F407939

General Info

Members Datasets Scaffolds Average Seq Length
325 179 650 324

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_1700788|Ga0436365_1700788_18370_19530
Length 352
Sequence VNLMQSIPIPNVSLPVPFSPEQASTFAPHVDALYVYLVTLTAFLTLAVSAAIVFFAVKYRRRQPDELPRPIAGSMVLELTWTIIPLMVAMTIFIWGASIYFKAYRAPQQAMEVYVVAKQWMWKFQHQTGQREINELHIPVGARVKLTMTTEDVIHSFYVPAFRIKQDVVPGRYLQTWFEATKTGKFYLFCAEYCGTNHSGMGGYIYVMEPAAYQQWLAGGSGAESAASQGQKLFQQRGCASCHQVEAGGQQGRGPTLYGIFGRQQQIEGDGAVTVDESYIRESILNPQAKTAAGFQNIMPTFQGQLSEEQILQLVAYVRSLAPAGQQPGRSNPLAPTGERQGSPAPNANRRP

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
87 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
88 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
126 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
127 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
136 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
137 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
138 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
139 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
141 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
142 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
147 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
148 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
152 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
153 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
154 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
155 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
156 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
157 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
158 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
159 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
160 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
171 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
174 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
175 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
176 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
177 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
178 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
179 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.77
Metatranscriptomes 1.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.31
Rhizosphere 88.92
Stem 0
Stem Tuber 0
Unclassified 7.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_1700788 3300039437 Bacteria 98783
2 rootH1_10117781 3300003323 Unclassified 1876
3 rootH1_10138313 3300003323 Bacteria 2379
4 Ga0065715_10103343 3300005293 Bacteria 3040
5 Ga0070683_100288574 3300005329 Bacteria 1561
6 Ga0068869_100006216 3300005334 Bacteria 7561
7 Ga0070680_100004696 3300005336 Bacteria 10276
8 Ga0070680_100113959 3300005336 Bacteria 2252
9 Ga0070682_100005135 3300005337 Bacteria 7283
10 Ga0070682_100044976 3300005337 Bacteria 2735
11 Ga0068868_100016845 3300005338 Bacteria 5436
12 Ga0068868_100026406 3300005338 Bacteria 4425
13 Ga0068868_100126970 3300005338 Bacteria 2084
14 Ga0070661_100047297 3300005344 Bacteria 3148
15 Ga0070669_100031645 3300005353 Bacteria 3822
16 Ga0070659_100002627 3300005366 Bacteria 12778
17 Ga0070659_100012783 3300005366 Bacteria 6233
18 Ga0070667_100048139 3300005367 Bacteria 3588
19 Ga0070709_10043999 3300005434 Unclassified 2764
20 Ga0070709_10049816 3300005434 Bacteria 2621
21 Ga0070714_100004498 3300005435 Bacteria 10508
22 Ga0070714_100021465 3300005435 Bacteria 5284
23 Ga0070714_100044772 3300005435 Bacteria 3747
24 Ga0070714_100344224 3300005435 Bacteria 1399
25 Ga0070713_100135398 3300005436 Bacteria 2176
26 Ga0070713_100200943 3300005436 Bacteria 1800
