F408062

General Info

Members Datasets Scaffolds Average Seq Length
325 178 302 259

Family's Representative Sequence

Representative Sequence 3300053090|Ga0500646_0003119|Ga0500646_0003119_1884_2753
Length 289
Sequence VETSKKNMKMIRFFALTSFLVISVFSLSACMGQDRDTLDKAEGKGFAVLELFTSEGCSSCPPADELLARIQTEAAGKNVYLLAYHVDYWDRQGWKDAFSNADYSRRQAQYGSWLNTPQIYTPQLIVNGQSEFVGSDEAAIRYAILEQLVINTPVTLILKAHRDGEKLVIQYQSTGAKKGNDLLIAIIQKEAQSNVTRGENTGRSLSHVQIVSKLQVEPLSTTGNGNTIITLPKGFDTKNWEIVGLIQDHRNGKISAASKADLNTGVVTLNNKTITFIVPELKDVDTLYE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
3 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
4 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
5 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
6 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
7 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
8 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
9 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
10 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
11 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
12 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
13 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
14 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
15 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
16 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
17 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
18 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
19 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
20 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
21 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
22 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
23 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
24 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
25 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
26 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
27 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
28 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
29 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
30 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
31 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
32 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
33 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
94 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
139 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
140 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
141 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
142 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
143 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
144 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
145 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
146 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
147 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
148 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
149 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
150 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
151 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
152 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
153 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
154 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
155 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
156 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
157 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
158 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
159 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
160 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
161 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
162 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
163 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
164 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
165 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
166 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
167 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
168 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
169 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
170 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
171 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
172 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
173 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
174 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
175 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
176 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
177 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
178 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.92
Metatranscriptomes 0
Isolates 7.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.38
Nodule 0
Rhizoplane 0.31
Rhizosphere 92
Stem 0
Stem Tuber 0
Unclassified 4.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1000995 2162886007 Bacteria 2556
2 SwRhRL2b_contig_2122642 2162886007 Bacteria 2312
3 JGI24736J21556_1002422 3300001904 Bacteria 3295
