F406930

General Info

Members Datasets Scaffolds Average Seq Length
323 169 323 258

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10001118|Ga0157372_1000111814
Length 237
Sequence MRSIWTGAIGFGLVNIPVKLYSATQGSELDLDMLDKKDLSNIRFKRVNENTGKEVAWENIVKGYKLDDRYVVLTDEDFKKIDGIYYETPYYLEPEKSGGRAYVLLRDALHKTGMVGFGSFVMRNKEGLCLIKPMEDILVLNRIRWGQEIRGTEEIKVPDSAPKPAEMKMAMELIKQLSGPFDIAKYRDTYSDELLALIKAKAKGKAPKAPLRVVHKAKSEDLLSQLKASLGGKKKAG

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
111 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
112 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
113 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
114 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
115 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
120 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
121 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
122 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
123 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
124 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
125 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
126 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
127 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
128 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
129 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
132 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
133 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
134 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
135 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
136 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
137 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
146 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
147 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
148 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
149 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
150 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
152 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
153 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
154 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
155 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
156 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
157 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
158 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
159 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
160 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
161 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
162 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
163 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
164 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
165 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
166 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
167 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
168 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
169 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.76
Metatranscriptomes 1.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.81
Nodule 0
Rhizoplane 0
Rhizosphere 89.47
Stem 0
Stem Tuber 0
Unclassified 3.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10005386 3300003320 Bacteria 74798
2 rootH2_10154567 3300003320 Bacteria 8794
