F406940

General Info

Members Datasets Scaffolds Average Seq Length
323 267 197 151

Family's Representative Sequence

Representative Sequence 3300025303|Ga0209051_1041421|Ga0209051_10414212
Length 178
Sequence VRLSFAVGGFDAGLTAARLSTAKKEDVMSEVDLPWEGGCRCGRVRLKISAKPLLTMACHCTGCQKMSSSAYSLSAAIPAEGFAITEGEPVVGGLHGAEAHHYFCGHCMTWMFTRSEGMDWFVNLRPTMLDDPRWFKPFIETWTREKLPFAETGAARSYEALPEMDAYEGLVKEYMACG

Samples

Sample ID Description Type Environment
1 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
2 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
3 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
4 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
5 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
6 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
7 2516143018 Ensifer sp. BR816 Isolate Nodule
8 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
9 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
10 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
11 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
12 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
13 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
14 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
15 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
16 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
17 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
18 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
19 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
20 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
21 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
22 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
23 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
24 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
25 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
26 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
27 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
28 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
29 2643221599 Rhizobium sp. Root708 Isolate Unclassified
30 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
31 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
32 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
33 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
34 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
35 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
36 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
37 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
38 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
39 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
40 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
41 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
42 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
43 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
44 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
45 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
46 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
47 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
48 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
49 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
50 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
51 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
52 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
53 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
54 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
55 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
56 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
57 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
58 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
59 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
60 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
61 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
62 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
63 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
64 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
65 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
66 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
67 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
68 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
69 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
70 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
71 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
72 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
73 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
74 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
75 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
76 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
77 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
78 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
79 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
80 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
81 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
82 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
83 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
84 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
85 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
86 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
87 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
88 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
89 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
90 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
91 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
92 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
93 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
94 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
95 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
96 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
97 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
98 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
99 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
100 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
101 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
102 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
103 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
104 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
105 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
106 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
107 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
108 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
109 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
110 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
111 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
112 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
113 2996887358 Rhizobium sp. R711 Isolate Nodule
114 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
115 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
116 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
117 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
118 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
119 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
120 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
121 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
122 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
123 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
124 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
125 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
126 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
127 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
128 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