4 JGI24737J22298_10007087 3300001990 Unclassified 3799
5 JGI24743J22301_10026630 3300001991 Unclassified 1126
6 rootH1_10191791 3300003316 Bacteria 1701
7 rootH2_10139716 3300003320 Bacteria 5028
8 rootL2_10129401 3300003322 Bacteria 4593
9 rootL2_10290614 3300003322 Bacteria 1834
10 Ga0065714_10019406 3300005288 Bacteria 1354
11 Ga0065714_10075728 3300005288 Bacteria 2867
12 Ga0065704_10074051 3300005289 Bacteria 6575
13 Ga0065704_10075544 3300005289 Bacteria 5529
14 Ga0070683_100000055 3300005329 Bacteria 86882
15 Ga0070683_100011836 3300005329 Bacteria 7559
16 Ga0070683_100070039 3300005329 Bacteria 3271
17 Ga0070670_100003996 3300005331 Bacteria 12311
18 Ga0068869_100003494 3300005334 Bacteria 9625
19 Ga0070666_10068029 3300005335 Bacteria 2419
20 Ga0070682_100053520 3300005337 Bacteria 2530
21 Ga0068868_100000946 3300005338 Bacteria 19740
22 Ga0068868_100341592 3300005338 Bacteria 1280
23 Ga0070660_100107948 3300005339 Bacteria 2212
24 Ga0070661_100002410 3300005344 Bacteria 12821
25 Ga0070661_100017895 3300005344 Bacteria 5032
26 Ga0070661_100066508 3300005344 Bacteria 2648
27 Ga0070668_100014210 3300005347 Bacteria 5948
28 Ga0070671_100000919 3300005355 Bacteria 21487
29 Ga0070673_100475220 3300005364 Unclassified 1127
30 Ga0070659_100030155 3300005366 Bacteria 4196
31 Ga0070659_100393933 3300005366 Bacteria 1168
32 Ga0070667_100000566 3300005367 Bacteria 36566
33 Ga0070667_100110565 3300005367 Bacteria 2382
34 Ga0070663_100040389 3300005455 Bacteria 3266
35 Ga0070662_100000003 3300005457 Bacteria 239813
36 Ga0070684_100000662 3300005535 Bacteria 23780
37 Ga0070684_100016379 3300005535 Bacteria 6057
38 Ga0070684_100071125 3300005535 Bacteria 3062
39 Ga0070684_100201668 3300005535 Bacteria 1812
40 Ga0070684_100350304 3300005535 Bacteria 1358
41 Ga0068853_100000135 3300005539 Bacteria 50106
42 Ga0068853_100003275 3300005539 Bacteria 12383
43 Ga0068853_100017796 3300005539 Bacteria 5868
44 Ga0068853_100048261 3300005539 Bacteria 3657
45 Ga0068853_100068893 3300005539 Bacteria 3077
46 Ga0068853_100290447 3300005539 Bacteria 1509
47 Ga0070672_100189852 3300005543 Bacteria 1715
48 Ga0070665_100000178 3300005548 Bacteria 113002
49 Ga0070665_100039231 3300005548 Bacteria 4763
50 Ga0070665_100392684 3300005548 Bacteria 1395
51 Ga0068855_100000842 3300005563 Bacteria 37998
52 Ga0068855_100001850 3300005563 Bacteria 26318
53 Ga0068855_100076745 3300005563 Unclassified 3877
54 Ga0070664_100013943 3300005564 Bacteria 6553
55 Ga0070664_100075589 3300005564 Bacteria 2893
56 Ga0070664_100422635 3300005564 Bacteria 1221
57 Ga0068857_100000243 3300005577 Bacteria 36451
58 Ga0068857_100021888 3300005577 Bacteria 5626
59 Ga0068857_100046629 3300005577 Bacteria 3846
60 Ga0068857_100082242 3300005577 Bacteria 2876
61 Ga0068857_100199346 3300005577 Unclassified 1824
62 Ga0068854_100178065 3300005578 Bacteria 1659
63 Ga0068854_100181659 3300005578 Unclassified 1644
64 Ga0068856_100001360 3300005614 Bacteria 25702
65 Ga0068856_100005774 3300005614 Bacteria 12195
66 Ga0068856_100007686 3300005614 Bacteria 10518
67 Ga0068856_100381087 3300005614 Bacteria 1429
68 Ga0068852_100000054 3300005616 Bacteria 78608
69 Ga0068852_100001090 3300005616 Bacteria 17917
70 Ga0068852_100023568 3300005616 Bacteria 4957
71 Ga0068852_100072289 3300005616 Bacteria 3031
72 Ga0068859_100004590 3300005617 Bacteria 14089
73 Ga0068859_100033361 3300005617 Bacteria 5169
74 Ga0068864_100000912 3300005618 Bacteria 24810
75 Ga0068851_10002673 3300005834 Bacteria 7856
76 Ga0068851_10021266 3300005834 Unclassified 3150
77 Ga0068851_10058967 3300005834 Bacteria 1963
78 Ga0068851_10110911 3300005834 Bacteria 1464
79 Ga0068851_10129587 3300005834 Bacteria 1363
80 Ga0068863_100000681 3300005841 Bacteria 34370
81 Ga0068858_100001479 3300005842 Bacteria 24177
82 Ga0068858_100002665 3300005842 Bacteria 17956
83 Ga0068858_100224133 3300005842 Bacteria 1781
84 Ga0068860_100000031 3300005843 Bacteria 255068
85 Ga0068860_100001075 3300005843 Bacteria 30099
86 Ga0070716_100000862 3300006173 Bacteria 13071
87 Ga0097621_100000168 3300006237 Bacteria 41208
88 Ga0097621_100041997 3300006237 Bacteria 3683
89 Ga0068871_100003582 3300006358 Bacteria 10675
90 Ga0068871_100055443 3300006358 Bacteria 3217
91 Ga0097620_100004589 3300006931 Bacteria 14089
92 Ga0097620_100033361 3300006931 Bacteria 5169
93 Ga0105240_10000116 3300009093 Bacteria 165524
94 Ga0105240_10000171 3300009093 Bacteria 132604
95 Ga0105240_10001569 3300009093 Bacteria 38745
96 Ga0105240_10006077 3300009093 Bacteria 17834
97 Ga0105240_10037465 3300009093 Bacteria 6233
98 Ga0105240_10040545 3300009093 Bacteria 5954
99 Ga0105240_10048253 3300009093 Bacteria 5383
100 Ga0105245_10000297 3300009098 Bacteria 47567
101 Ga0105247_10001010 3300009101 Bacteria 21268
102 Ga0105247_10061815 3300009101 Bacteria 2322
103 Ga0105243_10003425 3300009148 Bacteria 12847
104 Ga0105241_10000061 3300009174 Bacteria 83048
105 Ga0105241_10000380 3300009174 Bacteria 33883
106 Ga0105241_10000817 3300009174 Bacteria 23652
107 Ga0105241_10111439 3300009174 Unclassified 2191
