F407454

General Info

Members Datasets Scaffolds Average Seq Length
324 258 243 336

Family's Representative Sequence

Representative Sequence 3300035692|Ga0373935_0017765|Ga0373935_0017765_516_1529
Length 327
Sequence MKLATLKDGSRDGRLVVVSRDLSRAVAVPQIAPTLQAALDDWDVALALLADAYRRLNEGGITDAMPFDPALAHSPLPRAYQWADASAYVNHVELVRKARGATMPAEFWTDPLMYQGGSDSFIGPRDDVVCADEAFGIDLEAEVAVVTGDVPMGTTPQAVNDVSLRNLIPGELAKGFGFFQGKPASAFSPVAATPDELGAAWRDGKVHLPLLTFVNDVLFGRPNAGVDMTFNFPTLIAHAARTRELEAGSIVGSGTVSNKEDGGPGRPVAQGGAGYACIAEQRTVEMLRDGKPSTPFLRFGDRVRIDMHDAAGESIFGAIDQRVRQAD

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
3 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
4 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
5 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
6 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
7 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
8 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
9 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
10 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
11 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
12 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
13 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
14 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
15 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
16 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
17 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
18 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
19 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
20 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
21 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
22 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
23 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
24 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
25 2738541297 Duganella sp. GV083 Isolate Unclassified
26 2738541357 Duganella sp. GV053 Isolate Unclassified
27 2738543003 Duganella sp. GV066 Isolate Unclassified
28 2738543026 Duganella sp. GV089 Isolate Unclassified
29 2738543029 Duganella sp. GV039 Isolate Unclassified
30 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
31 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
32 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
33 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
34 2791355262 Rhizobium sp. M1 Isolate Nodule
35 2791355266 Rhizobium sp. L43 Isolate Nodule
36 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
37 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
38 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
39 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
40 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
41 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
42 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
43 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
44 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
45 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
46 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
47 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
48 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
49 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
50 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
51 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
52 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
53 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
54 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
55 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
56 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
57 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
58 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
59 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
60 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
61 2857564685 Duganella sp. R-74599 Isolate Unclassified
62 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
63 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
64 2933599457 Rhizobium phaseoli M3 Isolate Nodule
65 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
66 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
67 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
68 2936381700 Rhizobium chutanense C16 Isolate Unclassified
69 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
70 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
71 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
72 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
73 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
74 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
75 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
76 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
77 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
78 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
79 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
80 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
81 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
82 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
83 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
84 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
85 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
86 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
87 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
88 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
89 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
90 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
91 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
92 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
93 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
94 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
95 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
96 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
97 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
98 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
99 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
100 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
101 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
102 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
103 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
104 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
105 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
106 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
107 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
108 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
109 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
110 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
111 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
112 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
113 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
114 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
116 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
117 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
118 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
119 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
120 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
121 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
122 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
123 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
124 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
125 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
126 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
127 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
128 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
129 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
130 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
131 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
132 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
133 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
134 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
135 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
136 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
137 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
