 Bacteria 1604
157 Ga0466970_0002816 3300044765 Bacteria 8396
158 Ga0495627_000013 3300046453 Bacteria 332765
159 Ga0495592_0007294 3300046454 Bacteria 8269
160 Ga0495603_0003931 3300046455 Bacteria 8856
161 Ga0495603_0090626 3300046455 Bacteria 1788
162 Ga0495591_008065 3300046458 Bacteria 4362
163 Ga0495629_0000967 3300046459 Bacteria 23155
164 Ga0495638_0000356 3300046460 Bacteria 57145
165 Ga0495651_0002210 3300046462 Bacteria 15018
166 Ga0495651_0028998 3300046462 Bacteria 4316
167 Ga0495651_0081326 3300046462 Bacteria 2445
168 Ga0495653_0038353 3300046463 Bacteria 3761
169 Ga0495653_0060807 3300046463 Bacteria 2860
170 Ga0495650_0001460 3300046471 Bacteria 22664
171 Ga0495580_0000375 3300046472 Bacteria 36457
172 Ga0495580_0003543 3300046472 Bacteria 13260
173 Ga0495580_0073307 3300046472 Bacteria 2390
174 Ga0495582_0074839 3300046473 Bacteria 1875
175 Ga0495605_0001838 3300046474 Bacteria 13575
176 Ga0495605_0011772 3300046474 Bacteria 4869
177 Ga0495662_0002729 3300046476 Bacteria 8923
178 Ga0495664_0004963 3300046477 Bacteria 7284
179 Ga0495664_0006878 3300046477 Bacteria 6295
180 Ga0495585_0005595 3300046492 Bacteria 7897
181 Ga0495596_0003225 3300046500 Bacteria 8368
182 Ga0495596_0030582 3300046500 Bacteria 2155
183 Ga0495607_0011194 3300046501 Bacteria 5988
184 Ga0495608_0013653 3300046511 Bacteria 5635
185 Ga0495610_0009302 3300046512 Bacteria 6226
186 Ga0495618_0071676 3300046514 Bacteria 2204
187 Ga0495630_0001249 3300046517 Bacteria 17544
188 Ga0495630_0153190 3300046517 Bacteria 1754
189 Ga0495648_0011451 3300046524 Bacteria 6678
190 Ga0495666_0011634 3300046526 Bacteria 4386
191 Ga0495666_0019909 3300046526 Bacteria 3328
192 Ga0495642_0001041 3300046528 Bacteria 12874
193 Ga0495642_0017327 3300046528 Bacteria 2815
194 Ga0495652_0015869 3300046529 Bacteria 6743
195 Ga0495652_0022467 3300046529 Bacteria 5597
196 Ga0495652_0121545 3300046529 Bacteria 2081
197 Ga0495665_0005006 3300046531 Bacteria 7144
198 Ga0495640_0003474 3300046533 Bacteria 12686
199 Ga0495586_0014720 3300046535 Bacteria 4156
200 Ga0495587_0004271 3300046536 Bacteria 9437
201 Ga0495645_0000967 3300046543 Bacteria 19586
202 Ga0495645_0004991 3300046543 Bacteria 9091
203 Ga0495622_0014379 3300046557 Bacteria 3676
204 Ga0495667_0083507 3300046559 Bacteria 2074
205 Ga0495667_0088946 3300046559 Bacteria 2002
206 Ga0495634_0006253 3300046642 Bacteria 9068
207 Ga0495625_0080421 3300046660 Bacteria 2270
208 Ga0495635_0005753 3300046663 Bacteria 8637
209 Ga0495635_0014013 3300046663 Bacteria 5609
210 Ga0495661_0007817 3300046665 Bacteria 7438
211 Ga0495588_0013240 3300046674 Bacteria 3925
212 Ga0495657_0006354 3300046675 Bacteria 9254
213 Ga0495599_0017534 3300046678 Bacteria 4449
214 Ga0495599_0018398 3300046678 Bacteria 4352
215 Ga0495623_0005758 3300046679 Bacteria 8084
216 Ga0495646_0000991 3300046680 Bacteria 16325
217 Ga0495646_0044876 3300046680 Bacteria 2701
218 Ga0495669_0027964 3300046684 Bacteria 2467
219 Ga0495669_0049852 3300046684 Bacteria 1876
220 Ga0495613_0001212 3300046689 Bacteria 19744
221 Ga0495613_0014150 3300046689 Bacteria 5919
222 Ga0495613_0022734 3300046689 Bacteria 4672
223 Ga0495624_0000515 3300046690 Bacteria 30255
224 Ga0495671_0007660 3300046692 Bacteria 6131
225 Ga0495671_0045057 3300046692 Bacteria 2209
226 Ga0495589_0002185 3300046794 Bacteria 10997
227 Ga0495589_0018981 3300046794 Bacteria 3526
228 Ga0495600_0004545 3300046809 Bacteria 8314
229 Ga0495600_0022220 3300046809 Bacteria 4071
230 Ga0495600_0111799 3300046809 Bacteria 1778
231 Ga0495660_0038976 3300046810 Bacteria 2640
232 Ga0495581_0003614 3300047315 Bacteria 8903
233 Ga0495581_0004528 3300047315 Bacteria 8028
234 Ga0495581_0020020 3300047315 Bacteria 3885
235 Ga0495604_0000648 3300047317 Bacteria 29764