129 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
130 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
131 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
132 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
133 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
134 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
135 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
136 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
137 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
138 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
139 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
140 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
141 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
142 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
143 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
144 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
145 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
146 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
147 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
148 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
149 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
150 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
151 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
152 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
153 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
154 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
155 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
156 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
157 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
158 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
159 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
160 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
161 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
162 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
163 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
164 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
165 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
166 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
167 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
168 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
169 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
171 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
172 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
173 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
174 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
176 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
177 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
178 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
180 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
181 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
199 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
203 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
204 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
205 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
206 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
207 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
208 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
209 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
210 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
211 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
212 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
213 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
214 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
215 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
216 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
217 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
218 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
219 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
220 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
221 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
224 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
225 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
226 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
227 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
228 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
229 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
230 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
231 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
232 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
240 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
241 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
242 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
243 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
245 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
246 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
247 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
248 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
249 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
250 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
251 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
252 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
253 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
254 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
255 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
258 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
259 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
260 8005258706 Rhizobium sp. R693 Isolate Nodule
261 8005321885 Rhizobium sp. R72 Isolate Nodule
262 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
263 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
264 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
265 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
266 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere
267 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 60.37
Metatranscriptomes 0.62
Isolates 39.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.91
Nodule 28.17
Rhizoplane 0.93
Rhizosphere 35.29
Stem 0
Stem Tuber 0
Unclassified 12.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000050 3300002704 Bacteria 76996
2 JGI25156J39149_1000074 3300002705 Bacteria 76996
3 JGI25154J39366_1000099 3300002738 Bacteria 76996
4 JGI25157J39369_1000090 3300002741 Bacteria 76996
5 JGI25152J39213_1002681 3300002773 Bacteria 6548
6 JGI25152J39213_1022431 3300002773 Bacteria 1091
7 JGI25159J45721_1000353 3300002987 Bacteria 21229
8 JGI25151J46595_10007417 3300003187 Bacteria 5378
9 rootH1_10052503 3300003316 Bacteria 3318
10 rootL2_10007263 3300003322 Bacteria 4124
11 rootL2_10313196 3300003322 Bacteria 1039
12 JGI25160J50197_1000012 3300003354 Bacteria 267582
13 JGI25160J50197_1000116 3300003354 Bacteria 72316
14 JGI25160J50197_1019843 3300003354 Bacteria 2049
15 JGI25161J50226_1000002 3300003374 Bacteria 420324
16 JGI25161J50226_1000141 3300003374 Bacteria 49853
17 Ga0055526_1066320 3300003771 Bacteria 748
18 Ga0055536_1012525 3300003781 Bacteria 3137
19 Ga0055528_1002346 3300003790 Bacteria 10242
20 Ga0055528_1012227 3300003790 Bacteria 3348
21 Ga0058692_1019979 3300003856 Bacteria 1417
22 Ga0055543_1000011 3300004625 Bacteria 196089
23 Ga0065165_1000082 3300005262 Bacteria 158536
24 Ga0065165_1034632 3300005262 Bacteria 1560
25 Ga0070676_10319219 3300005328 Bacteria 1059
26 Ga0070670_100382981 3300005331 Bacteria 1239
27 Ga0070668_100001825 3300005347 Bacteria 15500
28 Ga0070668_100023151 3300005347 Bacteria 4696
29 Ga0070668_100234549 3300005347 Bacteria 1518
30 Ga0070668_100433528 3300005347 Bacteria 1127
31 Ga0070671_100008057 3300005355 Bacteria 8434
32 Ga0070667_100974270 3300005367 Bacteria 791