3 rootH2_10194423 3300003320 Bacteria 2211
4 rootL2_10304334 3300003322 Bacteria 1621
5 rootH1_10285853 3300003323 Unclassified 2265
6 rootH1_10303872 3300003323 Bacteria 1565
7 Ga0065714_10068843 3300005288 Bacteria 4514
8 Ga0070658_10114340 3300005327 Bacteria 2238
9 Ga0070683_100072634 3300005329 Unclassified 3212
10 Ga0070670_100093545 3300005331 Bacteria 2585
11 Ga0068869_100060516 3300005334 Bacteria 2775
12 Ga0070666_10028089 3300005335 Unclassified 3690
13 Ga0068868_100082447 3300005338 Bacteria 2579
14 Ga0070687_100018453 3300005343 Bacteria 3228
15 Ga0070668_100048133 3300005347 Bacteria 3279
16 Ga0070671_100072275 3300005355 Bacteria 2880
17 Ga0070671_100103389 3300005355 Bacteria 2390
18 Ga0070671_100273983 3300005355 Bacteria 1434
19 Ga0070674_100006543 3300005356 Bacteria 6808
20 Ga0070674_100033345 3300005356 Bacteria 3427
21 Ga0070673_100091595 3300005364 Bacteria 2485
22 Ga0070659_100047717 3300005366 Bacteria 3361
23 Ga0070667_100024892 3300005367 Bacteria 4972
24 Ga0070662_100045752 3300005457 Unclassified 3141
25 Ga0068867_100442164 3300005459 Bacteria 1106
26 Ga0070685_10134809 3300005466 Unclassified 1548
27 Ga0070684_100035618 3300005535 Bacteria 4261
28 Ga0068853_100057310 3300005539 Bacteria 3362
29 Ga0068853_100099462 3300005539 Unclassified 2569
30 Ga0068853_100334737 3300005539 Bacteria 1405
31 Ga0070672_100083938 3300005543 Bacteria 2557
32 Ga0070672_100110518 3300005543 Unclassified 2239
33 Ga0070665_100000006 3300005548 Bacteria 718034
34 Ga0070665_100051804 3300005548 Bacteria 4116
35 Ga0068855_100000729 3300005563 Bacteria 40389
36 Ga0068855_100003624 3300005563 Bacteria 18883
37 Ga0070664_100016212 3300005564 Bacteria 6108
38 Ga0068857_100000893 3300005577 Bacteria 22552
39 Ga0068857_100034016 3300005577 Bacteria 4509
40 Ga0068857_100072158 3300005577 Bacteria 3077
41 Ga0068854_100069020 3300005578 Unclassified 2579
42 Ga0068854_100110713 3300005578 Unclassified 2071
43 Ga0068854_100472536 3300005578 Bacteria 1051
44 Ga0068854_100484451 3300005578 Bacteria 1039
45 Ga0068856_100046205 3300005614 Bacteria 4289
46 Ga0068856_100050870 3300005614 Unclassified 4086
47 Ga0068856_100077327 3300005614 Bacteria 3297
48 Ga0068852_100000186 3300005616 Bacteria 42147
49 Ga0068852_100003015 3300005616 Bacteria 11714
50 Ga0068852_100146306 3300005616 Bacteria 2192
51 Ga0068852_100177357 3300005616 Bacteria 2001
52 Ga0068852_100187888 3300005616 Unclassified 1947
53 Ga0068852_100281239 3300005616 Bacteria 1604
54 Ga0068859_100003950 3300005617 Bacteria 15131
55 Ga0068859_100043727 3300005617 Bacteria 4502
56 Ga0068859_100152865 3300005617 Bacteria 2384
57 Ga0068864_100026260 3300005618 Bacteria 4911
58 Ga0068864_100029827 3300005618 Bacteria 4622
59 Ga0068864_100038280 3300005618 Bacteria 4096
60 Ga0068866_10048512 3300005718 Unclassified 2148
61 Ga0068851_10096638 3300005834 Bacteria 1562
62 Ga0068863_100025880 3300005841 Bacteria 5598
63 Ga0068863_100548039 3300005841 Unclassified 1142
64 Ga0068863_100860966 3300005841 Unclassified 905
65 Ga0068858_100006865 3300005842 Bacteria 11063
66 Ga0068858_100020178 3300005842 Bacteria 6232
67 Ga0068858_100485013 3300005842 Bacteria 1193
68 Ga0068860_100005701 3300005843 Bacteria 12574
69 Ga0068860_100010863 3300005843 Bacteria 8979
70 Ga0068860_100057965 3300005843 Bacteria 3682
71 Ga0068860_100069495 3300005843 Bacteria 3348