108 Ga0105242_10139596 3300009176 Unclassified 2101
109 Ga0105248_10000912 3300009177 Bacteria 32929
110 Ga0105248_10198748 3300009177 Bacteria 2259
111 Ga0105248_10550479 3300009177 Unclassified 1302
112 Ga0105237_10001729 3300009545 Bacteria 28215
113 Ga0105237_10011257 3300009545 Bacteria 9465
114 Ga0105238_10000024 3300009551 Bacteria 196322
115 Ga0105238_10002766 3300009551 Bacteria 17508
116 Ga0105238_10016606 3300009551 Bacteria 7454
117 Ga0105238_10099536 3300009551 Bacteria 2890
118 Ga0105249_10323998 3300009553 Bacteria 1553
119 Ga0105239_10004815 3300010375 Bacteria 16004
120 Ga0105239_10004983 3300010375 Bacteria 15681
121 Ga0105239_10006380 3300010375 Bacteria 13700
122 Ga0105239_10065220 3300010375 Unclassified 3999
123 Ga0105239_10183003 3300010375 Bacteria 2344
124 Ga0105246_10000176 3300011119 Bacteria 31076
125 Ga0105246_10020904 3300011119 Bacteria 4203
126 Ga0157373_10035793 3300013100 Bacteria 3563
127 Ga0157371_10002388 3300013102 Bacteria 17967
128 Ga0157370_10000019 3300013104 Bacteria 167473
129 Ga0157370_10024909 3300013104 Bacteria 5923
130 Ga0157369_10000004 3300013105 Bacteria 479764
131 Ga0157369_10000081 3300013105 Bacteria 132630
132 Ga0157369_10003300 3300013105 Bacteria 19193
133 Ga0157369_10003828 3300013105 Bacteria 17872
134 Ga0157369_10007578 3300013105 Bacteria 12491
135 Ga0157369_10019671 3300013105 Bacteria 7556
136 Ga0157369_10071858 3300013105 Bacteria 3713
137 Ga0157374_10001083 3300013296 Bacteria 23561
138 Ga0157374_10003055 3300013296 Bacteria 14034
139 Ga0157374_10019376 3300013296 Bacteria 6022
140 Ga0157374_10095842 3300013296 Bacteria 2838
141 Ga0157374_10118093 3300013296 Bacteria 2557
142 Ga0157378_10003811 3300013297 Bacteria 13345
143 Ga0157378_10005840 3300013297 Bacteria 10790
144 Ga0157378_10045573 3300013297 Unclassified 3897
145 Ga0157378_10120901 3300013297 Bacteria 2414
146 Ga0163162_10000008 3300013306 Bacteria 316194
147 Ga0163162_10273766 3300013306 Bacteria 1820
148 Ga0163162_10288136 3300013306 Bacteria 1774
149 Ga0157372_10000009 3300013307 Bacteria 302051
150 Ga0157372_10000058 3300013307 Bacteria 125647
151 Ga0157372_10018946 3300013307 Bacteria 7406
152 Ga0157372_10036240 3300013307 Bacteria 5436
153 Ga0157372_10050827 3300013307 Bacteria 4611
154 Ga0157372_10287357 3300013307 Bacteria 1912
155 Ga0157372_10612466 3300013307 Bacteria 1269
156 Ga0157372_10639477 3300013307 Bacteria 1239
157 Ga0157375_10005041 3300013308 Bacteria 11472
158 Ga0157375_10170488 3300013308 Bacteria 2324
159 Ga0157375_10172867 3300013308 Bacteria 2309
160 Ga0163163_10000435 3300014325 Bacteria 38174
161 Ga0157377_10020861 3300014745 Bacteria 3438
162 Ga0157379_10000362 3300014968 Bacteria 36426
163 Ga0157379_10007535 3300014968 Bacteria 9421
164 Ga0157376_10000277 3300014969 Bacteria 34809
165 Ga0157376_10104686 3300014969 Unclassified 2480
166 Ga0157376_10133312 3300014969 Bacteria 2220
167 Ga0157376_10309218 3300014969 Bacteria 1499
168 Ga0157376_10488909 3300014969 Bacteria 1207
169 Ga0182006_1000012 3300015261 Bacteria 394239
170 Ga0182006_1000434 3300015261 Bacteria 33365
171 Ga0182007_10000006 3300015262 Bacteria 427355
172 Ga0182007_10043253 3300015262 Bacteria 1497
173 Ga0207656_10089242 3300025321 Bacteria 1397
174 Ga0207710_10000747 3300025900 Bacteria 17957
175 Ga0207710_10157180 3300025900 Bacteria 1105
176 Ga0207647_10000049 3300025904 Bacteria 88392
177 Ga0207647_10098605 3300025904 Bacteria 1736
178 Ga0207654_10000024 3300025911 Bacteria 147501
179 Ga0207654_10000109 3300025911 Bacteria 54718
180 Ga0207654_10000960 3300025911 Bacteria 15823
181 Ga0207707_10167102 3300025912 Bacteria 1923
182 Ga0207695_10000075 3300025913 Bacteria 308496
183 Ga0207695_10000115 3300025913 Bacteria 240394
184 Ga0207695_10000466 3300025913 Bacteria 87899
185 Ga0207695_10004075 3300025913 Bacteria 20092
186 Ga0207695_10006474 3300025913 Bacteria 15201
187 Ga0207695_10020313 3300025913 Bacteria 7611
188 Ga0207695_10053907 3300025913 Bacteria 4203
189 Ga0207695_10222804 3300025913 Bacteria 1793
190 Ga0207671_10000032 3300025914 Bacteria 245878
191 Ga0207671_10000403 3300025914 Bacteria 60340
192 Ga0207657_10112515 3300025919 Bacteria 2246
193 Ga0207649_10002148 3300025920 Bacteria 11153
194 Ga0207649_10004254 3300025920 Bacteria 7796
195 Ga0207649_10032615 3300025920 Bacteria 3107
196 Ga0207694_10000024 3300025924 Bacteria 259443
197 Ga0207694_10000098 3300025924 Bacteria 96679
198 Ga0207694_10026602 3300025924 Bacteria 4403
199 Ga0207694_10133103 3300025924 Bacteria 1994
200 Ga0207650_10003312 3300025925 Bacteria 11088
201 Ga0207687_10000172 3300025927 Bacteria 42739
202 Ga0207644_10000798 3300025931 Bacteria 19950
203 Ga0207690_10033400 3300025932 Bacteria 3308
204 Ga0207690_10112594 3300025932 Unclassified 1963
205 Ga0207706_10000111 3300025933 Bacteria 87282
206 Ga0207709_10002381 3300025935 Bacteria 11855
207 Ga0207665_10000343 3300025939 Bacteria 32318
208 Ga0207691_10163054 3300025940 Bacteria 1954
209 Ga0207711_10074827 3300025941 Bacteria 2946
210 Ga0207689_10007365 3300025942 Bacteria 9648
211 Ga0207661_10000058 3300025944 Bacteria 83169