138 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
139 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
142 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
145 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
146 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
179 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
180 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
181 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
182 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
185 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
186 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
187 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
188 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
191 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
192 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
193 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
194 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
195 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
196 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
197 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
198 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
199 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
200 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
201 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
202 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
203 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
204 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
205 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
206 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
207 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
208 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
209 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
210 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
211 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
212 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
213 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
214 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
215 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
216 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
217 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
218 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
219 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
220 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
221 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
222 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
223 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
224 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
225 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
226 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
227 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
228 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
229 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
230 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
231 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
232 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
233 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
234 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
235 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
236 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
237 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
238 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
239 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
240 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
241 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
242 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
243 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
244 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
245 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
246 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
247 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
248 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
249 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
250 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
251 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
252 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
253 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
254 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
255 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
256 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
257 8024501048 Rhizobium sp. H4 Isolate Nodule
258 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 75
Metatranscriptomes 0
Isolates 25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.95
Nodule 18.52
Rhizoplane 0
Rhizosphere 57.72
Stem 0
Stem Tuber 0
Unclassified 14.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000405 3300002705 Bacteria 27011
2 JGI25162J39368_1000111 3300002737 Bacteria 89317
3 JGI25154J39366_1000342 3300002738 Bacteria 26841
4 JGI25157J39369_1000437 3300002741 Bacteria 27009
5 JGI25153J46596_10007535 3300003215 Bacteria 5332
6 JGI25153J46596_10020052 3300003215 Bacteria 2540
7 Ga0055537_1000075 3300003773 Bacteria 70912
8 Ga0055524_1000098 3300003775 Bacteria 108095
9 Ga0055536_1018748 3300003781 Bacteria 2205
10 Ga0055534_1001245 3300003784 Bacteria 10529
11 Ga0055528_1000255 3300003790 Bacteria 45167
12 Ga0055530_10000228 3300003791 Bacteria 50142
13 Ga0055540_1000203 3300003792 Bacteria 57592
14 Ga0055540_1000361 3300003792 Bacteria 38460
15 Ga0070670_100001013 3300005331 Bacteria 22166
16 Ga0070670_100010232 3300005331 Bacteria 8005
17 Ga0070677_10030560 3300005333 Bacteria 2052
18 Ga0070666_10007056 3300005335 Bacteria 6923
19 Ga0070668_100004358 3300005347 Bacteria 10499
20 Ga0070668_100045490 3300005347 Bacteria 3367
21 Ga0070669_100001355 3300005353 Bacteria 17636
22 Ga0070675_100002929 3300005354 Bacteria 12873
23 Ga0070675_100242043 3300005354 Bacteria 1576
24 Ga0070671_100082967 3300005355 Bacteria 2680
25 Ga0070674_100065406 3300005356 Bacteria 2552
26 Ga0070673_100036125 3300005364 Bacteria 3753
27 Ga0070673_100262728 3300005364 Bacteria 1508
28 Ga0070688_100031098 3300005365 Bacteria 3209
29 Ga0070667_100003589 3300005367 Bacteria 13206
30 Ga0070667_100096631 3300005367 Bacteria 2548
31 Ga0070713_100000001 3300005436 Bacteria 257984
32 Ga0070705_100142042 3300005440 Bacteria 1581
33 Ga0070700_100070624 3300005441 Bacteria 2227
34 Ga0070708_100000207 3300005445 Bacteria 43511
35 Ga0070678_100000200 3300005456 Bacteria 26391
36 Ga0070681_10297410 3300005458 Bacteria 1524
37 Ga0068867_100001219 3300005459 Bacteria 17696
38 Ga0070679_100441480 3300005530 Bacteria 1246
39 Ga0070672_100002443 3300005543 Bacteria 11791
40 Ga0070672_100312490 3300005543 Bacteria 1334
41 Ga0070693_100046594 3300005547 Bacteria 2463
42 Ga0070665_100001447 3300005548 Bacteria 27820
43 Ga0068857_100000126 3300005577 Bacteria 46128
44 Ga0068856_100001618 3300005614 Bacteria 23572
45 Ga0068859_100282735 3300005617 Bacteria 1752
46 Ga0068864_100000938 3300005618 Bacteria 24407
47 Ga0068864_100017645 3300005618 Bacteria 5951
48 Ga0068864_100082762 3300005618 Bacteria 2817
49 Ga0068864_100087341 3300005618 Bacteria 2745
50 Ga0068861_100052795 3300005719 Bacteria 3091
51 Ga0068863_100001021 3300005841 Bacteria 28037
52 Ga0068863_100409186 3300005841 Bacteria 1328
53 Ga0068863_100503173 3300005841 Bacteria 1193
54 Ga0068858_100004492 3300005842 Bacteria 13669
55 Ga0068860_100002049 3300005843 Bacteria 21245
56 Ga0070712_100000198 3300006175 Bacteria 33726
57 Ga0070712_100003321 3300006175 Bacteria 9891
58 Ga0097621_100015171 3300006237 Bacteria 5789
59 Ga0075370_10075011 3300006353 Bacteria 1939
60 Ga0068871_100001041 3300006358 Bacteria 18568
61 Ga0075428_100309613 3300006844 Bacteria 1698
62 Ga0075434_100355101 3300006871 Bacteria 1487
63 Ga0075436_100000629 3300006914 Bacteria 23192
64 Ga0097620_100282714 3300006931 Bacteria 1752
65 Ga0114129_10390795 3300009147 Bacteria 1835
66 Ga0105241_10033554 3300009174 Bacteria 3853
67 Ga0105248_10001701 3300009177 Bacteria 24486
68 Ga0105248_10128778 3300009177 Bacteria 2856
69 Ga0105237_10165740 3300009545 Bacteria 2209
70 Ga0105249_10164464 3300009553 Bacteria 2147