33 Ga0070667_101603646 3300005367 Bacteria 612
34 Ga0070663_100160539 3300005455 Bacteria 1730
35 Ga0070672_101255327 3300005543 Bacteria 661
36 Ga0070665_100166884 3300005548 Bacteria 2204
37 Ga0068852_101061461 3300005616 Bacteria 830
38 Ga0068859_100852538 3300005617 Bacteria 997
39 Ga0068861_100305314 3300005719 Bacteria 1380
40 Ga0068860_100000109 3300005843 Bacteria 132169
41 Ga0068860_100072457 3300005843 Bacteria 3274
42 Ga0068862_100010673 3300005844 Bacteria 7588
43 Ga0068862_100270584 3300005844 Bacteria 1553
44 Ga0068862_101128471 3300005844 Bacteria 780
45 Ga0075365_10007044 3300006038 Bacteria 6261
46 Ga0075365_10517551 3300006038 Bacteria 843
47 Ga0075368_10171431 3300006042 Bacteria 912
48 Ga0075368_10294886 3300006042 Bacteria 699
49 Ga0075363_100261224 3300006048 Bacteria 999
50 Ga0075364_10497474 3300006051 Bacteria 833
51 Ga0075362_10082077 3300006177 Bacteria 1487
52 Ga0075367_10115702 3300006178 Bacteria 1649
53 Ga0075369_10003537 3300006186 Bacteria 5687
54 Ga0075369_10276559 3300006186 Bacteria 782
55 Ga0075366_10287722 3300006195 Bacteria 1005
56 Ga0075370_10011402 3300006353 Bacteria 4669
57 Ga0075370_10320826 3300006353 Bacteria 923
58 Ga0097620_100852342 3300006931 Bacteria 997
59 Ga0105244_10264503 3300009036 Bacteria 800
60 Ga0105244_10272245 3300009036 Bacteria 786
61 Ga0105240_10044701 3300009093 Bacteria 5625
62 Ga0105240_10123799 3300009093 Bacteria 3110
63 Ga0105243_10674804 3300009148 Bacteria 1004
64 Ga0105243_11464409 3300009148 Bacteria 705
65 Ga0105238_11612826 3300009551 Bacteria 679
66 Ga0105238_12258788 3300009551 Bacteria 579
67 Ga0105249_12059785 3300009553 Bacteria 643
68 Ga0123342_1012423 3300009766 Bacteria 8908
69 Ga0157370_10890021 3300013104 Bacteria 808
70 Ga0157372_10323550 3300013307 Bacteria 1795
71 Ga0163161_11081058 3300017792 Bacteria 689
72 Ga0209435_100063 3300025206 Bacteria 77066
73 Ga0207425_1025770 3300025245 Bacteria 1211
74 Ga0209646_1000187 3300025246 Bacteria 77066
75 Ga0209026_1000227 3300025250 Bacteria 77066
76 Ga0209148_1014682 3300025254 Bacteria 1381
77 Ga0209759_1000258 3300025256 Bacteria 77066
78 Ga0209129_1000066 3300025258 Bacteria 226820
79 Ga0209129_1002598 3300025258 Bacteria 8634
80 Ga0209673_1000024 3300025273 Bacteria 409632
81 Ga0209673_1013355 3300025273 Bacteria 3245
82 Ga0209130_1000028 3300025284 Bacteria 325668
83 Ga0209676_1009960 3300025292 Bacteria 4025
84 Ga0209676_1025912 3300025292 Bacteria 1872
85 Ga0209025_1000275 3300025294 Bacteria 119220
86 Ga0209025_1008882 3300025294 Bacteria 7117
87 Ga0209025_1012716 3300025294 Bacteria 5365
88 Ga0209025_1041349 3300025294 Bacteria 1976
89 Ga0209025_1129598 3300025294 Bacteria 736
90 Ga0209025_1136141 3300025294 Bacteria 704
91 Ga0209564_1012487 3300025295 Bacteria 3699
92 Ga0209758_1000058 3300025297 Bacteria 331603
93 Ga0209758_1021306 3300025297 Bacteria 3025
94 Ga0209758_1101454 3300025297 Bacteria 817
95 Ga0209050_1017838 3300025298 Bacteria 2802
96 Ga0209050_1034294 3300025298 Bacteria 1521
97 Ga0209256_1001719 3300025299 Bacteria 21003
98 Ga0207426_1000012 3300025302 Bacteria 730942
99 Ga0207426_1000608 3300025302 Bacteria 46209
100 Ga0209051_1041421 3300025303 Bacteria 1638
101 Ga0209051_1065692 3300025303 Bacteria 1117
102 Ga0209051_1096467 3300025303 Bacteria 807
103 Ga0209051_1118478 3300025303 Bacteria 676
104 Ga0209257_1002539 3300025304 Bacteria 17877
105 Ga0209257_1014016 3300025304 Bacteria 3493
106 Ga0209257_1038325 3300025304 Bacteria 1453
107 Ga0207647_10043190 3300025904 Bacteria 2822
108 Ga0207707_10215082 3300025912 Bacteria 1673
109 Ga0207695_10012685 3300025913 Bacteria 10093
110 Ga0207695_10027954 3300025913 Bacteria 6268
111 Ga0207671_11069869 3300025914 Bacteria 634
112 Ga0207660_10172227 3300025917 Bacteria 1676
113 Ga0207681_10939734 3300025923 Bacteria 725
114 Ga0207681_11214980 3300025923 Bacteria 633
115 Ga0207644_10276791 3300025931 Bacteria 1346
116 Ga0207669_10277261 3300025937 Bacteria 1263
117 Ga0207711_10278811 3300025941 Bacteria 1539
118 Ga0207712_10030451 3300025961 Bacteria 3628
119 Ga0207668_10008292 3300025972 Bacteria 6190
120 Ga0207668_10126039 3300025972 Bacteria 1947
121 Ga0207658_10466403 3300025986 Bacteria 1120
122 Ga0207678_10175714 3300026067 Bacteria 1829
123 Ga0207678_11012981 3300026067 Bacteria 735
124 Ga0207675_100175173 3300026118 Bacteria 2052
125 Ga0209371_1002861 3300027312 Bacteria 9090
126 Ga0209813_10181950 3300027866 Bacteria 769
127 Ga0268266_11147319 3300028379 Bacteria 752
128 Ga0268265_10011675 3300028380 Bacteria 5940
129 Ga0268265_10247001 3300028380 Bacteria 1578
130 Ga0268264_10000002 3300028381 Bacteria 1153045
131 Ga0307515_10002654 3300028794 Bacteria 38313
132 Ga0307413_10570883 3300031824 Bacteria 921
133 Ga0307410_10192964 3300031852 Bacteria 1550
134 Ga0307412_10205405 3300031911 Bacteria 1499
135 Ga0307415_100220769 3300032126 Bacteria 1519
136 Ga0307415_102375303 3300032126 Bacteria 521
137 Ga0307510_10189019 3300033180 Bacteria 1610
138 Ga0439453_0010319 3300041408 Bacteria 1538
139 Ga0439458_0031516 3300042157 Bacteria 1264
140 Ga0439435_0001675 3300042436 Bacteria 4171
141 Ga0466966_0102013 3300044684 Bacteria 1774
142 Ga0466963_0213851 3300044694 Bacteria 1349
143 Ga0466963_1197114 3300044694 Bacteria 534
144 Ga0466970_0013890 3300044765 Bacteria 4130
145 Ga0466958_0007443 3300045836 Bacteria 6024
146 Ga0495638_0511966 3300046460 Bacteria 603
147 Ga0495620_0102521 3300046515 Bacteria 1140
148 Ga0495643_0252799 3300046522 Bacteria 822
149 Ga0495633_0015407 3300046558 Bacteria 3967
150 Ga0495625_0073334 3300046660 Bacteria 2400
151 Ga0495625_0097267 3300046660 Bacteria 2026
152 Ga0495625_0328690 3300046660 Bacteria 972
153 Ga0495686_0021491 3300047472 Bacteria 4284
154 Ga0495686_0411147 3300047472 Bacteria 725
155 Ga0496105_0833321 3300048908 Bacteria 699
156 Ga0496106_0403164 3300048909 Bacteria 1099
157 Ga0496107_0190689 3300048910 Bacteria 1523
158 Ga0496116_0461470 3300048919 Bacteria 540
159 Ga0496118_0267762 3300048921 Bacteria 960
160 Ga0496121_0023881 3300048924 Bacteria 5866
161 Ga0496121_0047576 3300048924 Bacteria 3658
162 Ga0496121_0150046 3300048924 Bacteria 1716
163 Ga0496121_0206206 3300048924 Bacteria 1396
164 Ga0496122_0160375 3300048925 Bacteria 1372
165 Ga0496123_0141286 3300048926 Bacteria 1316
166 Ga0496124_0131323 3300048927 Bacteria 1989
167 Ga0496124_0236824 3300048927 Bacteria 1360
168 Ga0496125_0085628 3300048928 Bacteria 2387
169 Ga0496126_0573908 3300048929 Bacteria 892
170 Ga0501036_0326322 3300049572 Bacteria 1282
171 Ga0501037_0270641 3300049573 Bacteria 1185
172 Ga0501038_0746447 3300049574 Bacteria 730
173 Ga0501039_0088950 3300049575 Bacteria 2406
174 Ga0501043_0390950 3300049579 Bacteria 1052
175 Ga0501047_0300052 3300049581 Bacteria 1449
176 Ga0501048_0755813 3300049582 Bacteria 698
177 Ga0501068_0608151 3300049584 Bacteria 712
178 Ga0501073_0265440 3300049589 Bacteria 1185
179 Ga0501074_0360956 3300049590 Bacteria 1031
180 Ga0501080_0283938 3300049742 Bacteria 1504
181 Ga0501035_0217230 3300049822 Bacteria 1634
182 Ga0501044_1294466 3300049823 Bacteria 595
183 nmdc:mga06z11_191850_c1 3300050494 Bacteria 1183
184 nmdc:mga0sz30_112578_c1 3300050516 Bacteria 1193
185 Ga0500647_0011191 3300053091 Bacteria 3995
186 Ga0500569_019019 3300053109 Bacteria 1782
187 Ga0500618_005168 3300053125 Bacteria 4012
188 Ga0500568_0025940 3300053139 Bacteria 2464
189 Ga0500604_0000027 3300053151 Bacteria 62112
190 Ga0500616_0000730 3300053153 Bacteria 38013
191 Ga0500616_0000798 3300053153 Bacteria 36041
192 Ga0500620_001594 3300053155 Bacteria 4261
193 Ga0500627_0159917 3300053158 Bacteria 1016
194 Ga0500627_0220653 3300053158 Bacteria 846
195 Ga0500627_0305152 3300053158 Bacteria 694
196 Ga0587088_050876 3300059508 Bacteria 811
197 Ga0587111_0128275 3300060346 Bacteria 660