72 Ga0068862_100093792 3300005844 Bacteria 2618
73 Ga0097621_100211198 3300006237 Bacteria 1689
74 Ga0097621_100306903 3300006237 Bacteria 1403
75 Ga0068871_100026281 3300006358 Bacteria 4541
76 Ga0075431_100002152 3300006847 Bacteria 18843
77 Ga0075429_100023604 3300006880 Bacteria 5338
78 Ga0097620_100003950 3300006931 Bacteria 15131
79 Ga0097620_100043730 3300006931 Bacteria 4502
80 Ga0097620_100152857 3300006931 Bacteria 2384
81 Ga0105240_10000100 3300009093 Bacteria 176640
82 Ga0105240_10000351 3300009093 Bacteria 86310
83 Ga0105240_10002264 3300009093 Bacteria 31205
84 Ga0105240_10007119 3300009093 Bacteria 16295
85 Ga0105240_10014167 3300009093 Bacteria 10892
86 Ga0105240_10385401 3300009093 Bacteria 1582
87 Ga0105247_10003538 3300009101 Bacteria 10151
88 Ga0105247_10006991 3300009101 Bacteria 6945
89 Ga0105241_10000346 3300009174 Bacteria 35174
90 Ga0105241_10001476 3300009174 Bacteria 18013
91 Ga0105241_10020015 3300009174 Bacteria 4942
92 Ga0105242_10023669 3300009176 Bacteria 4842
93 Ga0105242_10381093 3300009176 Unclassified 1311
94 Ga0105237_10000256 3300009545 Bacteria 75634
95 Ga0105237_10002867 3300009545 Bacteria 20963
96 Ga0105237_10004608 3300009545 Bacteria 15895
97 Ga0105237_10015667 3300009545 Bacteria 7880
98 Ga0105237_10030640 3300009545 Bacteria 5462
99 Ga0105237_10102969 3300009545 Bacteria 2846
100 Ga0105237_10201883 3300009545 Unclassified 1988
101 Ga0105237_10215506 3300009545 Bacteria 1920
102 Ga0105238_10000808 3300009551 Bacteria 32462
103 Ga0105238_10484925 3300009551 Bacteria 1236
104 Ga0105249_10000336 3300009553 Bacteria 47472
105 Ga0105249_10029294 3300009553 Bacteria 4971
106 Ga0105249_10047148 3300009553 Bacteria 3925
107 Ga0105249_10116247 3300009553 Unclassified 2535
108 Ga0105249_10145963 3300009553 Bacteria 2273
109 Ga0105249_10213316 3300009553 Bacteria 1896
110 Ga0105249_10259009 3300009553 Bacteria 1728
111 Ga0105239_10000089 3300010375 Bacteria 129415
112 Ga0105239_10000211 3300010375 Bacteria 85890
113 Ga0105239_10000848 3300010375 Bacteria 43534
114 Ga0105239_10002624 3300010375 Bacteria 22738
115 Ga0105239_10015520 3300010375 Bacteria 8435
116 Ga0105239_10016783 3300010375 Bacteria 8093
117 Ga0105239_10033117 3300010375 Bacteria 5676
118 Ga0105239_10258423 3300010375 Bacteria 1957
119 Ga0105246_10033967 3300011119 Bacteria 3393
120 Ga0105246_10551830 3300011119 Bacteria 988
121 Ga0157371_10275938 3300013102 Bacteria 1214
122 Ga0157371_10499962 3300013102 Bacteria 898
123 Ga0157370_10016708 3300013104 Bacteria 7426
124 Ga0157370_10035168 3300013104 Bacteria 4872
125 Ga0157370_10036409 3300013104 Bacteria 4775
126 Ga0157369_10010939 3300013105 Bacteria 10330
127 Ga0157374_10000004 3300013296 Bacteria 759774
128 Ga0157374_10097696 3300013296 Bacteria 2810
129 Ga0157374_10129246 3300013296 Bacteria 2443
130 Ga0157378_10016330 3300013297 Bacteria 6501
131 Ga0157378_10038460 3300013297 Bacteria 4241
132 Ga0157378_10078445 3300013297 Unclassified 2979
133 Ga0157378_10197672 3300013297 Bacteria 1900
134 Ga0163162_10000549 3300013306 Bacteria 34654
135 Ga0163162_10000578 3300013306 Bacteria 33905
136 Ga0157372_10001118 3300013307 Bacteria 29130
137 Ga0157372_10001557 3300013307 Bacteria 24967
138 Ga0157375_10071294 3300013308 Bacteria 3487
139 Ga0157375_10104789 3300013308 Bacteria 2917