27 Ga0070711_100000079 3300005439 Bacteria 53822
28 Ga0070694_100005378 3300005444 Bacteria 7747
29 Ga0070694_100381281 3300005444 Bacteria 1100
30 Ga0070708_100000957 3300005445 Bacteria 21911
31 Ga0070708_100027874 3300005445 Bacteria 4852
32 Ga0070708_100052930 3300005445 Bacteria 3601
33 Ga0070708_100078942 3300005445 Bacteria 2976
34 Ga0070708_100136089 3300005445 Bacteria 2276
35 Ga0070663_100030074 3300005455 Bacteria 3718
36 Ga0070662_100002376 3300005457 Bacteria 11567
37 Ga0070681_10002209 3300005458 Bacteria 17745
38 Ga0070681_10069904 3300005458 Bacteria 3477
39 Ga0070706_100000479 3300005467 Bacteria 47131
40 Ga0070706_100005884 3300005467 Bacteria 11626
41 Ga0070706_100105422 3300005467 Bacteria 2623
42 Ga0070707_100000671 3300005468 Bacteria 33971
43 Ga0070707_100004004 3300005468 Bacteria 13864
44 Ga0070707_100023160 3300005468 Bacteria 5875
45 Ga0070698_100000012 3300005471 Bacteria 116260
46 Ga0070698_100069745 3300005471 Bacteria 3528
47 Ga0070698_100120458 3300005471 Bacteria 2584
48 Ga0070699_100027170 3300005518 Bacteria 4936
49 Ga0070699_100040593 3300005518 Bacteria 4029
50 Ga0070699_100074231 3300005518 Bacteria 2959
51 Ga0070699_100139232 3300005518 Bacteria 2142
52 Ga0070679_100000737 3300005530 Bacteria 28290
53 Ga0070684_100014668 3300005535 Bacteria 6355
54 Ga0070684_100030878 3300005535 Unclassified 4557
55 Ga0070697_100001672 3300005536 Bacteria 16933
56 Ga0070697_100002228 3300005536 Bacteria 14869
57 Ga0070697_100299775 3300005536 Bacteria 1381
58 Ga0068853_100004645 3300005539 Bacteria 10650
59 Ga0068853_100020457 3300005539 Bacteria 5503
60 Ga0070686_100018914 3300005544 Bacteria 4052
61 Ga0070695_100411256 3300005545 Bacteria 1028
62 Ga0070696_100044735 3300005546 Bacteria 3066
63 Ga0070696_100059133 3300005546 Bacteria 2678
64 Ga0070665_100011275 3300005548 Bacteria 9040
65 Ga0068855_100013667 3300005563 Bacteria 9790
66 Ga0068855_100091769 3300005563 Bacteria 3503
67 Ga0068855_100206972 3300005563 Bacteria 2207
68 Ga0070664_100048502 3300005564 Bacteria 3589
69 Ga0068857_100000993 3300005577 Bacteria 21789
70 Ga0068857_100132081 3300005577 Bacteria 2252
71 Ga0068854_100003419 3300005578 Bacteria 9897
72 Ga0068854_100053363 3300005578 Bacteria 2903
73 Ga0068856_100007374 3300005614 Bacteria 10734
74 Ga0068856_100108385 3300005614 Bacteria 2774
75 Ga0068852_100014990 3300005616 Bacteria 5989
76 Ga0068852_100049787 3300005616 Unclassified 3586
77 Ga0068859_100019768 3300005617 Bacteria 6761
78 Ga0068859_100033551 3300005617 Bacteria 5155
79 Ga0068864_100053966 3300005618 Bacteria 3468
80 Ga0068866_10007826 3300005718 Bacteria 4484
81 Ga0068861_100183349 3300005719 Bacteria 1744
82 Ga0068851_10005162 3300005834 Bacteria 5926
83 Ga0068863_100071694 3300005841 Bacteria 3277
84 Ga0068863_100115486 3300005841 Bacteria 2558
85 Ga0068863_100622464 3300005841 Bacteria 1069
86 Ga0068858_100008679 3300005842 Bacteria 9755
87 Ga0068858_100040192 3300005842 Bacteria 4336
88 Ga0068858_100225279 3300005842 Bacteria 1777
89 Ga0068860_100075338 3300005843 Bacteria 3209
90 Ga0068860_100185673 3300005843 Bacteria 2010
91 Ga0068860_100561090 3300005843 Bacteria 1145
92 Ga0068862_100238872 3300005844 Bacteria 1651
93 Ga0081539_10001217 3300005985 Bacteria 45977
94 Ga0070717_10003181 3300006028 Bacteria 11728
95 Ga0070717_10012082 3300006028 Bacteria 6578
96 Ga0070717_10035978 3300006028 Bacteria 4013
97 Ga0070717_10110634 3300006028 Bacteria 2343
98 Ga0070715_10004091 3300006163 Bacteria 4740
99 Ga0070715_10052398 3300006163 Bacteria 1760
100 Ga0070716_100007729 3300006173 Bacteria 5305
101 Ga0070716_100023702 3300006173 Bacteria 3258
102 Ga0070716_100041649 3300006173 Bacteria 2560