71 Ga0157371_10000001 3300013102 Bacteria 1162285
72 Ga0157374_10004890 3300013296 Bacteria 11242
73 Ga0163162_10110801 3300013306 Bacteria 2842
74 Ga0157375_10002885 3300013308 Bacteria 14912
75 Ga0163163_10210385 3300014325 Bacteria 1994
76 Ga0163163_10218057 3300014325 Bacteria 1957
77 Ga0157379_10001106 3300014968 Bacteria 22048
78 Ga0157379_10002695 3300014968 Bacteria 14972
79 Ga0157376_10001970 3300014969 Bacteria 13739
80 Ga0157376_10180428 3300014969 Bacteria 1929
81 Ga0163161_10036349 3300017792 Bacteria 3527
82 Ga0163161_10113943 3300017792 Bacteria 2024
83 Ga0209435_100039 3300025206 Bacteria 116879
84 Ga0209646_1000137 3300025246 Bacteria 116791
85 Ga0209026_1000135 3300025250 Bacteria 117001
86 Ga0209759_1000154 3300025256 Bacteria 119427
87 Ga0209129_1008642 3300025258 Bacteria 2802
88 Ga0209565_1000026 3300025263 Bacteria 365910
89 Ga0209673_1000009 3300025273 Bacteria 620735
90 Ga0209130_1000347 3300025284 Bacteria 53284
91 Ga0209675_1000246 3300025291 Bacteria 53700
92 Ga0209676_1000013 3300025292 Bacteria 816080
93 Ga0209025_1059738 3300025294 Bacteria 1436
94 Ga0209758_1001568 3300025297 Bacteria 26208
95 Ga0209758_1006356 3300025297 Bacteria 8545
96 Ga0209050_1000008 3300025298 Bacteria 1144179
97 Ga0209256_1000003 3300025299 Bacteria 1661127
98 Ga0209051_1000005 3300025303 Bacteria 1142353
99 Ga0209051_1031610 3300025303 Bacteria 2033
100 Ga0209257_1000048 3300025304 Bacteria 455536
101 Ga0207680_10001982 3300025903 Bacteria 9581
102 Ga0207645_10001058 3300025907 Bacteria 22793
103 Ga0207681_10009784 3300025923 Bacteria 5864
104 Ga0207681_10092579 3300025923 Bacteria 2161
105 Ga0207694_10313245 3300025924 Bacteria 1294
106 Ga0207650_10001788 3300025925 Bacteria 15209
107 Ga0207650_10096071 3300025925 Bacteria 2273
108 Ga0207659_10000739 3300025926 Bacteria 19339
109 Ga0207659_10018662 3300025926 Bacteria 4550
110 Ga0207659_10073262 3300025926 Bacteria 2507
111 Ga0207687_10162727 3300025927 Bacteria 1714
112 Ga0207644_10039090 3300025931 Bacteria 3347
113 Ga0207644_10228250 3300025931 Bacteria 1478
114 Ga0207669_10102604 3300025937 Bacteria 1895
115 Ga0207691_10000041 3300025940 Bacteria 106275
116 Ga0207691_10003579 3300025940 Bacteria 15124
117 Ga0207711_10001347 3300025941 Bacteria 23185
118 Ga0207711_10139750 3300025941 Bacteria 2178
119 Ga0207667_10059877 3300025949 Bacteria 3986
120 Ga0207651_10006458 3300025960 Bacteria 6141
121 Ga0207651_10008943 3300025960 Bacteria 5440
122 Ga0207651_10070412 3300025960 Bacteria 2474
123 Ga0207712_10144350 3300025961 Bacteria 1830
124 Ga0207712_10183868 3300025961 Bacteria 1644
125 Ga0207668_10155385 3300025972 Bacteria 1776
126 Ga0207658_10007536 3300025986 Bacteria 7413
127 Ga0207658_10083209 3300025986 Bacteria 2459
128 Ga0207677_10165325 3300026023 Bacteria 1724
129 Ga0207703_10004690 3300026035 Bacteria 11165
130 Ga0207708_10158783 3300026075 Bacteria 1784
131 Ga0207702_10013689 3300026078 Bacteria 6737
132 Ga0207641_10009275 3300026088 Bacteria 8114
133 Ga0207641_10141478 3300026088 Bacteria 2171
134 Ga0207641_10470695 3300026088 Bacteria 1217
135 Ga0207648_10000601 3300026089 Bacteria 40481
136 Ga0207648_10091371 3300026089 Bacteria 2661
137 Ga0207676_10037978 3300026095 Bacteria 3674
138 Ga0207676_10061021 3300026095 Bacteria 2985
139 Ga0207676_10150233 3300026095 Bacteria 2005
140 Ga0207676_10269745 3300026095 Bacteria 1541
141 Ga0207674_10000002 3300026116 Bacteria 279738
142 Ga0207675_100028483 3300026118 Bacteria 5201
143 Ga0207683_10000011 3300026121 Bacteria 140261
144 Ga0268265_10166903 3300028380 Bacteria 1877
145 Ga0268264_10001396 3300028381 Bacteria 22573
146 Ga0307515_10000037 3300028794 Bacteria 331970
147 Ga0265331_10032533 3300031250 Bacteria 2584
148 Ga0265342_10047278 3300031712 Bacteria 2583
149 Ga0316576_10008575 3300031727 Bacteria 6534
150 Ga0307410_10028113 3300031852 Bacteria 3563
151 Ga0307416_100107404 3300032002 Bacteria 2449
152 Ga0307411_10075239 3300032005 Bacteria 2305
153 Ga0307415_100036713 3300032126 Bacteria 3213
154 Ga0373932_0008432 3300035112 Bacteria 2465
155 Ga0373931_0202845 3300035691 Bacteria 1186
156 Ga0373935_0017765 3300035692 Bacteria 4320
157 Ga0373935_0082977 3300035692 Bacteria 2086
158 Ga0373937_0164258 3300036401 Bacteria 2082
159 Ga0373937_0390893 3300036401 Bacteria 1319
160 Ga0395899_0000028 3300037312 Bacteria 334378
161 Ga0395905_0082719 3300037471 Bacteria 3008
162 Ga0395905_0176489 3300037471 Bacteria 2006
163 Ga0395905_0281424 3300037471 Bacteria 1549
164 Ga0451835_0324511 3300041492 Bacteria 1144
165 Ga0451835_0941431 3300041492 Bacteria 2226
166 Ga0451837_0240248 3300041494 Bacteria 1864
167 Ga0451837_0272173 3300041494 Bacteria 5633
168 Ga0451837_0906286 3300041494 Bacteria 4859
169 Ga0451839_0211155 3300041496 Bacteria 7198
170 Ga0451841_1266462 3300041498 Bacteria 4200
171 Ga0451845_0075806 3300041501 Bacteria 3513
172 Ga0451845_0526932 3300041501 Bacteria 1939
173 Ga0451847_0335240 3300041503 Bacteria 6928
174 Ga0451847_0948397 3300041503 Bacteria 2034
175 Ga0451849_0721008 3300041505 Bacteria 1578
176 Ga0451849_0842790 3300041505 Bacteria 1836
177 Ga0451849_1450724 3300041505 Bacteria 6177
178 Ga0451851_1300334 3300041507 Bacteria 2122
179 Ga0451853_4000486 3300041512 Bacteria 1592
180 Ga0450904_000690 3300042139 Bacteria 5985
181 Ga0451577_0133190 3300042876 Bacteria 2231
182 Ga0453683_0036379 3300044673 Bacteria 3099
183 Ga0451576_0000239 3300045051 Bacteria 134323
184 Ga0495617_000050 3300046452 Bacteria 109761
185 Ga0495638_0070314 3300046460 Bacteria 2143
186 Ga0495650_0000477 3300046471 Bacteria 61376
187 Ga0495650_0006288 3300046471 Bacteria 7432
188 Ga0495582_0045919 3300046473 Bacteria 2406
189 Ga0495585_0003363 3300046492 Bacteria 10821
190 Ga0495585_0019538 3300046492 Bacteria 3906
191 Ga0495607_0009421 3300046501 Bacteria 6610
192 Ga0495607_0037841 3300046501 Bacteria 2894
193 Ga0495606_0000229 3300046507 Bacteria 98732
194 Ga0495610_0006414 3300046512 Bacteria 8099
195 Ga0495616_0060332 3300046513 Bacteria 1863
196 Ga0495620_0017146 3300046515 Bacteria 3617
197 Ga0495631_0004975 3300046518 Bacteria 7003
198 Ga0495631_0037336 3300046518 Bacteria 2165
199 Ga0495632_0046253 3300046519 Bacteria 2163
200 Ga0495648_0015065 3300046524 Bacteria 5630
201 Ga0495648_0019743 3300046524 Bacteria 4724
202 Ga0495654_0046334 3300046530 Bacteria 2142
203 Ga0495665_0007549 3300046531 Bacteria 5889
204 Ga0495609_0003736 3300046538 Bacteria 8599
205 Ga0495609_0046736 3300046538 Bacteria 1938
206 Ga0495633_0104058 3300046558 Bacteria 1317
207 Ga0495668_0000118 3300046616 Bacteria 119439
208 Ga0495668_0005386 3300046616 Bacteria 8703
209 Ga0495668_0006680 3300046616 Bacteria 7510
210 Ga0495668_0057598 3300046616 Bacteria 2144
211 Ga0495611_0036654 3300046648 Bacteria 2177
212 Ga0495625_0031914 3300046660 Bacteria 3913
213 Ga0495625_0035970 3300046660 Bacteria 3644
214 Ga0495625_0079565 3300046660 Bacteria 2285
215 Ga0495661_0008216 3300046665 Bacteria 7230
216 Ga0495623_0090239 3300046679 Bacteria 1882
217 Ga0495649_0053602 3300046694 Bacteria 2183
218 Ga0495660_0004552 3300046810 Bacteria 8374
219 Ga0495672_0155316 3300047320 Bacteria 1182
220 Ga0495687_030930 3300047443 Bacteria 2461
221 Ga0495677_0035335 3300047445 Bacteria 1823
222 Ga0495679_006871 3300047446 Bacteria 4829
223 Ga0495673_0000049 3300047469 Bacteria 265878
224 Ga0495673_0017129 3300047469 Bacteria 3687
225 Ga0495686_0007958 3300047472 Bacteria 7865
226 Ga0495686_0059832 3300047472 Bacteria 2369
227 Ga0495626_0040566 3300048091 Bacteria 2198
228 Ga0496122_0140945 3300048925 Bacteria 1508
229 Ga0496123_0009320 3300048926 Bacteria 8858
230 Ga0496124_0009304 3300048927 Bacteria 10128
231 Ga0496124_0042621 3300048927 Bacteria 3907
232 Ga0496124_0091593 3300048927 Bacteria 2477
233 Ga0501031_0131978 3300049568 Bacteria 1632
234 nmdc:mga08y16_269009_c1 3300050511 Bacteria 1759
235 Ga0495601_0070055 3300053077 Bacteria 2238
236 Ga0495612_0040326 3300053078 Bacteria 1902
237 Ga0495655_0025768 3300053083 Bacteria 1379
238 Ga0495619_0101707 3300053085 Bacteria 1957
239 Ga0495619_0117119 3300053085 Bacteria 1824
240 Ga0495619_0260030 3300053085 Bacteria 1203
241 Ga0500594_0024019 3300053118 Bacteria 1550
242 Ga0500658_0001854 3300053134 Bacteria 8315
243 Ga0500616_0006201 3300053153 Bacteria 7888