140 Ga0163163_10156620 3300014325 Bacteria 2322
141 Ga0163163_10354965 3300014325 Unclassified 1522
142 Ga0163163_10385577 3300014325 Bacteria 1459
143 Ga0157377_10058160 3300014745 Bacteria 2201
144 Ga0157379_10031590 3300014968 Bacteria 4718
145 Ga0157376_10000546 3300014969 Bacteria 24167
146 Ga0157376_10014879 3300014969 Bacteria 5858
147 Ga0197907_10093024 3300020069 Unclassified 1649
148 Ga0206352_10451156 3300020078 Bacteria 3607
149 Ga0206350_10948500 3300020080 Unclassified 1888
150 Ga0224712_10059669 3300022467 Unclassified 1515
151 Ga0207697_10021762 3300025315 Bacteria 2627
152 Ga0207710_10007962 3300025900 Bacteria 4480
153 Ga0207710_10009656 3300025900 Bacteria 4053
154 Ga0207688_10005338 3300025901 Bacteria 6980
155 Ga0207688_10010181 3300025901 Bacteria 5117
156 Ga0207680_10000021 3300025903 Bacteria 87712
157 Ga0207680_10021672 3300025903 Unclassified 3480
158 Ga0207680_10144095 3300025903 Bacteria 1582
159 Ga0207647_10140238 3300025904 Bacteria 1417
160 Ga0207645_10023805 3300025907 Bacteria 3976
161 Ga0207645_10026059 3300025907 Unclassified 3780
162 Ga0207643_10053744 3300025908 Unclassified 2288
163 Ga0207654_10002905 3300025911 Bacteria 8680
164 Ga0207654_10007894 3300025911 Bacteria 5364
165 Ga0207654_10106767 3300025911 Bacteria 1735
166 Ga0207695_10000027 3300025913 Bacteria 612456
167 Ga0207695_10000073 3300025913 Bacteria 312565
168 Ga0207695_10000164 3300025913 Bacteria 196777
169 Ga0207695_10000706 3300025913 Bacteria 65089
170 Ga0207695_10008241 3300025913 Bacteria 13080
171 Ga0207695_10026860 3300025913 Bacteria 6419
172 Ga0207695_10089366 3300025913 Bacteria 3098
173 Ga0207671_10006526 3300025914 Bacteria 10369
174 Ga0207671_10008707 3300025914 Bacteria 8563
175 Ga0207671_10010655 3300025914 Bacteria 7564
176 Ga0207671_10023108 3300025914 Bacteria 4691
177 Ga0207671_10054208 3300025914 Unclassified 2971
178 Ga0207694_10006125 3300025924 Bacteria 9192
179 Ga0207694_10011131 3300025924 Bacteria 6792
180 Ga0207694_10213068 3300025924 Bacteria 1574
181 Ga0207644_10122399 3300025931 Bacteria 1982
182 Ga0207690_10019742 3300025932 Bacteria 4155
183 Ga0207706_10027620 3300025933 Bacteria 5073
184 Ga0207706_10048113 3300025933 Bacteria 3772
185 Ga0207686_10081477 3300025934 Bacteria 2113
186 Ga0207709_10176843 3300025935 Bacteria 1503
187 Ga0207670_10033207 3300025936 Bacteria 3324
188 Ga0207669_10059454 3300025937 Bacteria 2338
189 Ga0207704_10075283 3300025938 Bacteria 2158
190 Ga0207704_10093952 3300025938 Unclassified 1979
191 Ga0207691_10031320 3300025940 Bacteria 4965
192 Ga0207689_10001626 3300025942 Bacteria 21283
193 Ga0207689_10019614 3300025942 Bacteria 5699
194 Ga0207689_10028551 3300025942 Bacteria 4667
195 Ga0207689_10167700 3300025942 Bacteria 1809
196 Ga0207661_10117260 3300025944 Unclassified 2261
197 Ga0207667_10000519 3300025949 Bacteria 50770
198 Ga0207667_10004401 3300025949 Bacteria 17259
199 Ga0207667_10006731 3300025949 Bacteria 13883
200 Ga0207667_10060863 3300025949 Bacteria 3952
201 Ga0207651_10293902 3300025960 Bacteria 1348
202 Ga0207651_10438184 3300025960 Unclassified 1119
203 Ga0207712_10001697 3300025961 Bacteria 14784
204 Ga0207712_10027199 3300025961 Bacteria 3818
205 Ga0207712_10086905 3300025961 Unclassified 2291
206 Ga0207668_10205591 3300025972 Bacteria 1571
207 Ga0207640_10014596 3300025981 Unclassified 4526