103 Ga0070716_100061142 3300006173 Bacteria 2179
104 Ga0070716_100323004 3300006173 Bacteria 1082
105 Ga0070712_100015238 3300006175 Bacteria 4945
106 Ga0070712_100081994 3300006175 Archaea 2339
107 Ga0097621_100001039 3300006237 Bacteria 19473
108 Ga0097621_100028521 3300006237 Bacteria 4399
109 Ga0097621_100271835 3300006237 Bacteria 1489
110 Ga0068871_100007522 3300006358 Bacteria 7789
111 Ga0068871_100010023 3300006358 Bacteria 6889
112 Ga0068871_100241370 3300006358 Bacteria 1571
113 Ga0075431_100005781 3300006847 Bacteria 12234
114 Ga0075433_10003030 3300006852 Bacteria 12906
115 Ga0075434_100002002 3300006871 Bacteria 17697
116 Ga0068865_100085057 3300006881 Bacteria 2281
117 Ga0075436_100013788 3300006914 Bacteria 5536
118 Ga0075436_100021110 3300006914 Bacteria 4468
119 Ga0097620_100019768 3300006931 Bacteria 6761
120 Ga0097620_100033551 3300006931 Bacteria 5155
121 Ga0075435_100001773 3300007076 Bacteria 14054
122 Ga0075435_100004923 3300007076 Bacteria 9263
123 Ga0099794_10102853 3300007265 Bacteria 1427
124 Ga0105240_10164119 3300009093 Unclassified 2636
125 Ga0105245_10000563 3300009098 Bacteria 33752
126 Ga0105245_10025768 3300009098 Bacteria 5171
127 Ga0105245_10081106 3300009098 Bacteria 2965
128 Ga0105245_10144777 3300009098 Unclassified 2241
129 Ga0105245_10232205 3300009098 Bacteria 1785
130 Ga0105247_10004558 3300009101 Bacteria 8834
131 Ga0105247_10248895 3300009101 Unclassified 1214
132 Ga0114129_10020220 3300009147 Bacteria 9473
133 Ga0114129_10121347 3300009147 Bacteria 3597
134 Ga0105241_10013911 3300009174 Bacteria 5896
135 Ga0105242_10008502 3300009176 Bacteria 7880
136 Ga0105242_10124834 3300009176 Unclassified 2214
137 Ga0105248_10007142 3300009177 Bacteria 12245
138 Ga0105248_10046283 3300009177 Bacteria 4875
139 Ga0105248_10067206 3300009177 Bacteria 4024
140 Ga0105248_10525210 3300009177 Bacteria 1335
141 Ga0105237_10018318 3300009545 Bacteria 7247
142 Ga0105237_10077602 3300009545 Bacteria 3311
143 Ga0105237_10240192 3300009545 Bacteria 1813
144 Ga0105237_10448628 3300009545 Bacteria 1296
145 Ga0105238_10026621 3300009551 Bacteria 5897
146 Ga0105238_10060042 3300009551 Bacteria 3808
147 Ga0105249_10002239 3300009553 Bacteria 16779
148 Ga0105239_10022026 3300010375 Bacteria 7025
149 Ga0105239_10187595 3300010375 Bacteria 2314
150 Ga0105239_10449985 3300010375 Bacteria 1461
151 Ga0157371_10036648 3300013102 Bacteria 3512
152 Ga0157370_10180393 3300013104 Bacteria 1962
153 Ga0157369_10019301 3300013105 Bacteria 7628
154 Ga0157369_10028698 3300013105 Bacteria 6155
155 Ga0157369_10198198 3300013105 Bacteria 2108
156 Ga0157374_10004870 3300013296 Bacteria 11261
157 Ga0157374_10025198 3300013296 Bacteria 5337
158 Ga0157374_10237049 3300013296 Bacteria 1793
159 Ga0157378_10001969 3300013297 Bacteria 18390
160 Ga0157378_10030543 3300013297 Bacteria 4762
161 Ga0163162_10002638 3300013306 Bacteria 17007
162 Ga0163162_10004655 3300013306 Bacteria 13225
163 Ga0163162_10017560 3300013306 Bacteria 7002
164 Ga0163162_10263132 3300013306 Unclassified 1856
165 Ga0163162_10376258 3300013306 Bacteria 1553
166 Ga0157372_10012812 3300013307 Bacteria 8936
167 Ga0157372_10134508 3300013307 Bacteria 2846
168 Ga0157372_10283584 3300013307 Bacteria 1926
169 Ga0157375_10082458 3300013308 Bacteria 3258
170 Ga0157379_10002535 3300014968 Bacteria 15316
171 Ga0157379_10057592 3300014968 Bacteria 3473
172 Ga0157376_10063641 3300014969 Bacteria 3108
173 Ga0206350_10994065 3300020080 Unclassified 1048
174 Ga0213876_10000083 3300021384 Bacteria 107933
175 Ga0213876_10000280 3300021384 Bacteria 46817
176 Ga0228598_1000004 3300024227 Bacteria 30534
177 Ga0207692_10086665 3300025898 Bacteria 1688