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003784 Ga0055534_1001245 Ga0055534_100124510 295
2 3300053083 Ga0495655_0025768 Ga0495655_0025768_474_1367 297
3 3300046473 Ga0495582_0045919 Ga0495582_0045919_590_1567 310
4 3300046531 Ga0495665_0007549 Ga0495665_0007549_185_1162 310
5 3300053085 Ga0495619_0260030 Ga0495619_0260030_235_1173 311
6 3300003773 Ga0055537_1000075 Ga0055537_100007538 322
7 3300003775 Ga0055524_1000098 Ga0055524_100009843 322
8 3300003781 Ga0055536_1018748 Ga0055536_10187483 322
9 3300003790 Ga0055528_1000255 Ga0055528_100025527 322
10 3300003791 Ga0055530_10000228 Ga0055530_1000022818 322
11 3300003792 Ga0055540_1000203 Ga0055540_100020325 322
12 3300003792 Ga0055540_1000361 Ga0055540_100036127 322
13 3300025263 Ga0209565_1000026 Ga0209565_100002666 322
14 3300025273 Ga0209673_1000009 Ga0209673_100000975 322
15 3300025284 Ga0209130_1000347 Ga0209130_100034737 322
16 3300025291 Ga0209675_1000246 Ga0209675_100024644 322
17 3300025292 Ga0209676_1000013 Ga0209676_1000013171 322
18 3300025298 Ga0209050_1000008 Ga0209050_1000008171 322
19 3300025299 Ga0209256_1000003 Ga0209256_1000003230 322
20 3300025303 Ga0209051_1000005 Ga0209051_1000005171 322
21 3300025304 Ga0209257_1000048 Ga0209257_1000048171 322
22 3300031250 Ga0265331_10032533 Ga0265331_100325333 323
23 3300009553 Ga0105249_10164464 Ga0105249_101644643 325
24 3300025961 Ga0207712_10144350 Ga0207712_101443502 325
25 3300005436 Ga0070713_100000001 Ga0070713_10000000189 326
26 3300005440 Ga0070705_100142042 Ga0070705_1001420422 326
27 3300005530 Ga0070679_100441480 Ga0070679_1004414801 326
28 3300005547 Ga0070693_100046594 Ga0070693_1000465944 326
29 3300005577 Ga0068857_100000126 Ga0068857_10000012644 326
30 3300005614 Ga0068856_100001618 Ga0068856_10000161816 326
31 3300006175 Ga0070712_100000198 Ga0070712_10000019821 326
32 3300006871 Ga0075434_100355101 Ga0075434_1003551012 326
33 3300006914 Ga0075436_100000629 Ga0075436_10000062915 326
34 3300009174 Ga0105241_10033554 Ga0105241_100335545 326
35 3300009545 Ga0105237_10165740 Ga0105237_101657402 326
36 3300014968 Ga0157379_10002695 Ga0157379_100026959 326
37 3300025924 Ga0207694_10313245 Ga0207694_103132452 326
38 3300025949 Ga0207667_10059877 Ga0207667_100598774 326
39 3300026078 Ga0207702_10013689 Ga0207702_100136897 326
40 3300026116 Ga0207674_10000002 Ga0207674_10000002177 326
41 3300035112 Ga0373932_0008432 Ga0373932_0008432_1115_2098 326
42 3300035692 Ga0373935_0017765 Ga0373935_0017765_516_1529 326
43 3300035692 Ga0373935_0082977 Ga0373935_0082977_581_1564 326
44 3300036401 Ga0373937_0390893 Ga0373937_0390893_124_1107 326
45 3300046679 Ga0495623_0090239 Ga0495623_0090239_756_1739 326
46 3300006353 Ga0075370_10075011 Ga0075370_100750112 327
47 iso_pu_bacteria 2919543075 2919544969 327
48 3300028794 Ga0307515_10000037 Ga0307515_10000037163 328
49 3300053085 Ga0495619_0101707 Ga0495619_0101707_958_1947 328
50 3300026095 Ga0207676_10269745 Ga0207676_102697451 329
51 3300053078 Ga0495612_0040326 Ga0495612_0040326_501_1493 329
52 3300053085 Ga0495619_0117119 Ga0495619_0117119_811_1803 329
53 3300037471 Ga0395905_0082719 Ga0395905_0082719_1914_2933 331
54 3300037471 Ga0395905_0176489 Ga0395905_0176489_923_1954 331
55 3300037471 Ga0395905_0281424 Ga0395905_0281424_69_1073 331
56 iso_pu_bacteria 2974320154 2974320906 331
57 iso_pu_bacteria 2574179768 2574431814 332
58 iso_pu_bacteria 2643221564 2643837277 333
59 3300031727 Ga0316576_10008575 Ga0316576_100085756 334
60 3300032005 Ga0307411_10075239 Ga0307411_100752393 334
61 iso_pu_bacteria 2751185821 2753460986 334
62 iso_pu_bacteria 2897803580 2897808249 334
63 iso_pu_bacteria 8054002106 8054004192 334
64 3300031712 Ga0265342_10047278 Ga0265342_100472782 335
65 3300049568 Ga0501031_0131978 Ga0501031_0131978_416_1429 335
66 iso_pu_bacteria 2738541297 2738829503 335
67 iso_pu_bacteria 2738541357 2739153299 335
68 iso_pu_bacteria 2738543003 2739195219 335
69 iso_pu_bacteria 2738543026 2739321695 335
70 iso_pu_bacteria 2738543029 2739339749 335
71 iso_pu_bacteria 2751185846 2753567867 335
72 iso_pu_bacteria 2857564685 2857564992 335
73 3300005331 Ga0070670_100001013 Ga0070670_10000101320 336
74 3300005331 Ga0070670_100010232 Ga0070670_1000102323 336
75 3300005333 Ga0070677_10030560 Ga0070677_100305602 336
76 3300005335 Ga0070666_10007056 Ga0070666_100070562 336
77 3300005347 Ga0070668_100004358 Ga0070668_1000043585 336
78 3300005347 Ga0070668_100045490 Ga0070668_1000454901 336
79 3300005353 Ga0070669_100001355 Ga0070669_1000013552 336
80 3300005354 Ga0070675_100002929 Ga0070675_1000029299 336
81 3300005354 Ga0070675_100242043 Ga0070675_1002420432 336