212 Ga0207661_10046260 3300025944 Bacteria 3450
213 Ga0207661_10056098 3300025944 Bacteria 3162
214 Ga0207679_10001619 3300025945 Bacteria 14028
215 Ga0207679_10340381 3300025945 Bacteria 1304
216 Ga0207667_10003482 3300025949 Bacteria 19433
217 Ga0207667_10043623 3300025949 Unclassified 4758
218 Ga0207667_10061653 3300025949 Bacteria 3923
219 Ga0207651_10473639 3300025960 Unclassified 1078
220 Ga0207712_10215933 3300025961 Bacteria 1530
221 Ga0207712_10334031 3300025961 Bacteria 1255
222 Ga0207668_10000674 3300025972 Bacteria 20969
223 Ga0207640_10068304 3300025981 Bacteria 2381
224 Ga0207640_10341580 3300025981 Bacteria 1199
225 Ga0207640_10792742 3300025981 Unclassified 820
226 Ga0207658_10000041 3300025986 Bacteria 138200
227 Ga0207658_10096611 3300025986 Bacteria 2304
228 Ga0207677_10000063 3300026023 Bacteria 89531
229 Ga0207677_10315569 3300026023 Bacteria 1297
230 Ga0207703_10001322 3300026035 Bacteria 22771
231 Ga0207639_10000039 3300026041 Bacteria 143047
232 Ga0207639_10013258 3300026041 Bacteria 5763
233 Ga0207639_10070502 3300026041 Unclassified 2730
234 Ga0207678_10043163 3300026067 Bacteria 3903
235 Ga0207702_10000457 3300026078 Bacteria 46125
236 Ga0207702_10003584 3300026078 Bacteria 14109
237 Ga0207702_10223250 3300026078 Bacteria 1756
238 Ga0207641_10002855 3300026088 Bacteria 15698
239 Ga0207676_10001989 3300026095 Bacteria 14882
240 Ga0207676_10580207 3300026095 Bacteria 1075
241 Ga0207674_10001042 3300026116 Bacteria 36044
242 Ga0207674_10001513 3300026116 Bacteria 29993
243 Ga0207674_10006654 3300026116 Bacteria 13576
244 Ga0207698_10000011 3300026142 Bacteria 260352
245 Ga0207698_10000650 3300026142 Bacteria 20114
246 Ga0207698_10491731 3300026142 Bacteria 1192
247 Ga0268266_10000098 3300028379 Bacteria 182784
248 Ga0268266_10063289 3300028379 Bacteria 3193
249 Ga0268266_10108699 3300028379 Bacteria 2454
250 Ga0268266_10163233 3300028379 Bacteria 2017
251 Ga0268264_10000362 3300028381 Bacteria 67431
252 Ga0307405_10000002 3300031731 Bacteria 575196
253 Ga0307405_10000012 3300031731 Bacteria 233774
254 Ga0307406_10006848 3300031901 Bacteria 6310
255 Ga0307407_10000014 3300031903 Bacteria 156064
256 Ga0307416_100000007 3300032002 Bacteria 433284
257 Ga0395899_0000220 3300037312 Bacteria 78900
258 Ga0439466_0034067 3300041411 Bacteria 1728
259 Ga0439465_0001390 3300041413 Bacteria 7812
260 Ga0451789_1196182 3300041443 Bacteria 1424
261 Ga0451841_0600283 3300041498 Bacteria 2574
262 Ga0451851_0454410 3300041507 Bacteria 1139
263 Ga0466969_0009231 3300044656 Bacteria 5230
264 Ga0466972_0000002 3300044658 Bacteria 408005
265 Ga0466961_0017203 3300044693 Bacteria 4645
266 Ga0466970_0001775 3300044765 Bacteria 10400
267 Ga0466960_0034348 3300044901 Bacteria 2363
268 Ga0466959_0094098 3300045049 Unclassified 2150
269 Ga0495627_000002 3300046453 Bacteria 903861
270 Ga0495610_0000009 3300046512 Bacteria 554843
271 Ga0495628_0236520 3300046516 Unclassified 1368
272 Ga0495643_0001026 3300046522 Bacteria 28462
273 Ga0495654_0000001 3300046530 Bacteria 1513197
274 Ga0495645_0030896 3300046543 Bacteria 3902
275 Ga0495633_0000894 3300046558 Bacteria 25504
276 Ga0495625_0000486 3300046660 Bacteria 59478
277 Ga0495625_0000899 3300046660 Bacteria 40086
278 Ga0495625_0009344 3300046660 Bacteria 8213
279 Ga0495661_0003541 3300046665 Bacteria 11508
280 Ga0495599_0056956 3300046678 Unclassified 2446
281 Ga0495681_0114223 3300047470 Unclassified 1165
282 Ga0495686_0000086 3300047472 Bacteria 197490
283 Ga0495686_0012370 3300047472 Bacteria 5972
284 Ga0495686_0105921 3300047472 Bacteria 1691
285 Ga0496122_0000159 3300048925 Bacteria 159297
286 Ga0496123_0026291 3300048926 Bacteria 4363
287 Ga0496126_0130929 3300048929 Bacteria 2168
288 Ga0501217_023718 3300049661 Bacteria 1463
289 Ga0501247_000112 3300049677 Bacteria 4628
290 Ga0501249_004896 3300049679 Bacteria 2731
291 Ga0501269_000185 3300049766 Bacteria 19129
292 nmdc:mga0k408_22_c2 3300050493 Bacteria 93033
293 Ga0500644_0000222 3300053088 Bacteria 32776
294 Ga0500646_0003119 3300053090 Bacteria 4252
295 Ga0500646_0029687 3300053090 Bacteria 1498
296 Ga0500583_0000214 3300053092 Bacteria 21581
297 Ga0500642_0056505 3300053130 Unclassified 1749
298 Ga0500658_0003301 3300053134 Bacteria 6124
299 Ga0500577_0003007 3300053142 Bacteria 4349
300 Ga0500627_0004625 3300053158 Bacteria 4451
301 Ga0500633_0086319 3300053160 Unclassified 1141
302 Ga0500636_0074010 3300053177 Bacteria 1972

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003316 rootH1_10191791 rootH1_101917911 205
2 3300026095 Ga0207676_10580207 Ga0207676_105802071 206
3 3300009551 Ga0105238_10016606 Ga0105238_100166061 210
4 3300010375 Ga0105239_10065220 Ga0105239_100652204 210
5 3300013105 Ga0157369_10007578 Ga0157369_100075782 210
6 3300013307 Ga0157372_10018946 Ga0157372_100189461 210
7 3300005834 Ga0068851_10129587 Ga0068851_101295872 227
8 3300009101 Ga0105247_10061815 Ga0105247_100618152 227
9 3300010375 Ga0105239_10004815 Ga0105239_100048152 227
10 3300013296 Ga0157374_10118093 Ga0157374_101180932 227
11 3300013297 Ga0157378_10120901 Ga0157378_101209012 227