178 Ga0207710_10081859 3300025900 Bacteria 1499
179 Ga0207647_10002414 3300025904 Bacteria 14165
180 Ga0207647_10029453 3300025904 Bacteria 3554
181 Ga0207685_10013572 3300025905 Bacteria 2524
182 Ga0207685_10047900 3300025905 Bacteria 1634
183 Ga0207699_10043105 3300025906 Bacteria 2620
184 Ga0207699_10113906 3300025906 Bacteria 1738
185 Ga0207684_10002954 3300025910 Bacteria 16852
186 Ga0207684_10037168 3300025910 Bacteria 4132
187 Ga0207684_10077513 3300025910 Bacteria 2826
188 Ga0207654_10033852 3300025911 Bacteria 2835
189 Ga0207707_10004173 3300025912 Bacteria 12795
190 Ga0207707_10048543 3300025912 Bacteria 3697
191 Ga0207695_10229623 3300025913 Bacteria 1761
192 Ga0207695_10284835 3300025913 Bacteria 1546
193 Ga0207671_10024372 3300025914 Bacteria 4551
194 Ga0207671_10106411 3300025914 Unclassified 2129
195 Ga0207693_10000230 3300025915 Bacteria 51238
196 Ga0207693_10010908 3300025915 Bacteria 7370
197 Ga0207663_10001477 3300025916 Bacteria 10951
198 Ga0207663_10062877 3300025916 Bacteria 2361
199 Ga0207646_10000151 3300025922 Bacteria 95358
200 Ga0207646_10000287 3300025922 Bacteria 69461
201 Ga0207646_10094827 3300025922 Bacteria 2673
202 Ga0207646_10198414 3300025922 Bacteria 1812
203 Ga0207694_10232410 3300025924 Unclassified 1506
204 Ga0207694_10363206 3300025924 Bacteria 1200
205 Ga0207687_10002458 3300025927 Bacteria 12576
206 Ga0207687_10004123 3300025927 Bacteria 9727
207 Ga0207700_10014020 3300025928 Bacteria 5239
208 Ga0207700_10357541 3300025928 Bacteria 1273
209 Ga0207664_10016936 3300025929 Bacteria 5330
210 Ga0207664_10026495 3300025929 Bacteria 4383
211 Ga0207664_10101845 3300025929 Bacteria 2374
212 Ga0207664_10118007 3300025929 Bacteria 2216
213 Ga0207664_10183618 3300025929 Archaea 1797
214 Ga0207706_10000281 3300025933 Bacteria 55604
215 Ga0207709_10097813 3300025935 Bacteria 1934
216 Ga0207670_10066073 3300025936 Bacteria 2484
217 Ga0207665_10006177 3300025939 Bacteria 7955
218 Ga0207665_10007037 3300025939 Bacteria 7450
219 Ga0207665_10014822 3300025939 Bacteria 5125
220 Ga0207711_10224082 3300025941 Unclassified 1721
221 Ga0207689_10000243 3300025942 Bacteria 48629
222 Ga0207689_10005238 3300025942 Bacteria 11629
223 Ga0207661_10036769 3300025944 Bacteria 3825
224 Ga0207667_10024164 3300025949 Bacteria 6677
225 Ga0207667_10029733 3300025949 Bacteria 5919
226 Ga0207712_10075812 3300025961 Bacteria 2432
227 Ga0207677_10003881 3300026023 Bacteria 7960
228 Ga0207677_10006852 3300026023 Bacteria 6260
229 Ga0207703_10035742 3300026035 Bacteria 3949
230 Ga0207703_10237061 3300026035 Bacteria 1638
231 Ga0207678_10001098 3300026067 Bacteria 24827
232 Ga0207702_10082392 3300026078 Bacteria 2797
233 Ga0207641_10028581 3300026088 Bacteria 4608
234 Ga0207641_10030055 3300026088 Bacteria 4498
235 Ga0207641_10195588 3300026088 Bacteria 1861
236 Ga0207648_10012550 3300026089 Bacteria 7927
237 Ga0207676_10014364 3300026095 Bacteria 5697
238 Ga0207676_10031246 3300026095 Bacteria 4004
239 Ga0207674_10000079 3300026116 Bacteria 102085
240 Ga0207675_100269867 3300026118 Unclassified 1651
241 Ga0207683_10026888 3300026121 Bacteria 4971
242 Ga0268264_10232587 3300028381 Bacteria 1703
243 Ga0265323_10000314 3300028653 Bacteria 27997
244 Ga0265338_10000854 3300028800 Bacteria 51511
245 Ga0265338_10016641 3300028800 Bacteria 7977
246 Ga0265760_10000642 3300031090 Bacteria 9911
247 Ga0265760_10002473 3300031090 Bacteria 5392
248 Ga0265760_10007094 3300031090 Unclassified 3208
249 Ga0307408_100266024 3300031548 Bacteria 1421
250 Ga0307410_10023012 3300031852 Bacteria 3864
251 Ga0307406_10167106 3300031901 Bacteria 1588
252 Ga0307407_10089296 3300031903 Bacteria 1885
253 Ga0307416_100080236 3300032002 Bacteria 2753