236 Ga0495604_0057932 3300047317 Bacteria 2976
237 Ga0495674_0006527 3300047319 Bacteria 11195
238 Ga0495674_0042860 3300047319 Bacteria 4032
239 Ga0495676_0026217 3300047321 Bacteria 5019
240 Ga0495680_0046844 3300047322 Bacteria 3406
241 Ga0495683_0020242 3300047323 Bacteria 3433
242 Ga0495687_000592 3300047443 Bacteria 42279
243 Ga0495675_0024396 3300047444 Bacteria 3855
244 Ga0495679_002908 3300047446 Bacteria 8478
245 Ga0495673_0006145 3300047469 Bacteria 7113
246 Ga0495681_0030734 3300047470 Bacteria 2730
247 Ga0495686_0000042 3300047472 Bacteria 293968
248 Ga0495593_0028793 3300047673 Bacteria 3049
249 Ga0495602_0066902 3300048088 Bacteria 3093
250 Ga0495602_0085945 3300048088 Bacteria 2626
251 Ga0495614_0000490 3300048089 Bacteria 16205
252 Ga0495614_0002748 3300048089 Bacteria 7827
253 Ga0495626_0025545 3300048091 Bacteria 2888
254 Ga0496100_0050604 3300048903 Bacteria 2693
255 Ga0496101_0008834 3300048904 Bacteria 6594
256 Ga0496101_0084635 3300048904 Bacteria 2349
257 Ga0496102_0001994 3300048905 Bacteria 17631
258 Ga0496103_0009752 3300048906 Bacteria 5685
259 Ga0496104_0013565 3300048907 Bacteria 7345
260 Ga0496105_0003515 3300048908 Bacteria 11609
261 Ga0496106_0030611 3300048909 Bacteria 4012
262 Ga0496112_0014888 3300048915 Bacteria 7238
263 Ga0496113_0009790 3300048916 Bacteria 6304
264 Ga0496114_0002864 3300048917 Bacteria 13223
265 Ga0496115_0051734 3300048918 Bacteria 3293
266 Ga0496115_0085413 3300048918 Bacteria 2574
267 Ga0496117_0002771 3300048920 Bacteria 21469
268 Ga0496118_0000553 3300048921 Bacteria 61663
269 Ga0496121_0051921 3300048924 Bacteria 3449
270 Ga0496122_0085621 3300048925 Bacteria 2174
271 Ga0496123_0108301 3300048926 Bacteria 1595
272 Ga0496124_0000024 3300048927 Bacteria 414291
273 Ga0496126_0000995 3300048929 Bacteria 48357
274 Ga0501036_0089664 3300049572 Bacteria 2598
275 nmdc:mga0yw44_14730_c1 3300050492 Bacteria 4163
276 Ga0500560_015764 3300053107 Bacteria 2047
277 Ga0500658_0018066 3300053134 Bacteria 2641
278 Ga0500573_0043417 3300053140 Bacteria 2594
279 Ga0500604_0002313 3300053151 Bacteria 5209
280 Ga0500636_0004651 3300053177 Bacteria 7789
281 2501073823 2501025501 Bacteria 7768574
282 2501077590 2501025502 Bacteria 9641094
283 2501084690 2501025502 Bacteria 9641094
284 2508726109 2508501050 Bacteria 9633614
285 2511091344 2510917013 Bacteria 9951648
286 2511092447 2510917013 Bacteria 9951648
287 2511105518 2510917015 Bacteria 7950052
288 2511186915 2510917028 Bacteria 6185411
289 2513558617 2513237082 Bacteria 8640282
290 2513565886 2513237083 Bacteria 8410967
291 2513721365 2513237104 Bacteria 10034502
292 2513961232 2513237151 Bacteria 6309801
293 2514047573 2513237166 Bacteria 10373764
294 2524438852 2524023205 Bacteria 8918781
295 2545678482 2545555834 Bacteria 8130841
296 2586061680 2585427649 Bacteria 9053857
297 2599717802 2599185236 Bacteria 6875203
298 2643978780 2643221594 Bacteria 5811388
299 2687578812 2687453129 Bacteria 4387428
300 2723879743 2721755763 Bacteria 4464185
301 2738820510 2738541296 Bacteria 7285013
302 2738832990 2738541298 Bacteria 7286732
303 2738874517 2738541306 Bacteria 7284992
304 2739186147 2738543002 Bacteria 7284546
305 2739221115 2738543008 Bacteria 7282815
306 2745074671 2744054633 Bacteria 8678936
307 2809036463 2808606395 Bacteria 6020352
308 2809590313 2808606522 Bacteria 9488490
309 2842779203 2842775625 Bacteria 5587290
310 2866618824 2866612099 Bacteria 7543886
311 2904486062 2904483920 Bacteria 7545285
312 2904621986 2904615490 Bacteria 10047340
313 2917704915 2917699015 Bacteria 7043791
314 2919527406 2919527303 Bacteria 7718827
315 2920761846 2920760137 Bacteria 7427611
316 2941502233 2941499720 Bacteria 7599444
317 2945938709 2945934425 Bacteria 7444609
318 2990708708 2990703756 Bacteria 7715990