12 3300014969 Ga0157376_10488909 Ga0157376_104889092 227
13 3300025900 Ga0207710_10157180 Ga0207710_101571801 227
14 3300025941 Ga0207711_10074827 Ga0207711_100748272 227
15 3300009177 Ga0105248_10198748 Ga0105248_101987483 229
16 3300046530 Ga0495654_0000001 Ga0495654_0000001_1270515_1271273 229
17 3300041443 Ga0451789_1196182 Ga0451789_1196182_414_1121 230
18 3300041413 Ga0439465_0001390 Ga0439465_0001390_26_751 231
19 3300005337 Ga0070682_100053520 Ga0070682_1000535202 232
20 3300005329 Ga0070683_100011836 Ga0070683_1000118362 233
21 3300005339 Ga0070660_100107948 Ga0070660_1001079481 233
22 3300005344 Ga0070661_100017895 Ga0070661_1000178955 233
23 3300005366 Ga0070659_100393933 Ga0070659_1003939332 233
24 3300005535 Ga0070684_100000662 Ga0070684_10000066215 233
25 3300005539 Ga0068853_100017796 Ga0068853_1000177963 233
26 3300005564 Ga0070664_100013943 Ga0070664_1000139433 233
27 3300005577 Ga0068857_100021888 Ga0068857_1000218883 233
28 3300005578 Ga0068854_100178065 Ga0068854_1001780652 233
29 3300025919 Ga0207657_10112515 Ga0207657_101125151 233
30 3300025920 Ga0207649_10004254 Ga0207649_100042548 233
31 3300025932 Ga0207690_10033400 Ga0207690_100334002 233
32 3300025944 Ga0207661_10046260 Ga0207661_100462603 233
33 3300025945 Ga0207679_10001619 Ga0207679_100016197 233
34 3300026041 Ga0207639_10013258 Ga0207639_100132585 233
35 3300026116 Ga0207674_10006654 Ga0207674_1000665412 233
36 3300046665 Ga0495661_0003541 Ga0495661_0003541_992_1747 233
37 3300013296 Ga0157374_10001083 Ga0157374_100010838 234
38 3300046516 Ga0495628_0236520 Ga0495628_0236520_326_1102 234
39 3300046543 Ga0495645_0030896 Ga0495645_0030896_2430_3206 234
40 3300046678 Ga0495599_0056956 Ga0495599_0056956_454_1230 234
41 3300047472 Ga0495686_0105921 Ga0495686_0105921_235_1062 234
42 3300005329 Ga0070683_100070039 Ga0070683_1000700392 235
43 3300005535 Ga0070684_100071125 Ga0070684_1000711252 235
44 3300005548 Ga0070665_100039231 Ga0070665_1000392312 235
45 3300005614 Ga0068856_100005774 Ga0068856_1000057749 235
46 3300005617 Ga0068859_100033361 Ga0068859_1000333614 235
47 3300006358 Ga0068871_100055443 Ga0068871_1000554432 235
48 3300006931 Ga0097620_100033361 Ga0097620_1000333614 235
49 3300025913 Ga0207695_10000466 Ga0207695_1000046610 235
50 3300025961 Ga0207712_10334031 Ga0207712_103340312 235
51 3300028379 Ga0268266_10108699 Ga0268266_101086992 235
52 3300053092 Ga0500583_0000214 Ga0500583_0000214_18416_19168 235
53 3300053130 Ga0500642_0056505 Ga0500642_0056505_363_1115 235
54 3300006173 Ga0070716_100000862 Ga0070716_10000086213 236
55 3300013100 Ga0157373_10035793 Ga0157373_100357932 236
56 3300025939 Ga0207665_10000343 Ga0207665_1000034314 236
57 3300025981 Ga0207640_10341580 Ga0207640_103415802 236
58 3300001991 JGI24743J22301_10026630 JGI24743J22301_100266301 237
59 3300005329 Ga0070683_100000055 Ga0070683_10000005556 237
60 3300005331 Ga0070670_100003996 Ga0070670_1000039962 237
61 3300005334 Ga0068869_100003494 Ga0068869_1000034943 237
62 3300005335 Ga0070666_10068029 Ga0070666_100680293 237
63 3300005338 Ga0068868_100000946 Ga0068868_10000094611 237
64 3300005344 Ga0070661_100002410 Ga0070661_1000024109 237
65 3300005344 Ga0070661_100066508 Ga0070661_1000665081 237
66 3300005355 Ga0070671_100000919 Ga0070671_1000009197 237
67 3300005364 Ga0070673_100475220 Ga0070673_1004752202 237
68 3300005367 Ga0070667_100000566 Ga0070667_1000005661 237
69 3300005535 Ga0070684_100016379 Ga0070684_1000163797 237
70 3300005535 Ga0070684_100201668 Ga0070684_1002016682 237
71 3300005535 Ga0070684_100350304 Ga0070684_1003503041 237
72 3300005539 Ga0068853_100000135 Ga0068853_1000001352 237
73 3300005539 Ga0068853_100003275 Ga0068853_1000032758 237
74 3300005539 Ga0068853_100048261 Ga0068853_1000482612 237
75 3300005539 Ga0068853_100290447 Ga0068853_1002904472 237
76 3300005548 Ga0070665_100392684 Ga0070665_1003926842 237
77 3300005563 Ga0068855_100000842 Ga0068855_10000084228 237
78 3300005563 Ga0068855_100001850 Ga0068855_1000018506 237
79 3300005564 Ga0070664_100075589 Ga0070664_1000755892 237
80 3300005564 Ga0070664_100422635 Ga0070664_1004226352 237
81 3300005577 Ga0068857_100000243 Ga0068857_10000024313 237
82 3300005577 Ga0068857_100046629 Ga0068857_1000466294 237
83 3300005577 Ga0068857_100082242 Ga0068857_1000822421 237
84 3300005577 Ga0068857_100199346 Ga0068857_1001993461 237
85 3300005578 Ga0068854_100181659 Ga0068854_1001816592 237
86 3300005614 Ga0068856_100001360 Ga0068856_10000136013 237
87 3300005614 Ga0068856_100007686 Ga0068856_1000076866 237
88 3300005614 Ga0068856_100381087 Ga0068856_1003810872 237
89 3300005616 Ga0068852_100000054 Ga0068852_10000005431 237
90 3300005616 Ga0068852_100001090 Ga0068852_1000010909 237
91 3300005616 Ga0068852_100023568 Ga0068852_1000235685 237
92 3300005616 Ga0068852_100072289 Ga0068852_1000722892 237
93 3300005617 Ga0068859_100004590 Ga0068859_1000045906 237
94 3300005618 Ga0068864_100000912 Ga0068864_10000091214 237
95 3300005834 Ga0068851_10021266 Ga0068851_100212662 237
96 3300005834 Ga0068851_10058967 Ga0068851_100589672 237