82 3300005355 Ga0070671_100082967 Ga0070671_1000829672 336
83 3300005356 Ga0070674_100065406 Ga0070674_1000654063 336
84 3300005364 Ga0070673_100036125 Ga0070673_1000361252 336
85 3300005364 Ga0070673_100262728 Ga0070673_1002627282 336
86 3300005365 Ga0070688_100031098 Ga0070688_1000310984 336
87 3300005367 Ga0070667_100003589 Ga0070667_1000035892 336
88 3300005367 Ga0070667_100096631 Ga0070667_1000966313 336
89 3300005441 Ga0070700_100070624 Ga0070700_1000706242 336
90 3300005445 Ga0070708_100000207 Ga0070708_10000020714 336
91 3300005456 Ga0070678_100000200 Ga0070678_1000002009 336
92 3300005459 Ga0068867_100001219 Ga0068867_1000012193 336
93 3300005543 Ga0070672_100002443 Ga0070672_1000024437 336
94 3300005543 Ga0070672_100312490 Ga0070672_1003124901 336
95 3300005548 Ga0070665_100001447 Ga0070665_10000144710 336
96 3300005617 Ga0068859_100282735 Ga0068859_1002827352 336
97 3300005618 Ga0068864_100000938 Ga0068864_10000093811 336
98 3300005618 Ga0068864_100017645 Ga0068864_1000176452 336
99 3300005618 Ga0068864_100082762 Ga0068864_1000827622 336
100 3300005618 Ga0068864_100087341 Ga0068864_1000873412 336
101 3300005719 Ga0068861_100052795 Ga0068861_1000527953 336
102 3300005841 Ga0068863_100001021 Ga0068863_10000102110 336
103 3300005841 Ga0068863_100409186 Ga0068863_1004091861 336
104 3300005841 Ga0068863_100503173 Ga0068863_1005031731 336
105 3300005842 Ga0068858_100004492 Ga0068858_1000044922 336
106 3300005843 Ga0068860_100002049 Ga0068860_10000204921 336
107 3300006237 Ga0097621_100015171 Ga0097621_1000151712 336
108 3300006358 Ga0068871_100001041 Ga0068871_1000010412 336
109 3300006844 Ga0075428_100309613 Ga0075428_1003096131 336
110 3300006931 Ga0097620_100282714 Ga0097620_1002827142 336
111 3300009177 Ga0105248_10001701 Ga0105248_1000170110 336
112 3300009177 Ga0105248_10128778 Ga0105248_101287783 336
113 3300013296 Ga0157374_10004890 Ga0157374_100048905 336
114 3300013306 Ga0163162_10110801 Ga0163162_101108011 336
115 3300013308 Ga0157375_10002885 Ga0157375_1000288510 336
116 3300014325 Ga0163163_10210385 Ga0163163_102103851 336
117 3300014325 Ga0163163_10218057 Ga0163163_102180572 336
118 3300014968 Ga0157379_10001106 Ga0157379_100011065 336
119 3300014969 Ga0157376_10001970 Ga0157376_100019705 336
120 3300014969 Ga0157376_10180428 Ga0157376_101804282 336
121 3300017792 Ga0163161_10036349 Ga0163161_100363492 336
122 3300017792 Ga0163161_10113943 Ga0163161_101139431 336
123 3300025903 Ga0207680_10001982 Ga0207680_100019823 336
124 3300025907 Ga0207645_10001058 Ga0207645_1000105817 336
125 3300025923 Ga0207681_10009784 Ga0207681_100097843 336
126 3300025923 Ga0207681_10092579 Ga0207681_100925792 336
127 3300025925 Ga0207650_10001788 Ga0207650_1000178812 336
128 3300025925 Ga0207650_10096071 Ga0207650_100960712 336
129 3300025926 Ga0207659_10000739 Ga0207659_100007399 336
130 3300025926 Ga0207659_10018662 Ga0207659_100186622 336
131 3300025926 Ga0207659_10073262 Ga0207659_100732622 336
132 3300025927 Ga0207687_10162727 Ga0207687_101627272 336
133 3300025931 Ga0207644_10039090 Ga0207644_100390903 336
134 3300025931 Ga0207644_10228250 Ga0207644_102282502 336
135 3300025937 Ga0207669_10102604 Ga0207669_101026042 336
136 3300025940 Ga0207691_10000041 Ga0207691_1000004171 336
137 3300025940 Ga0207691_10003579 Ga0207691_100035795 336
138 3300025941 Ga0207711_10001347 Ga0207711_100013479 336
139 3300025941 Ga0207711_10139750 Ga0207711_101397502 336
140 3300025960 Ga0207651_10006458 Ga0207651_100064585 336
141 3300025960 Ga0207651_10008943 Ga0207651_100089432 336
142 3300025960 Ga0207651_10070412 Ga0207651_100704123 336
143 3300025961 Ga0207712_10183868 Ga0207712_101838682 336
144 3300025972 Ga0207668_10155385 Ga0207668_101553852 336
145 3300025986 Ga0207658_10007536 Ga0207658_100075365 336
146 3300025986 Ga0207658_10083209 Ga0207658_100832092 336
147 3300026023 Ga0207677_10165325 Ga0207677_101653251 336
148 3300026035 Ga0207703_10004690 Ga0207703_100046905 336
149 3300026075 Ga0207708_10158783 Ga0207708_101587832 336
150 3300026088 Ga0207641_10009275 Ga0207641_100092755 336
151 3300026088 Ga0207641_10141478 Ga0207641_101414781 336
152 3300026088 Ga0207641_10470695 Ga0207641_104706951 336
153 3300026089 Ga0207648_10000601 Ga0207648_1000060118 336
154 3300026089 Ga0207648_10091371 Ga0207648_100913713 336
155 3300026095 Ga0207676_10037978 Ga0207676_100379781 336
156 3300026095 Ga0207676_10061021 Ga0207676_100610212 336
157 3300026095 Ga0207676_10150233 Ga0207676_101502332 336
158 3300026118 Ga0207675_100028483 Ga0207675_1000284833 336
159 3300026121 Ga0207683_10000011 Ga0207683_1000001146 336
160 3300028380 Ga0268265_10166903 Ga0268265_101669032 336