319 2997455016 2997451912 Bacteria 8492419
320 641643162 641522639 Bacteria 7737025
321 642420855 641736151 Bacteria 7477263
322 643601326 643348564 Bacteria 8839022
323 8003318158 8003314358 Bacteria 10575343
324 8003961580 8003955200 Bacteria 8601927
325 8045868061 8045864390 Bacteria 5043873
326 8054008959 8054002106 Bacteria 7987183
327 8055305813 8055301274 Bacteria 8587385
328 8057535787 8057529695 Bacteria 6306553
329 Ga0495628_0004258
330 JGI24740J21852_10008000
331 JGI24739J22299_10001626
332 JGI24738J21930_10002019
333 JGI24738J21930_10004057
334 JGI24738J21930_10010961
335 JGI25151J46595_10000028
336 Ga0055532_1000013
337 Ga0055527_1000010
338 Ga0055535_1000010
339 Ga0055542_1000016
340 Ga0055529_1000012
341 Ga0070658_10196272
342 Ga0070676_10000020
343 Ga0070670_100001819
344 Ga0070670_100039545
345 Ga0070670_100143822
346 Ga0070677_10000437
347 Ga0070666_10015709
348 Ga0068868_100000764
349 Ga0070668_100001542
350 Ga0070668_100009360
351 Ga0070668_100150804
352 Ga0070675_100008072
353 Ga0070675_100010686
354 Ga0070675_100056994
355 Ga0070671_100000345
356 Ga0070674_100000468
357 Ga0070673_100000918
358 Ga0070673_100061636
359 Ga0070667_100001333
360 Ga0070667_100098711
361 Ga0070667_100165102
362 Ga0070667_100187069
363 Ga0070701_10030735
364 Ga0070678_100000272
365 Ga0070678_100164767
366 Ga0068867_100000566
367 Ga0070672_100006354
368 Ga0070672_100119556
369 Ga0070665_100015372
370 Ga0070664_100036603
371 Ga0070664_100068389
372 Ga0068852_100000912
373 Ga0068864_100001419
374 Ga0068864_100161923
375 Ga0068851_10000230
376 Ga0068863_100107055
377 Ga0068863_100125091
378 Ga0068860_100016387
379 Ga0068860_100031556
380 Ga0068862_100012915
381 Ga0075365_10003476
382 Ga0097621_100024568
383 Ga0068871_100062896
384 Ga0075428_100000789
385 Ga0075429_100052313
386 Ga0068865_100132996
387 Ga0105240_10264129
388 Ga0111539_10092830
389 Ga0105245_10009898
390 Ga0105242_10067634
391 Ga0105248_10030186
392 Ga0105248_10136303
393 Ga0105248_10153262
394 Ga0157369_10047418
395 Ga0171462_1047
396 Ga0157374_10101556
397 Ga0157374_10154141
398 Ga0157378_10142453
399 Ga0163162_10001128
400 Ga0163162_10001733
401 Ga0163162_10116617
402 Ga0163162_10118283
403 Ga0163162_10134458
404 Ga0157375_10001058
405 Ga0157375_10042858
406 Ga0157375_10063795
407 Ga0157375_10086337
408 Ga0157379_10022379
409 Ga0163161_10042219
410 Ga0213875_10004455
411 Ga0209674_100011
412 Ga0209672_100002
413 Ga0209147_100003
414 Ga0209563_101885
415 Ga0209258_100042
416 Ga0209148_1000006
417 Ga0209759_1000009
418 Ga0209233_1000033
419 Ga0209455_1000003
420 Ga0209676_1006539
421 Ga0207697_10025384
422 Ga0207656_10001016
423 Ga0207682_10000846
424 Ga0207682_10000862
425 Ga0207680_10007303
426 Ga0207680_10064756
427 Ga0207645_10000499
428 Ga0207707_10045849
429 Ga0207662_10007631
430 Ga0207650_10072914
431 Ga0207659_10008446
432 Ga0207659_10036311
433 Ga0207644_10005560
434 Ga0207644_10010370
435 Ga0207706_10023445
436 Ga0207669_10004956
437 Ga0207691_10000152
438 Ga0207691_10035138
439 Ga0207691_10053813
440 Ga0207711_10021781
441 Ga0207689_10008301
442 Ga0207661_10035265
443 Ga0207651_10006419
444 Ga0207651_10019046
445 Ga0207658_10002215
446 Ga0207658_10079328
447 Ga0207677_10016140
448 Ga0207677_10049080
449 Ga0207678_10000793
450 Ga0207708_10015103
451 Ga0207641_10003484
452 Ga0207641_10024127
453 Ga0207641_10024153
454 Ga0207648_10001619
455 Ga0207648_10033513
456 Ga0207683_10000307
457 Ga0207683_10026822
458 Ga0207698_10010843
459 Ga0209995_1004402
460 Ga0207428_10016201
461 Ga0268266_10013418
462 Ga0268265_10239399
463 Ga0268264_10045089
464 Ga0307517_10024426
465 Ga0307515_10000694
466 Ga0265338_10000479
467 Ga0307511_10002189
468 Ga0265332_10015339
469 Ga0265328_10012586
470 Ga0265320_10019249
471 Ga0265331_10006034