97 3300005834 Ga0068851_10110911 Ga0068851_101109111 237
98 3300005841 Ga0068863_100000681 Ga0068863_1000006817 237
99 3300005842 Ga0068858_100001479 Ga0068858_1000014797 237
100 3300005843 Ga0068860_100000031 Ga0068860_100000031194 237
101 3300006237 Ga0097621_100000168 Ga0097621_1000001687 237
102 3300006358 Ga0068871_100003582 Ga0068871_1000035828 237
103 3300006931 Ga0097620_100004589 Ga0097620_1000045898 237
104 3300009093 Ga0105240_10000116 Ga0105240_1000011636 237
105 3300009093 Ga0105240_10000171 Ga0105240_1000017178 237
106 3300009093 Ga0105240_10006077 Ga0105240_1000607712 237
107 3300009093 Ga0105240_10040545 Ga0105240_100405454 237
108 3300009093 Ga0105240_10048253 Ga0105240_100482535 237
109 3300009098 Ga0105245_10000297 Ga0105245_1000029718 237
110 3300009101 Ga0105247_10001010 Ga0105247_100010107 237
111 3300009174 Ga0105241_10000061 Ga0105241_1000006158 237
112 3300009174 Ga0105241_10000380 Ga0105241_1000038020 237
113 3300009174 Ga0105241_10000817 Ga0105241_100008179 237
114 3300009174 Ga0105241_10111439 Ga0105241_101114392 237
115 3300009177 Ga0105248_10000912 Ga0105248_100009123 237
116 3300009545 Ga0105237_10001729 Ga0105237_100017295 237
117 3300009545 Ga0105237_10011257 Ga0105237_100112575 237
118 3300009551 Ga0105238_10000024 Ga0105238_10000024120 237
119 3300009551 Ga0105238_10002766 Ga0105238_100027667 237
120 3300009551 Ga0105238_10099536 Ga0105238_100995362 237
121 3300009553 Ga0105249_10323998 Ga0105249_103239981 237
122 3300010375 Ga0105239_10004983 Ga0105239_100049837 237
123 3300010375 Ga0105239_10006380 Ga0105239_100063809 237
124 3300011119 Ga0105246_10000176 Ga0105246_100001765 237
125 3300013104 Ga0157370_10000019 Ga0157370_1000001967 237
126 3300013105 Ga0157369_10000081 Ga0157369_1000008136 237
127 3300013105 Ga0157369_10003828 Ga0157369_100038288 237
128 3300013105 Ga0157369_10019671 Ga0157369_100196712 237
129 3300013105 Ga0157369_10071858 Ga0157369_100718582 237
130 3300013296 Ga0157374_10019376 Ga0157374_100193764 237
131 3300013297 Ga0157378_10003811 Ga0157378_100038115 237
132 3300013297 Ga0157378_10005840 Ga0157378_100058408 237
133 3300013307 Ga0157372_10000058 Ga0157372_1000005872 237
134 3300013307 Ga0157372_10050827 Ga0157372_100508273 237
135 3300013307 Ga0157372_10612466 Ga0157372_106124661 237
136 3300013307 Ga0157372_10639477 Ga0157372_106394771 237
137 3300013308 Ga0157375_10005041 Ga0157375_100050418 237
138 3300014325 Ga0163163_10000435 Ga0163163_1000043524 237
139 3300014968 Ga0157379_10000362 Ga0157379_100003628 237
140 3300014969 Ga0157376_10000277 Ga0157376_100002774 237
141 3300014969 Ga0157376_10104686 Ga0157376_101046862 237
142 3300014969 Ga0157376_10309218 Ga0157376_103092182 237
143 3300025321 Ga0207656_10089242 Ga0207656_100892422 237
144 3300025900 Ga0207710_10000747 Ga0207710_100007475 237
145 3300025904 Ga0207647_10098605 Ga0207647_100986052 237
146 3300025911 Ga0207654_10000024 Ga0207654_100000247 237
147 3300025911 Ga0207654_10000109 Ga0207654_1000010926 237
148 3300025911 Ga0207654_10000960 Ga0207654_100009608 237
149 3300025912 Ga0207707_10167102 Ga0207707_101671022 237
150 3300025913 Ga0207695_10000075 Ga0207695_1000007564 237
151 3300025913 Ga0207695_10000115 Ga0207695_10000115134 237
152 3300025913 Ga0207695_10004075 Ga0207695_100040759 237
153 3300025913 Ga0207695_10053907 Ga0207695_100539073 237
154 3300025913 Ga0207695_10222804 Ga0207695_102228041 237
155 3300025914 Ga0207671_10000032 Ga0207671_10000032145 237
156 3300025914 Ga0207671_10000403 Ga0207671_1000040339 237
157 3300025920 Ga0207649_10002148 Ga0207649_100021488 237
158 3300025920 Ga0207649_10032615 Ga0207649_100326151 237
159 3300025924 Ga0207694_10000024 Ga0207694_10000024176 237
160 3300025924 Ga0207694_10000098 Ga0207694_100000987 237
161 3300025924 Ga0207694_10026602 Ga0207694_100266022 237
162 3300025924 Ga0207694_10133103 Ga0207694_101331033 237
163 3300025925 Ga0207650_10003312 Ga0207650_100033128 237
164 3300025927 Ga0207687_10000172 Ga0207687_1000017215 237
165 3300025931 Ga0207644_10000798 Ga0207644_1000079810 237
166 3300025942 Ga0207689_10007365 Ga0207689_100073657 237
167 3300025944 Ga0207661_10000058 Ga0207661_1000005836 237
168 3300025944 Ga0207661_10056098 Ga0207661_100560982 237
169 3300025945 Ga0207679_10340381 Ga0207679_103403812 237
170 3300025949 Ga0207667_10003482 Ga0207667_100034827 237
171 3300025949 Ga0207667_10061653 Ga0207667_100616533 237
172 3300025960 Ga0207651_10473639 Ga0207651_104736391 237
173 3300025961 Ga0207712_10215933 Ga0207712_102159332 237
174 3300025981 Ga0207640_10068304 Ga0207640_100683042 237
175 3300025981 Ga0207640_10792742 Ga0207640_107927421 237
176 3300025986 Ga0207658_10000041 Ga0207658_1000004164 237
177 3300026023 Ga0207677_10000063 Ga0207677_1000006348 237
178 3300026035 Ga0207703_10001322 Ga0207703_100013226 237
179 3300026041 Ga0207639_10000039 Ga0207639_10000039111 237
180 3300026041 Ga0207639_10070502 Ga0207639_100705022 237
181 3300026078 Ga0207702_10000457 Ga0207702_1000045738 237
182 3300026078 Ga0207702_10003584 Ga0207702_1000358411 237