161 3300028381 Ga0268264_10001396 Ga0268264_1000139612 336
162 3300031852 Ga0307410_10028113 Ga0307410_100281134 336
163 3300032002 Ga0307416_100107404 Ga0307416_1001074042 336
164 3300032126 Ga0307415_100036713 Ga0307415_1000367132 336
165 3300035691 Ga0373931_0202845 Ga0373931_0202845_35_1048 336
166 3300036401 Ga0373937_0164258 Ga0373937_0164258_680_1693 336
167 3300050511 nmdc:mga08y16_269009_c1 nmdc:mga08y16_269009_c1_71_1081 336
168 3300053077 Ga0495601_0070055 Ga0495601_0070055_1030_2043 336
169 iso_pu_bacteria 8005484373 8005487771 336
170 3300009147 Ga0114129_10390795 Ga0114129_103907952 337
171 iso_pu_bacteria 2509276021 2509387373 337
172 iso_pu_bacteria 2509276033 2509442765 337
173 iso_pu_bacteria 2510065019 2510132624 337
174 iso_pu_bacteria 2513237084 2513570235 337
175 iso_pu_bacteria 2513237085 2513575693 337
176 iso_pu_bacteria 2513237093 2513636319 337
177 iso_pu_bacteria 2513237103 2513710486 337
178 iso_pu_bacteria 2513237162 2514019664 337
179 iso_pu_bacteria 2515154114 2515641910 337
180 iso_pu_bacteria 2515154116 2515655929 337
181 iso_pu_bacteria 2515154134 2515739315 337
182 iso_pu_bacteria 2516653085 2517075799 337
183 iso_pu_bacteria 2517093000 2517094383 337
184 iso_pu_bacteria 2524023209 2524459226 337
185 iso_pu_bacteria 2529292951 2530644919 337
186 iso_pu_bacteria 2617270742 2617385441 337
187 iso_pu_bacteria 2643221689 2644500243 337
188 iso_pu_bacteria 2718218235 2720631017 337
189 iso_pu_bacteria 2718218269 2720774655 337
190 iso_pu_bacteria 2721755685 2723566543 337
191 iso_pu_bacteria 2721755819 2724089262 337
192 iso_pu_bacteria 2721755822 2724103808 337
193 iso_pu_bacteria 2765235942 2766063642 337
194 iso_pu_bacteria 2775507266 2778176939 337
195 iso_pu_bacteria 2791355262 2793335160 337
196 iso_pu_bacteria 2791355266 2793364231 337
197 iso_pu_bacteria 2802429605 2805930123 337
198 iso_pu_bacteria 2838042994 2838047768 337
199 iso_pu_bacteria 2838068647 2838071143 337
200 iso_pu_bacteria 2838686498 2838693487 337
201 iso_pu_bacteria 2838729681 2838735243 337
202 iso_pu_bacteria 2838742623 2838747906 337
203 iso_pu_bacteria 2841851746 2841857998 337
204 iso_pu_bacteria 2841864319 2841865154 337
205 iso_pu_bacteria 2842156927 2842162944 337
206 iso_pu_bacteria 2842163707 2842165247 337
207 iso_pu_bacteria 2842180545 2842186526 337
208 iso_pu_bacteria 2842217011 2842220339 337
209 iso_pu_bacteria 2842229732 2842235730 337
210 iso_pu_bacteria 2842243621 2842248995 337
211 iso_pu_bacteria 2842257432 2842262950 337
212 iso_pu_bacteria 2842271015 2842277906 337
213 iso_pu_bacteria 2842298080 2842301014 337
214 iso_pu_bacteria 2842317721 2842322892 337
215 iso_pu_bacteria 2842357229 2842359972 337
216 iso_pu_bacteria 2842422224 2842425201 337
217 iso_pu_bacteria 2842482326 2842484292 337
218 iso_pu_bacteria 2842489311 2842494535 337
219 iso_pu_bacteria 2842509118 2842513803 337
220 iso_pu_bacteria 2844454524 2844454799 337
221 iso_pu_bacteria 2857516855 2857523384 337
222 iso_pu_bacteria 2933599457 2933601942 337
223 iso_pu_bacteria 2935901341 2935908122 337
224 iso_pu_bacteria 2936367885 2936373434 337
225 iso_pu_bacteria 2936375103 2936379519 337
226 iso_pu_bacteria 2936381700 2936387684 337
227 iso_pu_bacteria 3005416602 3005420895 337
228 iso_pu_bacteria 639633055 639647749 337
229 iso_pu_bacteria 8005282627 8005284057 337
230 iso_pu_bacteria 8005307578 8005314877 337
231 iso_pu_bacteria 8005314921 8005319370 337
232 iso_pu_bacteria 8005376324 8005378547 337
233 iso_pu_bacteria 8005556819 8005558360 337
234 iso_pu_bacteria 8005563573 8005569634 337
235 iso_pu_bacteria 8023680758 8023682141 337
236 iso_pu_bacteria 8024501048 8024504992 337
237 3300002737 JGI25162J39368_1000111 JGI25162J39368_100011148 338
238 3300006175 Ga0070712_100003321 Ga0070712_1000033214 339
239 3300042876 Ga0451577_0133190 Ga0451577_0133190_800_1822 339
240 3300044673 Ga0453683_0036379 Ga0453683_0036379_915_2012 339
241 3300045051 Ga0451576_0000239 Ga0451576_0000239_122504_123526 339
242 3300046452 Ga0495617_000050 Ga0495617_000050_103898_104920 339
243 3300046471 Ga0495650_0000477 Ga0495650_0000477_3845_4867 339
244 3300046471 Ga0495650_0006288 Ga0495650_0006288_4088_5110 339
245 3300046492 Ga0495585_0003363 Ga0495585_0003363_8010_9032 339
246 3300046501 Ga0495607_0009421 Ga0495607_0009421_2393_3415 339
247 3300046507 Ga0495606_0000229 Ga0495606_0000229_38026_39048 339
248 3300046512 Ga0495610_0006414 Ga0495610_0006414_5898_6920 339
249 3300046524 Ga0495648_0015065 Ga0495648_0015065_4022_5044 339
250 3300046524 Ga0495648_0019743 Ga0495648_0019743_2502_3524 339
251 3300046616 Ga0495668_0000118 Ga0495668_0000118_68072_69094 339