472 Ga0265327_10012698
473 Ga0265316_10011858
474 Ga0307509_10126597
475 Ga0307508_10020294
476 Ga0307516_10009319
477 Ga0307412_10000002
478 Ga0307415_100049677
479 Ga0307507_10018901
480 Ga0307510_10009762
481 Ga0436364_0723260
482 Ga0400483_223410
483 Ga0466977_0000058
484 Ga0466961_0126296
485 Ga0466970_0002816
486 Ga0495627_000013
487 Ga0495592_0007294
488 Ga0495603_0003931
489 Ga0495603_0090626
490 Ga0495591_008065
491 Ga0495629_0000967
492 Ga0495638_0000356
493 Ga0495651_0002210
494 Ga0495651_0028998
495 Ga0495651_0081326
496 Ga0495653_0038353
497 Ga0495653_0060807
498 Ga0495650_0001460
499 Ga0495580_0000375
500 Ga0495580_0003543
501 Ga0495580_0073307
502 Ga0495582_0074839
503 Ga0495605_0001838
504 Ga0495605_0011772
505 Ga0495662_0002729
506 Ga0495664_0004963
507 Ga0495664_0006878
508 Ga0495585_0005595
509 Ga0495596_0003225
510 Ga0495596_0030582
511 Ga0495607_0011194
512 Ga0495608_0013653
513 Ga0495610_0009302
514 Ga0495618_0071676
515 Ga0495630_0001249
516 Ga0495630_0153190
517 Ga0495648_0011451
518 Ga0495666_0011634
519 Ga0495666_0019909
520 Ga0495642_0001041
521 Ga0495642_0017327
522 Ga0495652_0015869
523 Ga0495652_0022467
524 Ga0495652_0121545
525 Ga0495665_0005006
526 Ga0495640_0003474
527 Ga0495586_0014720
528 Ga0495587_0004271
529 Ga0495645_0000967
530 Ga0495645_0004991
531 Ga0495622_0014379
532 Ga0495667_0083507
533 Ga0495667_0088946
534 Ga0495634_0006253
535 Ga0495625_0080421
536 Ga0495635_0005753
537 Ga0495635_0014013
538 Ga0495661_0007817
539 Ga0495588_0013240
540 Ga0495657_0006354
541 Ga0495599_0017534
542 Ga0495599_0018398
543 Ga0495623_0005758
544 Ga0495646_0000991
545 Ga0495646_0044876
546 Ga0495669_0027964
547 Ga0495669_0049852
548 Ga0495613_0001212
549 Ga0495613_0014150
550 Ga0495613_0022734
551 Ga0495624_0000515
552 Ga0495671_0007660
553 Ga0495671_0045057
554 Ga0495589_0002185
555 Ga0495589_0018981
556 Ga0495600_0004545
557 Ga0495600_0022220
558 Ga0495600_0111799
559 Ga0495660_0038976
560 Ga0495581_0003614
561 Ga0495581_0004528
562 Ga0495581_0020020
563 Ga0495604_0000648
564 Ga0495604_0057932
565 Ga0495674_0006527
566 Ga0495674_0042860
567 Ga0495676_0026217
568 Ga0495680_0046844
569 Ga0495683_0020242
570 Ga0495687_000592
571 Ga0495675_0024396
572 Ga0495679_002908
573 Ga0495673_0006145
574 Ga0495681_0030734
575 Ga0495686_0000042
576 Ga0495593_0028793
577 Ga0495602_0066902
578 Ga0495602_0085945
579 Ga0495614_0000490
580 Ga0495614_0002748
581 Ga0495626_0025545
582 Ga0496100_0050604
583 Ga0496101_0008834
584 Ga0496101_0084635
585 Ga0496102_0001994
586 Ga0496103_0009752
587 Ga0496104_0013565
588 Ga0496105_0003515
589 Ga0496106_0030611
590 Ga0496112_0014888
591 Ga0496113_0009790
592 Ga0496114_0002864
593 Ga0496115_0051734
594 Ga0496115_0085413
595 Ga0496117_0002771
596 Ga0496118_0000553
597 Ga0496121_0051921
598 Ga0496122_0085621
599 Ga0496123_0108301
600 Ga0496124_0000024
601 Ga0496126_0000995
602 Ga0501036_0089664
603 nmdc:mga0yw44_14730_c1
604 Ga0500560_015764
605 Ga0500658_0018066
606 Ga0500573_0043417
607 Ga0500604_0002313
608 Ga0500636_0004651
609 2501073823
610 2501077590
611 2501084690
612 2508726109
613 2511091344
614 2511092447
615 2511105518
616 2511186915
617 2513558617
618 2513565886
619 2513721365
620 2513961232
621 2514047573
622 2524438852
623 2545678482
624 2586061680
625 2599717802
626 2643978780
627 2687578812
628 2723879743
629 2738820510
630 2738832990
631 2738874517
632 2739186147
633 2739221115
634 2745074671
635 2809036463
636 2809590313
637 2842779203
638 2866618824
639 2904486062
640 2904621986
641 2917704915
642 2919527406
643 2920761846
644 2941502233
645 2945938709
646 2990708708
647 2997455016
648 641643162
649 642420855
650 643601326
651 8003318158
652 8003961580
653 8045868061
654 8054008959
655 8055305813
656 8057535787