183 3300026078 Ga0207702_10223250 Ga0207702_102232502 237
184 3300026088 Ga0207641_10002855 Ga0207641_100028558 237
185 3300026095 Ga0207676_10001989 Ga0207676_1000198910 237
186 3300026116 Ga0207674_10001042 Ga0207674_100010421 237
187 3300026116 Ga0207674_10001513 Ga0207674_100015138 237
188 3300026142 Ga0207698_10000011 Ga0207698_10000011144 237
189 3300026142 Ga0207698_10000650 Ga0207698_100006508 237
190 3300026142 Ga0207698_10491731 Ga0207698_104917311 237
191 3300028379 Ga0268266_10163233 Ga0268266_101632332 237
192 3300028381 Ga0268264_10000362 Ga0268264_1000036236 237
193 3300048929 Ga0496126_0130929 Ga0496126_0130929_726_1505 237
194 3300031903 Ga0307407_10000014 Ga0307407_1000001464 239
195 3300032002 Ga0307416_100000007 Ga0307416_100000007124 239
196 3300047472 Ga0495686_0000086 Ga0495686_0000086_84458_85219 239
197 iso_pu_bacteria 2775506739 2775672521 239
198 iso_pu_bacteria 2842083920 2842085092 239
199 iso_pu_bacteria 2919097161 2919100661 239
200 3300001904 JGI24736J21556_1002422 JGI24736J21556_10024222 240
201 3300001990 JGI24737J22298_10007087 JGI24737J22298_100070876 240
202 3300005338 Ga0068868_100341592 Ga0068868_1003415921 240
203 3300005347 Ga0070668_100014210 Ga0070668_1000142107 240
204 3300005366 Ga0070659_100030155 Ga0070659_1000301555 240
205 3300005367 Ga0070667_100110565 Ga0070667_1001105654 240
206 3300005457 Ga0070662_100000003 Ga0070662_100000003204 240
207 3300005543 Ga0070672_100189852 Ga0070672_1001898521 240
208 3300005834 Ga0068851_10002673 Ga0068851_1000267311 240
209 3300005842 Ga0068858_100002665 Ga0068858_1000026653 240
210 3300005842 Ga0068858_100224133 Ga0068858_1002241332 240
211 3300009093 Ga0105240_10037465 Ga0105240_100374656 240
212 3300010375 Ga0105239_10183003 Ga0105239_101830032 240
213 3300011119 Ga0105246_10020904 Ga0105246_100209042 240
214 3300013296 Ga0157374_10003055 Ga0157374_100030556 240
215 3300013306 Ga0163162_10288136 Ga0163162_102881362 240
216 3300013307 Ga0157372_10036240 Ga0157372_100362405 240
217 3300014745 Ga0157377_10020861 Ga0157377_100208615 240
218 3300025904 Ga0207647_10000049 Ga0207647_1000004919 240
219 3300025913 Ga0207695_10006474 Ga0207695_100064743 240
220 3300025932 Ga0207690_10112594 Ga0207690_101125941 240
221 3300025933 Ga0207706_10000111 Ga0207706_1000011118 240
222 3300025972 Ga0207668_10000674 Ga0207668_100006744 240
223 3300025986 Ga0207658_10096611 Ga0207658_100966112 240
224 3300026023 Ga0207677_10315569 Ga0207677_103155692 240
225 3300028379 Ga0268266_10063289 Ga0268266_100632895 240
226 3300044658 Ga0466972_0000002 Ga0466972_0000002_262845_263615 240
227 3300044765 Ga0466970_0001775 Ga0466970_0001775_3797_4558 240
228 3300044901 Ga0466960_0034348 Ga0466960_0034348_121_882 240
229 3300053088 Ga0500644_0000222 Ga0500644_0000222_24364_25119 240
230 3300053160 Ga0500633_0086319 Ga0500633_0086319_83_838 240
231 iso_pu_bacteria 2511231000 2511231444 240
232 iso_pu_bacteria 2582581281 2585158852 240
233 iso_pu_bacteria 2582581282 2585163140 240
234 iso_pu_bacteria 2585428045 2587677667 240
235 iso_pu_bacteria 2585428060 2587746817 240
236 iso_pu_bacteria 2585428095 2587867967 240
237 iso_pu_bacteria 2585428187 2588233834 240
238 iso_pu_bacteria 2588253712 2588444951 240
239 iso_pu_bacteria 2588254255 2590604475 240
240 iso_pu_bacteria 2739367874 2740058385 240
241 iso_pu_bacteria 2929177148 2929181425 240
242 iso_pu_bacteria 2945977869 2945983832 240
243 iso_pu_bacteria 2946013367 2946016774 240
244 iso_pu_bacteria 2946019816 2946021940 240
245 3300005843 Ga0068860_100001075 Ga0068860_10000107512 241
246 3300006237 Ga0097621_100041997 Ga0097621_1000419975 241
247 3300013308 Ga0157375_10170488 Ga0157375_101704882 241
248 3300025940 Ga0207691_10163054 Ga0207691_101630542 241
249 3300053177 Ga0500636_0074010 Ga0500636_0074010_484_1233 241
250 iso_pu_bacteria 2842722452 2842725756 241
251 iso_pu_bacteria 2842909656 2842914953 241
252 iso_pu_bacteria 2852623160 2852624463 241
253 iso_pu_bacteria 2884933994 2884936668 241
254 iso_pu_bacteria 2945997725 2946001292 241
255 iso_pu_bacteria 2954016120 2954018189 241
256 3300005539 Ga0068853_100068893 Ga0068853_1000688934 242
257 3300005548 Ga0070665_100000178 Ga0070665_10000017857 242
258 3300005563 Ga0068855_100076745 Ga0068855_1000767454 242
259 3300015261 Ga0182006_1000012 Ga0182006_100001298 242
260 3300015262 Ga0182007_10043253 Ga0182007_100432532 242
261 3300025913 Ga0207695_10020313 Ga0207695_100203131 242
262 3300025949 Ga0207667_10043623 Ga0207667_100436234 242
263 3300028379 Ga0268266_10000098 Ga0268266_10000098101 242
264 3300046512 Ga0495610_0000009 Ga0495610_0000009_120109_120882 242
265 3300049766 Ga0501269_000185 Ga0501269_000185_10394_11164 242
266 3300053158 Ga0500627_0004625 Ga0500627_0004625_131_922 242
267 2162886007 SwRhRL2b_contig_2122642 SwRhRL2b_0679.00001740 243
268 3300003320 rootH2_10139716 rootH2_101397163 243
269 3300005289 Ga0065704_10075544 Ga0065704_100755443 243
270 3300005455 Ga0070663_100040389 Ga0070663_1000403892 243
271 3300009148 Ga0105243_10003425 Ga0105243_100034256 243
272 3300013102 Ga0157371_10002388 Ga0157371_100023888 243