252 3300046616 Ga0495668_0005386 Ga0495668_0005386_4006_5028 339
253 3300046616 Ga0495668_0006680 Ga0495668_0006680_3489_4511 339
254 3300046660 Ga0495625_0079565 Ga0495625_0079565_533_1555 339
255 3300046665 Ga0495661_0008216 Ga0495661_0008216_242_1264 339
256 3300046810 Ga0495660_0004552 Ga0495660_0004552_4896_5918 339
257 3300047446 Ga0495679_006871 Ga0495679_006871_636_1658 339
258 3300047469 Ga0495673_0000049 Ga0495673_0000049_230683_231705 339
259 3300047472 Ga0495686_0007958 Ga0495686_0007958_3270_4292 339
260 3300048925 Ga0496122_0140945 Ga0496122_0140945_363_1385 339
261 3300048926 Ga0496123_0009320 Ga0496123_0009320_5690_6712 339
262 3300048927 Ga0496124_0042621 Ga0496124_0042621_556_1578 339
263 3300048927 Ga0496124_0091593 Ga0496124_0091593_1328_2350 339
264 3300013102 Ga0157371_10000001 Ga0157371_10000001138 340
265 3300037312 Ga0395899_0000028 Ga0395899_0000028_300484_301509 340
266 3300042139 Ga0450904_000690 Ga0450904_000690_2195_3220 340
267 3300046518 Ga0495631_0004975 Ga0495631_0004975_5634_6704 340
268 3300046538 Ga0495609_0003736 Ga0495609_0003736_4969_5994 340
269 3300046648 Ga0495611_0036654 Ga0495611_0036654_337_1407 340
270 3300047320 Ga0495672_0155316 Ga0495672_0155316_62_1132 340
271 3300047445 Ga0495677_0035335 Ga0495677_0035335_474_1499 340
272 3300047469 Ga0495673_0017129 Ga0495673_0017129_1768_2838 340
273 3300048091 Ga0495626_0040566 Ga0495626_0040566_546_1616 340
274 3300002705 JGI25156J39149_1000405 JGI25156J39149_100040514 341
275 3300002738 JGI25154J39366_1000342 JGI25154J39366_100034211 341
276 3300002741 JGI25157J39369_1000437 JGI25157J39369_100043714 341
277 3300003215 JGI25153J46596_10007535 JGI25153J46596_100075351 341
278 3300003215 JGI25153J46596_10020052 JGI25153J46596_100200522 341
279 3300005458 Ga0070681_10297410 Ga0070681_102974101 341
280 3300025206 Ga0209435_100039 Ga0209435_10003998 341
281 3300025246 Ga0209646_1000137 Ga0209646_100013713 341
282 3300025250 Ga0209026_1000135 Ga0209026_100013598 341
283 3300025256 Ga0209759_1000154 Ga0209759_100015413 341
284 3300025258 Ga0209129_1008642 Ga0209129_10086423 341
285 3300025294 Ga0209025_1059738 Ga0209025_10597382 341
286 3300025297 Ga0209758_1001568 Ga0209758_10015682 341
287 3300025297 Ga0209758_1006356 Ga0209758_10063565 341
288 3300025303 Ga0209051_1031610 Ga0209051_10316102 341
289 3300041492 Ga0451835_0324511 Ga0451835_0324511_70_1095 341
290 3300041492 Ga0451835_0941431 Ga0451835_0941431_317_1342 341
291 3300041494 Ga0451837_0240248 Ga0451837_0240248_350_1375 341
292 3300041494 Ga0451837_0272173 Ga0451837_0272173_2491_3516 341
293 3300041494 Ga0451837_0906286 Ga0451837_0906286_3715_4740 341
294 3300041496 Ga0451839_0211155 Ga0451839_0211155_4609_5634 341
295 3300041498 Ga0451841_1266462 Ga0451841_1266462_647_1672 341
296 3300041501 Ga0451845_0075806 Ga0451845_0075806_1149_2174 341
297 3300041501 Ga0451845_0526932 Ga0451845_0526932_149_1174 341
298 3300041503 Ga0451847_0335240 Ga0451847_0335240_1517_2542 341
299 3300041503 Ga0451847_0948397 Ga0451847_0948397_680_1705 341
300 3300041505 Ga0451849_0721008 Ga0451849_0721008_308_1333 341
301 3300041505 Ga0451849_0842790 Ga0451849_0842790_27_1052 341
302 3300041505 Ga0451849_1450724 Ga0451849_1450724_56_1081 341
303 3300041507 Ga0451851_1300334 Ga0451851_1300334_862_1887 341
304 3300041512 Ga0451853_4000486 Ga0451853_4000486_287_1312 341
305 3300046460 Ga0495638_0070314 Ga0495638_0070314_272_1297 341
306 3300046492 Ga0495585_0019538 Ga0495585_0019538_144_1169 341
307 3300046501 Ga0495607_0037841 Ga0495607_0037841_167_1192 341
308 3300046513 Ga0495616_0060332 Ga0495616_0060332_59_1084 341
309 3300046515 Ga0495620_0017146 Ga0495620_0017146_143_1168 341
310 3300046518 Ga0495631_0037336 Ga0495631_0037336_781_1806 341
311 3300046519 Ga0495632_0046253 Ga0495632_0046253_368_1393 341
312 3300046530 Ga0495654_0046334 Ga0495654_0046334_1002_2027 341
313 3300046538 Ga0495609_0046736 Ga0495609_0046736_83_1108 341
314 3300046558 Ga0495633_0104058 Ga0495633_0104058_169_1194 341
315 3300046616 Ga0495668_0057598 Ga0495668_0057598_253_1278 341
316 3300046660 Ga0495625_0031914 Ga0495625_0031914_1677_2702 341
317 3300046660 Ga0495625_0035970 Ga0495625_0035970_1573_2598 341
318 3300046694 Ga0495649_0053602 Ga0495649_0053602_881_1906 341
319 3300047443 Ga0495687_030930 Ga0495687_030930_366_1391 341
320 3300047472 Ga0495686_0059832 Ga0495686_0059832_1018_2043 341
321 3300048927 Ga0496124_0009304 Ga0496124_0009304_8531_9565 341
322 3300053118 Ga0500594_0024019 Ga0500594_0024019_398_1423 341
323 3300053134 Ga0500658_0001854 Ga0500658_0001854_5259_6284 341
324 3300053153 Ga0500616_0006201 Ga0500616_0006201_1567_2592 341