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07687

M20_dimer

Peptidase dimerisation domain

242

396

0.95

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

129

493

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pok-assembly1.cif.gz_B crystal structure of a m20 family metallo peptidase from streptococcus pneumoniae 0.8618 8 448
4ppz-assembly1.cif.gz_A crystal structure of zinc-bound succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 0.8537 18 448
4ppz-assembly1.cif.gz_A crystal structure of zinc-bound succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 0.8452 18 448
1vgy-assembly1.cif.gz_B crystal structure of succinyl diaminopimelate desuccinylase 0.8408 18 448
4mmo-assembly1.cif.gz_A the crystal structure of a m20 family metallo-carboxypeptidase sso-cp2 from sulfolobus solfataricus 0.8361 20 449
ID Description Score Start End Superfamily
4mmoA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8875 20 449 3.40.630.10
4mmoA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.869 20 449 3.40.630.10
4ruhA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8661 6 449 3.40.630.10
4ruhA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8466 6 449 3.40.630.10
2pokB01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8442 8 448 3.40.630.10
ID Description Score Start End GO Terms
AF-A0A3M3F9Q2-F1-model_v4 deleted 0.987 116 449
AF-A0A0Q4VZM1-F1-model_v4 deleted 0.9858 3 449
AF-A0A0S6UPA1-F1-model_v4 Hypothetical 98.1 kDa Trp-Asp repeats containing protein in PAF1-MRPL27 intergenic region 0.9857 2 451 GO:0016787
AF-A0A5P6P3C7-F1-model_v4 M20 family metallopeptidase 0.9855 3 451 GO:0016787
AF-A0A0P9HU39-F1-model_v4 deleted 0.983 202 449

Map