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053109 Ga0500569_019019 Ga0500569_019019_1352_1723 122
2 iso_pu_bacteria 2977828996 2977832454 127
3 3300025914 Ga0207671_11069869 Ga0207671_110698691 130
4 3300048927 Ga0496124_0131323 Ga0496124_0131323_225_623 132
5 3300044694 Ga0466963_0213851 Ga0466963_0213851_294_767 135
6 3300044765 Ga0466970_0013890 Ga0466970_0013890_746_1219 135
7 3300045836 Ga0466958_0007443 Ga0466958_0007443_4690_5163 135
8 3300048908 Ga0496105_0833321 Ga0496105_0833321_248_655 135
9 3300009553 Ga0105249_12059785 Ga0105249_120597852 141
10 3300046515 Ga0495620_0102521 Ga0495620_0102521_593_1042 141
11 3300053158 Ga0500627_0220653 Ga0500627_0220653_287_736 141
12 3300009148 Ga0105243_11464409 Ga0105243_114644091 142
13 3300046460 Ga0495638_0511966 Ga0495638_0511966_134_583 142
14 iso_pu_bacteria 2508501114 2509075559 143
15 3300053153 Ga0500616_0000798 Ga0500616_0000798_10659_11093 144
16 iso_pu_bacteria 2643221599 2644004208 145
17 iso_pu_bacteria 2871495908 2871501698 145
18 iso_pu_bacteria 2878760144 2878765615 145
19 iso_pu_bacteria 2878767105 2878772805 145
20 iso_pu_bacteria 2903540706 2903546516 145
21 iso_pu_bacteria 2924762789 2924765954 145
22 iso_pu_bacteria 2937822353 2937823356 145
23 iso_pu_bacteria 2937994558 2938000378 145
24 iso_pu_bacteria 2958165035 2958170785 145
25 iso_pu_bacteria 2961163497 2961169236 145
26 iso_pu_bacteria 2965018300 2965023976 145
27 iso_pu_bacteria 2968171901 2968177619 145
28 iso_pu_bacteria 2970554993 2970560465 145
29 iso_pu_bacteria 2987659509 2987665324 145
30 iso_pu_bacteria 2987666974 2987668529 145
31 iso_pu_bacteria 3004188549 3004194377 145
32 iso_pu_bacteria 3005452660 3005456207 145
33 iso_pu_bacteria 8057101203 8057102127 145
34 3300046660 Ga0495625_0097267 Ga0495625_0097267_359_799 146
35 iso_pu_bacteria 2582581866 2585396393 146
36 iso_pu_bacteria 2791355091 2792620244 146
37 iso_pu_bacteria 2791355092 2792626336 146
38 iso_pu_bacteria 2847686936 2847687565 146
39 iso_pu_bacteria 2856349417 2856353276 146
40 iso_pu_bacteria 2856356410 2856357911 146
41 iso_pu_bacteria 2869162929 2869167897 146
42 iso_pu_bacteria 2871444079 2871445181 146
43 iso_pu_bacteria 2871488783 2871492025 146
44 iso_pu_bacteria 2874102143 2874104292 146
45 iso_pu_bacteria 2876369609 2876377004 146
46 iso_pu_bacteria 2876392853 2876395368 146
47 iso_pu_bacteria 2878753008 2878755760 146
48 iso_pu_bacteria 2881147464 2881153209 146
49 iso_pu_bacteria 2881155292 2881156961 146
50 iso_pu_bacteria 2881161766 2881161901 146
51 iso_pu_bacteria 2881845957 2881852352 146
52 iso_pu_bacteria 2881853255 2881856237 146
53 iso_pu_bacteria 2881861095 2881863937 146
54 iso_pu_bacteria 2882912400 2882917871 146
55 iso_pu_bacteria 2885318864 2885324636 146
56 iso_pu_bacteria 2885342637 2885348041 146
57 iso_pu_bacteria 2885350715 2885354304 146
58 iso_pu_bacteria 2888350351 2888357533 146
59 iso_pu_bacteria 2889010040 2889012486 146
60 iso_pu_bacteria 2889016732 2889022618 146
61 iso_pu_bacteria 2903492973 2903503588 146
62 iso_pu_bacteria 2904659560 2904661998 146
63 iso_pu_bacteria 2906328253 2906332420 146
64 iso_pu_bacteria 2906354277 2906361580 146
65 iso_pu_bacteria 2922130491 2922131876 146
66 iso_pu_bacteria 2922185730 2922191807 146
67 iso_pu_bacteria 2924726620 2924728426 146
68 iso_pu_bacteria 2924784321 2924787516 146
69 iso_pu_bacteria 2958100919 2958103675 146
70 iso_pu_bacteria 2958115193 2958117453 146
71 iso_pu_bacteria 2958172287 2958179054 146
72 iso_pu_bacteria 2961114664 2961117152 146
73 iso_pu_bacteria 2961127735 2961131765 146
74 iso_pu_bacteria 2961170736 2961173921 146
75 iso_pu_bacteria 2965062239 2965063668 146
76 iso_pu_bacteria 2965119406 2965121791 146
77 iso_pu_bacteria 2967996073 2967999072 146
78 iso_pu_bacteria 2968003550 2968006756 146
79 iso_pu_bacteria 2968097103 2968099436 146
80 iso_pu_bacteria 2968110612 2968113060 146
81 iso_pu_bacteria 2968128360 2968132104 146
82 iso_pu_bacteria 2970503327 2970506510 146
83 iso_pu_bacteria 2977821940 2977824979 146
84 iso_pu_bacteria 2977858184 2977858256 146
85 iso_pu_bacteria 2977971508 2977974228 146
86 iso_pu_bacteria 2979710463 2979713509 146
87 iso_pu_bacteria 2979742915 2979749887 146
88 iso_pu_bacteria 2979779861 2979786147 146
89 iso_pu_bacteria 2979808191 2979811158 146
90 iso_pu_bacteria 2996341866 2996342954 146
91 iso_pu_bacteria 8004374579 8004377342 146
92 iso_pu_bacteria 8004445564 8004450936 146