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18288

FAA_hydro_N_2

Fumarylacetoacetase N-terminal domain 2

1

78

1

PF01557

FAA_hydrolase

Fumarylacetoacetate (FAA) hydrolase family

81

324

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lzk-assembly1.cif.gz_B the crystal structure of a probably aromatic amino acid degradation protein from sinorhizobium meliloti 1021 0.9531 1 337
3lzk-assembly1.cif.gz_B the crystal structure of a probably aromatic amino acid degradation protein from sinorhizobium meliloti 1021 0.9449 1 337
6v77-assembly1.cif.gz_A crystal structure of a putative hpce protein from mycobacterium smegmatis 0.8278 1 333
6v77-assembly1.cif.gz_A crystal structure of a putative hpce protein from mycobacterium smegmatis 0.8222 1 333
6v77-assembly1.cif.gz_B crystal structure of a putative hpce protein from mycobacterium smegmatis 0.807 1 336
ID Description Score Start End Superfamily
3lzkB00 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9513 2 337 3.90.850.10
3lzkB00 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9428 2 337 3.90.850.10
af_Q96GK7_51_314_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.8266 35 332 3.90.850.10
6jvvA02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.8262 112 335 3.90.850.10
1gttA02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.8233 75 336 3.90.850.10
ID Description Score Start End GO Terms
AF-A0A355SNV8-F1-model_v4 deleted 0.9789 197 338
AF-A0A527IS94-F1-model_v4 2-keto-4-pentenoate hydratase 0.9781 215 337 GO:0003824
AF-A0A2D9RAX5-F1-model_v4 2-keto-4-pentenoate hydratase 0.974 1 85 GO:0003824
AF-A0A527IS94-F1-model_v4 2-keto-4-pentenoate hydratase 0.9704 215 337 GO:0003824
AF-A0A068YM43-F1-model_v4 Fumarylacetoacetate hydrolase family protein 0.9694 127 335 GO:0016787

Feature Viewer

pLDDT pTM Quality
89.13 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map