273 3300013105 Ga0157369_10003300 Ga0157369_1000330016 243
274 3300013307 Ga0157372_10000009 Ga0157372_10000009195 243
275 3300025935 Ga0207709_10002381 Ga0207709_100023816 243
276 3300026067 Ga0207678_10043163 Ga0207678_100431632 243
277 3300037312 Ga0395899_0000220 Ga0395899_0000220_74069_74839 243
278 3300041411 Ga0439466_0034067 Ga0439466_0034067_823_1596 243
279 3300044656 Ga0466969_0009231 Ga0466969_0009231_2407_3177 243
280 3300044693 Ga0466961_0017203 Ga0466961_0017203_196_966 243
281 3300045049 Ga0466959_0094098 Ga0466959_0094098_1219_1989 243
282 3300046453 Ga0495627_000002 Ga0495627_000002_235511_236269 243
283 3300046558 Ga0495633_0000894 Ga0495633_0000894_4607_5380 243
284 3300046660 Ga0495625_0000899 Ga0495625_0000899_9615_10388 243
285 3300047472 Ga0495686_0012370 Ga0495686_0012370_4856_5614 243
286 3300048925 Ga0496122_0000159 Ga0496122_0000159_20809_21585 243
287 3300048926 Ga0496123_0026291 Ga0496123_0026291_2933_3709 243
288 3300003322 rootL2_10129401 rootL2_101294012 244
289 3300003322 rootL2_10290614 rootL2_102906142 244
290 3300005288 Ga0065714_10075728 Ga0065714_100757281 244
291 3300009177 Ga0105248_10550479 Ga0105248_105504792 244
292 3300013296 Ga0157374_10095842 Ga0157374_100958422 244
293 3300013297 Ga0157378_10045573 Ga0157378_100455733 244
294 3300013306 Ga0163162_10273766 Ga0163162_102737662 244
295 3300013308 Ga0157375_10172867 Ga0157375_101728673 244
296 3300014968 Ga0157379_10007535 Ga0157379_100075352 244
297 3300014969 Ga0157376_10133312 Ga0157376_101333122 244
298 3300005288 Ga0065714_10019406 Ga0065714_100194061 245
299 3300009093 Ga0105240_10001569 Ga0105240_1000156935 245
300 3300009176 Ga0105242_10139596 Ga0105242_101395962 245
301 3300013105 Ga0157369_10000004 Ga0157369_10000004341 245
302 3300013306 Ga0163162_10000008 Ga0163162_10000008223 245
303 3300013307 Ga0157372_10287357 Ga0157372_102873572 245
304 3300015261 Ga0182006_1000434 Ga0182006_100043411 245
305 3300015262 Ga0182007_10000006 Ga0182007_10000006132 245
306 3300031731 Ga0307405_10000012 Ga0307405_10000012150 245
307 3300041498 Ga0451841_0600283 Ga0451841_0600283_1328_2116 245
308 3300041507 Ga0451851_0454410 Ga0451851_0454410_145_933 245
309 3300049661 Ga0501217_023718 Ga0501217_023718_520_1311 245
310 3300049677 Ga0501247_000112 Ga0501247_000112_3594_4385 245
311 3300049679 Ga0501249_004896 Ga0501249_004896_447_1304 245
312 2162886007 SwRhRL2b_contig_1000995 SwRhRL2b_0333.00000260 246
313 3300005289 Ga0065704_10074051 Ga0065704_100740512 246
314 3300013104 Ga0157370_10024909 Ga0157370_100249097 246
315 3300031731 Ga0307405_10000002 Ga0307405_10000002151 246
316 3300031901 Ga0307406_10006848 Ga0307406_100068483 246
317 3300046522 Ga0495643_0001026 Ga0495643_0001026_18793_19551 246
318 3300046660 Ga0495625_0000486 Ga0495625_0000486_8024_8806 246
319 3300046660 Ga0495625_0009344 Ga0495625_0009344_6539_7297 246
320 3300047470 Ga0495681_0114223 Ga0495681_0114223_43_846 246
321 3300050493 nmdc:mga0k408_22_c2 nmdc:mga0k408_22_c2_25026_25805 246
322 3300053090 Ga0500646_0003119 Ga0500646_0003119_1884_2753 246
323 3300053090 Ga0500646_0029687 Ga0500646_0029687_193_951 246
324 3300053134 Ga0500658_0003301 Ga0500658_0003301_824_1693 246
325 3300053142 Ga0500577_0003007 Ga0500577_0003007_1797_2666 246

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06764

DUF1223

Protein of unknown function (DUF1223)

48

247

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5l71-assembly1.cif.gz_A crystal structure of mouse phospholipid hydroperoxide glutathione peroxidase 4 (gpx4) 0.8456 29 73
7u4m-assembly1.cif.gz_A crystal structure of human gpx4-u46c in complex with loc1886 0.8339 31 77
4fo5-assembly1.cif.gz_A crystal structure of a thioredoxin-like protein (bdi_1100) from parabacteroides distasonis atcc 8503 at 2.02 a resolution 0.8115 30 70
7u4k-assembly1.cif.gz_A crystal structure of human gpx4-u46c-r152h in complex with ml162 0.8089 29 77
7l8m-assembly1.cif.gz_A crystal structure of human gpx4-u46c mutant k48l 0.808 29 77
ID Description Score Start End Superfamily
af_I1LUV6_45_256_2.60.40.640 Mainly Beta;Sandwich;Immunoglobulin-like; 0.858 34 231 2.60.40.640
af_Q6Z402_152_270_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8331 139 243 2.60.40.10
af_I1LUV6_45_256_2.60.40.640 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8008 34 231 2.60.40.640
af_Q9XIF4_4_128_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7976 30 131 3.40.30.10
af_Q9TW67_1_111_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7926 31 132 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A1H4B4L2-F1-model_v4 DUF1223 domain-containing protein 0.9762 23 245
AF-A0A4Q1EPF3-F1-model_v4 DUF1223 domain-containing protein 0.9752 29 243
AF-A0A7G8VA35-F1-model_v4 DUF1223 domain-containing protein 0.9709 27 243
AF-A0A847RZY6-F1-model_v4 DUF1223 domain-containing protein 0.9599 29 246 GO:0016020
AF-A0A1H7GFY4-F1-model_v4 DUF1223 domain-containing protein 0.9597 28 243 GO:0016020

Feature Viewer

pLDDT pTM Quality
88.67 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map