254 Ga0307411_10117002 3300032005 Bacteria 1920
255 Ga0307415_100086444 3300032126 Bacteria 2256
256 Ga0373949_0032640 3300035090 Bacteria 1248
257 Ga0373941_0092426 3300035115 Bacteria 1040
258 Ga0373943_0018282 3300035170 Bacteria 3218
259 Ga0373943_0095933 3300035170 Unclassified 1543
260 Ga0373931_0023474 3300035691 Bacteria 3114
261 Ga0373935_0103038 3300035692 Bacteria 1884
262 Ga0373927_0008461 3300035695 Bacteria 6920
263 Ga0373933_0108254 3300035724 Bacteria 1731
264 Ga0373947_0008722 3300035725 Bacteria 5832
265 Ga0373937_0025279 3300036401 Bacteria 5362
266 Ga0373937_0378087 3300036401 Unclassified 1343
267 Ga0373925_0029010 3300037068 Bacteria 4057
268 Ga0373925_0425647 3300037068 Unclassified 1085
269 Ga0395905_0026244 3300037471 Bacteria 5493
270 Ga0436364_0488840 3300037853 Bacteria 8505
271 Ga0436365_0051833 3300039437 Bacteria 32975
272 Ga0436365_0563106 3300039437 Bacteria 187681
273 Ga0436363_1239741 3300039450 Bacteria 1496
274 Ga0466964_0220630 3300044706 Bacteria 920
275 Ga0451576_0038015 3300045051 Bacteria 5096
276 Ga0466967_0113569 3300045976 Bacteria 2492
277 Ga0495580_0009324 3300046472 Bacteria 7723
278 Ga0495580_0014960 3300046472 Bacteria 5874
279 Ga0495580_0056959 3300046472 Bacteria 2751
280 Ga0495580_0148326 3300046472 Bacteria 1625
281 Ga0495580_0334548 3300046472 Unclassified 1028
282 Ga0495582_0002797 3300046473 Bacteria 9749
283 Ga0495630_0202420 3300046517 Bacteria 1515
284 Ga0495665_0025673 3300046531 Bacteria 3164
285 Ga0495659_0087810 3300046664 Bacteria 1190
286 Ga0495624_0168363 3300046690 Bacteria 1337
287 Ga0495581_0092443 3300047315 Bacteria 1756
288 Ga0495674_0131118 3300047319 Unclassified 2112
289 Ga0495602_0167918 3300048088 Bacteria 1706
290 Ga0496100_0053259 3300048903 Bacteria 2634
291 Ga0496100_0233112 3300048903 Bacteria 1355
292 Ga0496101_0017632 3300048904 Bacteria 4844
293 Ga0496102_0008192 3300048905 Bacteria 8942
294 Ga0496102_0479851 3300048905 Unclassified 1165
295 Ga0496103_0023683 3300048906 Bacteria 3703
296 Ga0496104_0106005 3300048907 Bacteria 2693
297 Ga0496105_0128811 3300048908 Bacteria 2087
298 Ga0496106_0017544 3300048909 Bacteria 5297
299 Ga0496106_0069268 3300048909 Bacteria 2692
300 Ga0496106_0244023 3300048909 Bacteria 1435
301 Ga0496107_0039636 3300048910 Bacteria 3380
302 Ga0496107_0054205 3300048910 Bacteria 2894
303 Ga0496107_0134631 3300048910 Bacteria 1826
304 Ga0496107_0143369 3300048910 Bacteria 1766
305 Ga0496109_0122397 3300048912 Bacteria 2424
306 Ga0496109_0503032 3300048912 Bacteria 1144
307 Ga0496109_0546981 3300048912 Unclassified 1092
308 Ga0496112_0004726 3300048915 Bacteria 11609
309 Ga0496112_0007419 3300048915 Bacteria 9734
310 Ga0496112_0090633 3300048915 Bacteria 3026
311 Ga0496112_0091954 3300048915 Bacteria 3003
312 Ga0496112_0140332 3300048915 Bacteria 2386
313 Ga0496113_0307349 3300048916 Bacteria 1270
314 Ga0496114_0041461 3300048917 Bacteria 3815
315 Ga0496115_0035025 3300048918 Bacteria 3970
316 Ga0496115_0239955 3300048918 Bacteria 1494
317 Ga0501047_0384485 3300049581 Bacteria 1238
318 nmdc:mga05p37_116602_c1 3300050507 Bacteria 3282
319 nmdc:mga0n895_5529_c1 3300050512 Bacteria 10581
320 nmdc:mga0rr50_110_c2 3300050513 Bacteria 25403
321 nmdc:mga0rr50_8452_c1 3300050513 Bacteria 6410
322 nmdc:mga08x19_12966_c1 3300050514 Bacteria 5032
323 nmdc:mga08x19_2015_c1 3300050514 Bacteria 12441
324 nmdc:mga0a205_131_c1 3300050515 Bacteria 46472
325 Ga0495601_0159422 3300053077 Unclassified 1474
326 Ga0436365_1700788
327 rootH1_10117781
328 rootH1_10138313
329 Ga0065715_10103343
330 Ga0070683_100288574
331 Ga0068869_100006216
332 Ga0070680_100004696
333 Ga0070680_100113959
334 Ga0070682_100005135