93 iso_pu_bacteria 8004703790 8004711338 146
94 iso_pu_bacteria 2510917022 2511133300 147
95 iso_pu_bacteria 2510917026 2511169415 147
96 iso_pu_bacteria 2510917028 2511185546 147
97 iso_pu_bacteria 2513237088 2513599554 147
98 iso_pu_bacteria 2513237138 2513868502 147
99 iso_pu_bacteria 2524023209 2524457950 147
100 iso_pu_bacteria 2534681796 2535514442 147
101 iso_pu_bacteria 2582581294 2585201428 147
102 iso_pu_bacteria 2582581307 2585273521 147
103 iso_pu_bacteria 2582581308 2585280965 147
104 iso_pu_bacteria 2582581315 2585326396 147
105 iso_pu_bacteria 2582581316 2585330549 147
106 iso_pu_bacteria 2582581867 2585405062 147
107 iso_pu_bacteria 2585427527 2585533903 147
108 iso_pu_bacteria 2585427530 2585553560 147
109 iso_pu_bacteria 2585427531 2585559694 147
110 iso_pu_bacteria 2585427590 2585825131 147
111 iso_pu_bacteria 2585427608 2585900381 147
112 iso_pu_bacteria 2585427609 2585906127 147
113 iso_pu_bacteria 2585427633 2585996730 147
114 iso_pu_bacteria 2585427634 2586001258 147
115 iso_pu_bacteria 2585428125 2587978758 147
116 iso_pu_bacteria 2615840626 2616309518 147
117 iso_pu_bacteria 2615840698 2616556140 147
118 iso_pu_bacteria 2617270742 2617380660 147
119 iso_pu_bacteria 2643221643 2644237857 147
120 iso_pu_bacteria 2775507266 2778173765 147
121 iso_pu_bacteria 2818991448 2819608815 147
122 iso_pu_bacteria 2818991453 2819640914 147
123 iso_pu_bacteria 2842298080 2842299868 147
124 iso_pu_bacteria 2842357229 2842359610 147
125 iso_pu_bacteria 2842509118 2842513109 147
126 iso_pu_bacteria 2852387548 2852387931 147
127 iso_pu_bacteria 2854896431 2854901397 147
128 iso_pu_bacteria 2854916844 2854918988 147
129 iso_pu_bacteria 2923556063 2923561724 147
130 iso_pu_bacteria 2939669807 2939670217 147
131 iso_pu_bacteria 2996887358 2996889764 147
132 iso_pu_bacteria 8005258706 8005261610 147
133 iso_pu_bacteria 8005321885 8005324291 147
134 iso_pu_bacteria 8005484373 8005484531 147
135 iso_pu_bacteria 8005542996 8005543078 147
136 iso_pu_bacteria 8005645114 8005649228 147
137 iso_pu_bacteria 8046767195 8046769707 147
138 iso_pu_bacteria 8057575449 8057582393 147
139 iso_pu_bacteria 2516143018 2516209797 148
140 3300003781 Ga0055536_1012525 Ga0055536_10125252 149
141 3300005328 Ga0070676_10319219 Ga0070676_103192192 149
142 3300005367 Ga0070667_101603646 Ga0070667_1016036461 149
143 3300005843 Ga0068860_100072457 Ga0068860_1000724573 149
144 3300006038 Ga0075365_10517551 Ga0075365_105175511 149
145 3300006051 Ga0075364_10497474 Ga0075364_104974741 149
146 3300006186 Ga0075369_10276559 Ga0075369_102765592 149
147 3300009551 Ga0105238_11612826 Ga0105238_116128261 149
148 3300009551 Ga0105238_12258788 Ga0105238_122587881 149
149 3300017792 Ga0163161_11081058 Ga0163161_110810581 149
150 3300025292 Ga0209676_1009960 Ga0209676_10099604 149
151 3300025298 Ga0209050_1017838 Ga0209050_10178381 149
152 3300025304 Ga0209257_1002539 Ga0209257_10025393 149
153 3300025923 Ga0207681_10939734 Ga0207681_109397342 149
154 3300025937 Ga0207669_10277261 Ga0207669_102772611 149
155 3300046660 Ga0495625_0328690 Ga0495625_0328690_100_549 149
156 3300047472 Ga0495686_0411147 Ga0495686_0411147_221_670 149
157 3300053139 Ga0500568_0025940 Ga0500568_0025940_820_1278 149
158 3300053151 Ga0500604_0000027 Ga0500604_0000027_52042_52509 149
159 3300053153 Ga0500616_0000730 Ga0500616_0000730_27484_27942 149
160 3300053158 Ga0500627_0159917 Ga0500627_0159917_262_711 149
161 3300060346 Ga0587111_0128275 Ga0587111_0128275_139_591 149
162 3300002773 JGI25152J39213_1002681 JGI25152J39213_10026813 150
163 3300003187 JGI25151J46595_10007417 JGI25151J46595_100074176 150
164 3300005262 Ga0065165_1034632 Ga0065165_10346322 150
165 3300005347 Ga0070668_100001825 Ga0070668_10000182516 150
166 3300005347 Ga0070668_100023151 Ga0070668_1000231514 150
167 3300005347 Ga0070668_100433528 Ga0070668_1004335281 150
168 3300005617 Ga0068859_100852538 Ga0068859_1008525381 150
169 3300005719 Ga0068861_100305314 Ga0068861_1003053142 150
170 3300005843 Ga0068860_100000109 Ga0068860_100000109132 150
171 3300005844 Ga0068862_100010673 Ga0068862_1000106736 150
172 3300005844 Ga0068862_100270584 Ga0068862_1002705842 150
173 3300006042 Ga0075368_10171431 Ga0075368_101714312 150
174 3300006195 Ga0075366_10287722 Ga0075366_102877222 150
175 3300006931 Ga0097620_100852342 Ga0097620_1008523422 150
176 3300009036 Ga0105244_10264503 Ga0105244_102645031 150