335 Ga0070682_100044976
336 Ga0068868_100016845
337 Ga0068868_100026406
338 Ga0068868_100126970
339 Ga0070661_100047297
340 Ga0070669_100031645
341 Ga0070659_100002627
342 Ga0070659_100012783
343 Ga0070667_100048139
344 Ga0070709_10043999
345 Ga0070709_10049816
346 Ga0070714_100004498
347 Ga0070714_100021465
348 Ga0070714_100044772
349 Ga0070714_100344224
350 Ga0070713_100135398
351 Ga0070713_100200943
352 Ga0070711_100000079
353 Ga0070694_100005378
354 Ga0070694_100381281
355 Ga0070708_100000957
356 Ga0070708_100027874
357 Ga0070708_100052930
358 Ga0070708_100078942
359 Ga0070708_100136089
360 Ga0070663_100030074
361 Ga0070662_100002376
362 Ga0070681_10002209
363 Ga0070681_10069904
364 Ga0070706_100000479
365 Ga0070706_100005884
366 Ga0070706_100105422
367 Ga0070707_100000671
368 Ga0070707_100004004
369 Ga0070707_100023160
370 Ga0070698_100000012
371 Ga0070698_100069745
372 Ga0070698_100120458
373 Ga0070699_100027170
374 Ga0070699_100040593
375 Ga0070699_100074231
376 Ga0070699_100139232
377 Ga0070679_100000737
378 Ga0070684_100014668
379 Ga0070684_100030878
380 Ga0070697_100001672
381 Ga0070697_100002228
382 Ga0070697_100299775
383 Ga0068853_100004645
384 Ga0068853_100020457
385 Ga0070686_100018914
386 Ga0070695_100411256
387 Ga0070696_100044735
388 Ga0070696_100059133
389 Ga0070665_100011275
390 Ga0068855_100013667
391 Ga0068855_100091769
392 Ga0068855_100206972
393 Ga0070664_100048502
394 Ga0068857_100000993
395 Ga0068857_100132081
396 Ga0068854_100003419
397 Ga0068854_100053363
398 Ga0068856_100007374
399 Ga0068856_100108385
400 Ga0068852_100014990
401 Ga0068852_100049787
402 Ga0068859_100019768
403 Ga0068859_100033551
404 Ga0068864_100053966
405 Ga0068866_10007826
406 Ga0068861_100183349
407 Ga0068851_10005162
408 Ga0068863_100071694
409 Ga0068863_100115486
410 Ga0068863_100622464
411 Ga0068858_100008679
412 Ga0068858_100040192
413 Ga0068858_100225279
414 Ga0068860_100075338
415 Ga0068860_100185673
416 Ga0068860_100561090
417 Ga0068862_100238872
418 Ga0081539_10001217
419 Ga0070717_10003181
420 Ga0070717_10012082
421 Ga0070717_10035978
422 Ga0070717_10110634
423 Ga0070715_10004091
424 Ga0070715_10052398
425 Ga0070716_100007729
426 Ga0070716_100023702
427 Ga0070716_100041649
428 Ga0070716_100061142
429 Ga0070716_100323004
430 Ga0070712_100015238
431 Ga0070712_100081994
432 Ga0097621_100001039
433 Ga0097621_100028521
434 Ga0097621_100271835
435 Ga0068871_100007522
436 Ga0068871_100010023
437 Ga0068871_100241370
438 Ga0075431_100005781
439 Ga0075433_10003030
440 Ga0075434_100002002
441 Ga0068865_100085057
442 Ga0075436_100013788
443 Ga0075436_100021110
444 Ga0097620_100019768
445 Ga0097620_100033551
446 Ga0075435_100001773
447 Ga0075435_100004923
448 Ga0099794_10102853
449 Ga0105240_10164119
450 Ga0105245_10000563
451 Ga0105245_10025768
452 Ga0105245_10081106
453 Ga0105245_10144777
454 Ga0105245_10232205
455 Ga0105247_10004558
456 Ga0105247_10248895
457 Ga0114129_10020220
458 Ga0114129_10121347
459 Ga0105241_10013911
460 Ga0105242_10008502
461 Ga0105242_10124834
462 Ga0105248_10007142
463 Ga0105248_10046283
464 Ga0105248_10067206
465 Ga0105248_10525210
466 Ga0105237_10018318
467 Ga0105237_10077602
468 Ga0105237_10240192
469 Ga0105237_10448628
470 Ga0105238_10026621
471 Ga0105238_10060042
472 Ga0105249_10002239
473 Ga0105239_10022026
474 Ga0105239_10187595
475 Ga0105239_10449985
476 Ga0157371_10036648
477 Ga0157370_10180393
478 Ga0157369_10019301
479 Ga0157369_10028698
480 Ga0157369_10198198
481 Ga0157374_10004870
482 Ga0157374_10025198
483 Ga0157374_10237049
484 Ga0157378_10001969
485 Ga0157378_10030543
486 Ga0163162_10002638
487 Ga0163162_10004655
488 Ga0163162_10017560
489 Ga0163162_10263132
490 Ga0163162_10376258
491 Ga0157372_10012812
492 Ga0157372_10134508
493 Ga0157372_10283584
494 Ga0157375_10082458
495 Ga0157379_10002535
496 Ga0157379_10057592
497 Ga0157376_10063641
498 Ga0206350_10994065
499 Ga0213876_10000083
500 Ga0213876_10000280
501 Ga0228598_1000004
502 Ga0207692_10086665
503 Ga0207710_10081859
504 Ga0207647_10002414
505 Ga0207647_10029453
506 Ga0207685_10013572
507 Ga0207685_10047900
508 Ga0207699_10043105
509 Ga0207699_10113906
510 Ga0207684_10002954
511 Ga0207684_10037168
512 Ga0207684_10077513
513 Ga0207654_10033852
514 Ga0207707_10004173
515 Ga0207707_10048543
516 Ga0207695_10229623
517 Ga0207695_10284835
518 Ga0207671_10024372
519 Ga0207671_10106411
520 Ga0207693_10000230
521 Ga0207693_10010908
522 Ga0207663_10001477
523 Ga0207663_10062877
524 Ga0207646_10000151
525 Ga0207646_10000287
526 Ga0207646_10094827
527 Ga0207646_10198414
528 Ga0207694_10232410
529 Ga0207694_10363206
530 Ga0207687_10002458
531 Ga0207687_10004123
532 Ga0207700_10014020
533 Ga0207700_10357541
534 Ga0207664_10016936
535 Ga0207664_10026495
536 Ga0207664_10101845
537 Ga0207664_10118007
538 Ga0207664_10183618
539 Ga0207706_10000281
540 Ga0207709_10097813
541 Ga0207670_10066073
542 Ga0207665_10006177
543 Ga0207665_10007037
544 Ga0207665_10014822
545 Ga0207711_10224082
546 Ga0207689_10000243
547 Ga0207689_10005238
548 Ga0207661_10036769
549 Ga0207667_10024164
550 Ga0207667_10029733
551 Ga0207712_10075812
552 Ga0207677_10003881
553 Ga0207677_10006852
554 Ga0207703_10035742
555 Ga0207703_10237061
556 Ga0207678_10001098
557 Ga0207702_10082392
558 Ga0207641_10028581
559 Ga0207641_10030055
560 Ga0207641_10195588
561 Ga0207648_10012550
562 Ga0207676_10014364
563 Ga0207676_10031246
564 Ga0207674_10000079
565 Ga0207675_100269867
566 Ga0207683_10026888
567 Ga0268264_10232587
568 Ga0265323_10000314
569 Ga0265338_10000854
570 Ga0265338_10016641
571 Ga0265760_10000642
572 Ga0265760_10002473
573 Ga0265760_10007094
574 Ga0307408_100266024
575 Ga0307410_10023012
576 Ga0307406_10167106
577 Ga0307407_10089296
578 Ga0307416_100080236
579 Ga0307411_10117002
580 Ga0307415_100086444
581 Ga0373949_0032640
582 Ga0373941_0092426
583 Ga0373943_0018282
584 Ga0373943_0095933
585 Ga0373931_0023474
586 Ga0373935_0103038
587 Ga0373927_0008461
588 Ga0373933_0108254
589 Ga0373947_0008722
590 Ga0373937_0025279
591 Ga0373937_0378087
592 Ga0373925_0029010
593 Ga0373925_0425647
594 Ga0395905_0026244
595 Ga0436364_0488840
596 Ga0436365_0051833
597 Ga0436365_0563106
598 Ga0436363_1239741
599 Ga0466964_0220630
600 Ga0451576_0038015
601 Ga0466967_0113569
602 Ga0495580_0009324
603 Ga0495580_0014960
604 Ga0495580_0056959
605 Ga0495580_0148326
606 Ga0495580_0334548
607 Ga0495582_0002797
608 Ga0495630_0202420
609 Ga0495665_0025673
610 Ga0495659_0087810
611 Ga0495624_0168363
612 Ga0495581_0092443
613 Ga0495674_0131118
614 Ga0495602_0167918
615 Ga0496100_0053259
616 Ga0496100_0233112
617 Ga0496101_0017632
618 Ga0496102_0008192
619 Ga0496102_0479851
620 Ga0496103_0023683
621 Ga0496104_0106005
622 Ga0496105_0128811
623 Ga0496106_0017544
624 Ga0496106_0069268
625 Ga0496106_0244023
626 Ga0496107_0039636
627 Ga0496107_0054205
628 Ga0496107_0134631
629 Ga0496107_0143369
630 Ga0496109_0122397
631 Ga0496109_0503032
632 Ga0496109_0546981
633 Ga0496112_0004726
634 Ga0496112_0007419
635 Ga0496112_0090633
636 Ga0496112_0091954
637 Ga0496112_0140332
638 Ga0496113_0307349
639 Ga0496114_0041461
640 Ga0496115_0035025
641 Ga0496115_0239955
642 Ga0501047_0384485
643 nmdc:mga05p37_116602_c1
644 nmdc:mga0n895_5529_c1
645 nmdc:mga0rr50_110_c2
646 nmdc:mga0rr50_8452_c1
647 nmdc:mga08x19_12966_c1
648 nmdc:mga08x19_2015_c1
649 nmdc:mga0a205_131_c1
650 Ga0495601_0159422