177 3300025245 Ga0207425_1025770 Ga0207425_10257702 150
178 3300025258 Ga0209129_1000066 Ga0209129_1000066115 150
179 3300025294 Ga0209025_1000275 Ga0209025_100027518 150
180 3300025294 Ga0209025_1129598 Ga0209025_11295981 150
181 3300025294 Ga0209025_1136141 Ga0209025_11361411 150
182 3300025297 Ga0209758_1101454 Ga0209758_11014542 150
183 3300025303 Ga0209051_1065692 Ga0209051_10656922 150
184 3300025303 Ga0209051_1096467 Ga0209051_10964672 150
185 3300025304 Ga0209257_1038325 Ga0209257_10383254 150
186 3300025972 Ga0207668_10008292 Ga0207668_100082924 150
187 3300026067 Ga0207678_11012981 Ga0207678_110129812 150
188 3300026118 Ga0207675_100175173 Ga0207675_1001751732 150
189 3300028380 Ga0268265_10011675 Ga0268265_100116756 150
190 3300028380 Ga0268265_10247001 Ga0268265_102470012 150
191 3300028381 Ga0268264_10000002 Ga0268264_10000002679 150
192 3300028794 Ga0307515_10002654 Ga0307515_1000265420 150
193 3300031852 Ga0307410_10192964 Ga0307410_101929642 150
194 3300031911 Ga0307412_10205405 Ga0307412_102054052 150
195 3300033180 Ga0307510_10189019 Ga0307510_101890193 150
196 3300041408 Ga0439453_0010319 Ga0439453_0010319_276_731 150
197 3300042436 Ga0439435_0001675 Ga0439435_0001675_2775_3230 150
198 3300046558 Ga0495633_0015407 Ga0495633_0015407_55_513 150
199 3300046660 Ga0495625_0073334 Ga0495625_0073334_610_1089 150
200 3300049572 Ga0501036_0326322 Ga0501036_0326322_523_978 150
201 3300049573 Ga0501037_0270641 Ga0501037_0270641_651_1106 150
202 3300049574 Ga0501038_0746447 Ga0501038_0746447_209_664 150
203 3300049575 Ga0501039_0088950 Ga0501039_0088950_1792_2247 150
204 3300049579 Ga0501043_0390950 Ga0501043_0390950_427_882 150
205 3300049581 Ga0501047_0300052 Ga0501047_0300052_469_924 150
206 3300049582 Ga0501048_0755813 Ga0501048_0755813_66_521 150
207 3300049584 Ga0501068_0608151 Ga0501068_0608151_234_689 150
208 3300049589 Ga0501073_0265440 Ga0501073_0265440_675_1130 150
209 3300049590 Ga0501074_0360956 Ga0501074_0360956_391_846 150
210 3300049742 Ga0501080_0283938 Ga0501080_0283938_156_611 150
211 3300049822 Ga0501035_0217230 Ga0501035_0217230_104_559 150
212 3300049823 Ga0501044_1294466 Ga0501044_1294466_76_531 150
213 3300053091 Ga0500647_0011191 Ga0500647_0011191_2936_3412 150
214 3300053155 Ga0500620_001594 Ga0500620_001594_1505_1969 150
215 3300053158 Ga0500627_0305152 Ga0500627_0305152_30_485 150
216 3300002704 JGI25155J39150_1000050 JGI25155J39150_100005027 151
217 3300002705 JGI25156J39149_1000074 JGI25156J39149_100007453 151
218 3300002738 JGI25154J39366_1000099 JGI25154J39366_100009953 151
219 3300002741 JGI25157J39369_1000090 JGI25157J39369_100009027 151
220 3300002773 JGI25152J39213_1022431 JGI25152J39213_10224312 151
221 3300002987 JGI25159J45721_1000353 JGI25159J45721_100035320 151
222 3300003316 rootH1_10052503 rootH1_100525035 151
223 3300003322 rootL2_10007263 rootL2_100072636 151
224 3300003322 rootL2_10313196 rootL2_103131963 151
225 3300003354 JGI25160J50197_1000012 JGI25160J50197_1000012271 151
226 3300003354 JGI25160J50197_1000116 JGI25160J50197_100011627 151
227 3300003354 JGI25160J50197_1019843 JGI25160J50197_10198433 151
228 3300003374 JGI25161J50226_1000002 JGI25161J50226_1000002423 151
229 3300003374 JGI25161J50226_1000141 JGI25161J50226_100014121 151
230 3300003771 Ga0055526_1066320 Ga0055526_10663202 151
231 3300003790 Ga0055528_1002346 Ga0055528_100234610 151
232 3300003790 Ga0055528_1012227 Ga0055528_10122272 151
233 3300003856 Ga0058692_1019979 Ga0058692_10199791 151
234 3300004625 Ga0055543_1000011 Ga0055543_1000011176 151
235 3300005262 Ga0065165_1000082 Ga0065165_1000082140 151
236 3300005331 Ga0070670_100382981 Ga0070670_1003829812 151
237 3300005347 Ga0070668_100234549 Ga0070668_1002345491 151
238 3300005355 Ga0070671_100008057 Ga0070671_1000080576 151
239 3300005367 Ga0070667_100974270 Ga0070667_1009742701 151
240 3300005455 Ga0070663_100160539 Ga0070663_1001605392 151
241 3300005543 Ga0070672_101255327 Ga0070672_1012553271 151
242 3300005548 Ga0070665_100166884 Ga0070665_1001668842 151
243 3300005616 Ga0068852_101061461 Ga0068852_1010614612 151
244 3300005844 Ga0068862_101128471 Ga0068862_1011284712 151
245 3300006038 Ga0075365_10007044 Ga0075365_100070443 151
246 3300006042 Ga0075368_10294886 Ga0075368_102948862 151
247 3300006048 Ga0075363_100261224 Ga0075363_1002612242 151
248 3300006177 Ga0075362_10082077 Ga0075362_100820772 151
249 3300006178 Ga0075367_10115702 Ga0075367_101157022 151