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02790

COX2_TM

Cytochrome C oxidase subunit II, transmembrane domain

17

99

0.9

PF00034

Cytochrom_C

Cytochrome c

227

322

0.88

PF00116

COX2

Cytochrome C oxidase subunit II, periplasmic domain

90

208

0.81

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

225

318

0.66

Structural Annotation

Top 5 Hits

ID Description Score Start End
1cyx-assembly1.cif.gz_A quinol oxidase (periplasmic fragment of subunit ii with engineered cu-a binding site)(cyoa) 0.9398 102 211
1cyw-assembly1.cif.gz_A quinol oxidase (periplasmic fragment of subunit ii) (cyoa) 0.9228 102 211
4w9z-assembly1.cif.gz_A crystal structure of the periplasmic domain of subunit ii of cytochrome oxidase (coxb) of bradyrhizobium japonicum 0.9131 98 212
1w2l-assembly1.cif.gz_A cytochrome c domain of caa3 oxygen oxidoreductase 0.9068 217 311
6ptt-assembly2.cif.gz_B soluble model of arabidopsis thaliana cua (tt3lat) 0.897 105 202
ID Description Score Start End Superfamily
af_Q2FZJ9_108_266_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9432 96 211 2.60.40.420
af_A0A1D6ED90_406_498_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9317 128 209 2.60.40.420
5wehH02 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9262 104 213 2.60.40.420
3hb3B01 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9259 99 211 2.60.40.420
1w2lA00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.9068 217 311 1.10.760.10
ID Description Score Start End GO Terms
AF-A0A3D4PXL4-F1-model_v4 Cytochrome c oxidase subunit II 0.9579 127 214 GO:0004129
GO:0005507
GO:0016020
GO:0042773
AF-A0A5S9MLG3-F1-model_v4 Cytochrome oxidase subunit II copper A binding domain-containing protein 0.9539 114 211 GO:0004129
GO:0005507
GO:0005886
GO:0042773
AF-A0A2V9VMT5-F1-model_v4 Cytochrome oxidase subunit II copper A binding domain-containing protein 0.9534 127 212 GO:0004129
GO:0005507
GO:0016020
GO:0042773
AF-A0A2V8PE98-F1-model_v4 Cytochrome-c oxidase 0.9495 128 202 GO:0004129
GO:0005507
GO:0016020
GO:0030313
AF-A0A3M2SSA5-F1-model_v4 Cytochrome c oxidase polypeptide II 0.9461 127 203 GO:0004129
GO:0005507
GO:0016020
GO:0042773

Map