250 3300006186 Ga0075369_10003537 Ga0075369_100035372 151
251 3300006353 Ga0075370_10011402 Ga0075370_100114025 151
252 3300006353 Ga0075370_10320826 Ga0075370_103208262 151
253 3300009036 Ga0105244_10272245 Ga0105244_102722452 151
254 3300009093 Ga0105240_10044701 Ga0105240_100447012 151
255 3300009093 Ga0105240_10123799 Ga0105240_101237992 151
256 3300009148 Ga0105243_10674804 Ga0105243_106748043 151
257 3300009766 Ga0123342_1012423 Ga0123342_10124238 151
258 3300013104 Ga0157370_10890021 Ga0157370_108900212 151
259 3300013307 Ga0157372_10323550 Ga0157372_103235502 151
260 3300025206 Ga0209435_100063 Ga0209435_10006327 151
261 3300025246 Ga0209646_1000187 Ga0209646_100018727 151
262 3300025250 Ga0209026_1000227 Ga0209026_100022727 151
263 3300025254 Ga0209148_1014682 Ga0209148_10146822 151
264 3300025256 Ga0209759_1000258 Ga0209759_100025827 151
265 3300025258 Ga0209129_1002598 Ga0209129_10025981 151
266 3300025273 Ga0209673_1000024 Ga0209673_1000024149 151
267 3300025273 Ga0209673_1013355 Ga0209673_10133553 151
268 3300025284 Ga0209130_1000028 Ga0209130_100002828 151
269 3300025292 Ga0209676_1025912 Ga0209676_10259123 151
270 3300025294 Ga0209025_1008882 Ga0209025_10088828 151
271 3300025294 Ga0209025_1012716 Ga0209025_10127162 151
272 3300025294 Ga0209025_1041349 Ga0209025_10413492 151
273 3300025295 Ga0209564_1012487 Ga0209564_10124873 151
274 3300025297 Ga0209758_1000058 Ga0209758_1000058118 151
275 3300025297 Ga0209758_1021306 Ga0209758_10213062 151
276 3300025298 Ga0209050_1034294 Ga0209050_10342941 151
277 3300025299 Ga0209256_1001719 Ga0209256_10017193 151
278 3300025302 Ga0207426_1000012 Ga0207426_1000012553 151
279 3300025302 Ga0207426_1000608 Ga0207426_100060823 151
280 3300025303 Ga0209051_1041421 Ga0209051_10414212 151
281 3300025303 Ga0209051_1118478 Ga0209051_11184781 151
282 3300025304 Ga0209257_1014016 Ga0209257_10140165 151
283 3300025904 Ga0207647_10043190 Ga0207647_100431903 151
284 3300025912 Ga0207707_10215082 Ga0207707_102150822 151
285 3300025913 Ga0207695_10012685 Ga0207695_100126853 151
286 3300025913 Ga0207695_10027954 Ga0207695_100279542 151
287 3300025917 Ga0207660_10172227 Ga0207660_101722272 151
288 3300025923 Ga0207681_11214980 Ga0207681_112149802 151
289 3300025931 Ga0207644_10276791 Ga0207644_102767912 151
290 3300025941 Ga0207711_10278811 Ga0207711_102788112 151
291 3300025961 Ga0207712_10030451 Ga0207712_100304511 151
292 3300025972 Ga0207668_10126039 Ga0207668_101260392 151
293 3300025986 Ga0207658_10466403 Ga0207658_104664031 151
294 3300026067 Ga0207678_10175714 Ga0207678_101757141 151
295 3300027312 Ga0209371_1002861 Ga0209371_100286113 151
296 3300027866 Ga0209813_10181950 Ga0209813_101819501 151
297 3300028379 Ga0268266_11147319 Ga0268266_111473192 151
298 3300031824 Ga0307413_10570883 Ga0307413_105708832 151
299 3300032126 Ga0307415_100220769 Ga0307415_1002207692 151
300 3300032126 Ga0307415_102375303 Ga0307415_1023753031 151
301 3300042157 Ga0439458_0031516 Ga0439458_0031516_745_1215 151
302 3300044684 Ga0466966_0102013 Ga0466966_0102013_890_1363 151
303 3300044694 Ga0466963_1197114 Ga0466963_1197114_19_474 151
304 3300046522 Ga0495643_0252799 Ga0495643_0252799_208_663 151
305 3300047472 Ga0495686_0021491 Ga0495686_0021491_1156_1617 151
306 3300048909 Ga0496106_0403164 Ga0496106_0403164_23_481 151
307 3300048910 Ga0496107_0190689 Ga0496107_0190689_738_1196 151
308 3300048919 Ga0496116_0461470 Ga0496116_0461470_39_497 151
309 3300048921 Ga0496118_0267762 Ga0496118_0267762_27_491 151
310 3300048924 Ga0496121_0023881 Ga0496121_0023881_3071_3529 151
311 3300048924 Ga0496121_0047576 Ga0496121_0047576_3014_3550 151
312 3300048924 Ga0496121_0150046 Ga0496121_0150046_99_557 151
313 3300048924 Ga0496121_0206206 Ga0496121_0206206_817_1275 151
314 3300048925 Ga0496122_0160375 Ga0496122_0160375_840_1298 151
315 3300048926 Ga0496123_0141286 Ga0496123_0141286_341_799 151
316 3300048927 Ga0496124_0236824 Ga0496124_0236824_483_941 151
317 3300048928 Ga0496125_0085628 Ga0496125_0085628_1716_2252 151
318 3300048929 Ga0496126_0573908 Ga0496126_0573908_94_552 151
319 3300050494 nmdc:mga06z11_191850_c1 nmdc:mga06z11_191850_c1_225_680 151
320 3300050516 nmdc:mga0sz30_112578_c1 nmdc:mga0sz30_112578_c1_146_601 151
321 3300053125 Ga0500618_005168 Ga0500618_005168_65_520 151
322 3300059508 Ga0587088_050876 Ga0587088_050876_274_729 151
323 iso_pu_bacteria 2919171160 2919173025 151

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04828

GFA

Glutathione-dependent formaldehyde-activating enzyme

56

145

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.8853 2 140
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.8601 2 140
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.7965 9 103
1xa8-assembly1.cif.gz_A crystal structure analysis of glutathione-dependent formaldehyde-activating enzyme (gfa) 0.727 7 150
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.7038 9 103
ID Description Score Start End Superfamily
af_O14034_2_133_3.90.1590.10 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.8065 8 131 3.90.1590.10
af_Q54VC9_11_133_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.7975 10 103 2.170.150.70
3facD00 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.7905 9 103 2.170.150.70
af_Q54X87_13_141_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.7827 9 106 2.170.150.70
af_O14034_2_133_3.90.1590.10 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.7476 8 131 3.90.1590.10
ID Description Score Start End GO Terms
AF-A0A5B0WH61-F1-model_v4 GFA family protein 0.9941 1 151 GO:0016846
GO:0046872
AF-A0A521CRR2-F1-model_v4 Uncharacterized conserved protein 0.99 4 149 GO:0016846
GO:0046872
AF-J4T896-F1-model_v4 Glutathione-dependent formaldehyde-activating protein 0.9884 9 151 GO:0016846
GO:0046872
AF-A0A2T3GU41-F1-model_v4 Aldehyde-activating protein 0.9866 1 151 GO:0016846
GO:0046872
AF-A0A839XD07-F1-model_v4 deleted 0.9865 1 151

Feature Viewer

pLDDT pTM Quality
93.34 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map