208 Ga0207640_10073629 3300025981 Unclassified 2309
209 Ga0207640_10343605 3300025981 Unclassified 1196
210 Ga0207677_10078497 3300026023 Bacteria 2358
211 Ga0207677_10151991 3300026023 Bacteria 1787
212 Ga0207677_10422434 3300026023 Bacteria 1136
213 Ga0207677_10451592 3300026023 Unclassified 1101
214 Ga0207703_10029921 3300026035 Bacteria 4300
215 Ga0207639_10006238 3300026041 Bacteria 8100
216 Ga0207639_10024321 3300026041 Unclassified 4383
217 Ga0207639_10055256 3300026041 Bacteria 3038
218 Ga0207639_10372122 3300026041 Bacteria 1281
219 Ga0207708_10086125 3300026075 Bacteria 2418
220 Ga0207641_10003759 3300026088 Bacteria 13330
221 Ga0207641_10048643 3300026088 Bacteria 3580
222 Ga0207641_10147319 3300026088 Unclassified 2130
223 Ga0207648_10000810 3300026089 Bacteria 35351
224 Ga0207648_10325325 3300026089 Bacteria 1382
225 Ga0207676_10084141 3300026095 Bacteria 2592
226 Ga0207676_10486808 3300026095 Bacteria 1169
227 Ga0207674_10002149 3300026116 Bacteria 24925
228 Ga0207674_10080839 3300026116 Bacteria 3252
229 Ga0207674_10091054 3300026116 Bacteria 3041
230 Ga0207675_100243261 3300026118 Bacteria 1739
231 Ga0207675_100417917 3300026118 Bacteria 1324
232 Ga0207683_10002383 3300026121 Bacteria 16423
233 Ga0207698_10009124 3300026142 Bacteria 6304
234 Ga0207698_10052085 3300026142 Bacteria 3134
235 Ga0207698_10187294 3300026142 Bacteria 1839
236 Ga0207698_10917983 3300026142 Bacteria 883
237 Ga0268266_10000010 3300028379 Bacteria 1030233
238 Ga0268265_10091675 3300028380 Unclassified 2431
239 Ga0268264_10000012 3300028381 Bacteria 521740
240 Ga0268264_10001668 3300028381 Bacteria 20453
241 Ga0268264_10008992 3300028381 Bacteria 8288
242 Ga0268264_10060516 3300028381 Bacteria 3174
243 Ga0268264_10205280 3300028381 Unclassified 1805
244 Ga0268264_10481180 3300028381 Bacteria 1208
245 Ga0268264_10699996 3300028381 Bacteria 1006
246 Ga0307517_10273960 3300028786 Bacteria 968
247 Ga0307511_10002561 3300030521 Bacteria 18975
248 Ga0265327_10002557 3300031251 Bacteria 18876
249 Ga0307509_10071606 3300031507 Bacteria 3615
250 Ga0307509_10458720 3300031507 Bacteria 967
251 Ga0307516_10002039 3300031730 Bacteria 27534
252 Ga0307406_10195734 3300031901 Bacteria 1484
253 Ga0307416_100180895 3300032002 Unclassified 1976
254 Ga0373935_0302257 3300035692 Bacteria 1131
255 Ga0395905_0375329 3300037471 Bacteria 1316
256 Ga0439436_0000567 3300041404 Bacteria 9767
257 Ga0439439_0000898 3300041406 Bacteria 5496
258 Ga0451843_0377230 3300041509 Bacteria 1297
259 Ga0439449_0013247 3300042007 Bacteria 3102
260 Ga0439457_000087 3300042014 Bacteria 21111
261 Ga0439462_0005385 3300042015 Bacteria 3154
262 Ga0466972_0001672 3300044658 Bacteria 10853
263 Ga0466966_0170035 3300044684 Bacteria 1325
264 Ga0466971_0133150 3300044719 Bacteria 1155
265 Ga0466968_0020985 3300044735 Bacteria 2642
266 Ga0466970_0090551 3300044765 Unclassified 1660
267 Ga0466957_0000636 3300044842 Bacteria 17762
268 Ga0466957_0408263 3300044842 Bacteria 930
269 Ga0466959_0000089 3300045049 Bacteria 57482
270 Ga0495650_0019376 3300046471 Bacteria 3351
271 Ga0495611_0000665 3300046648 Bacteria 19571
272 Ga0495672_0005163 3300047320 Bacteria 10425
273 Ga0495672_0030031 3300047320 Bacteria 3415
274 Ga0495672_0093430 3300047320 Bacteria 1647
275 Ga0495687_000009 3300047443 Bacteria 419317
276 Ga0495686_0000058 3300047472 Bacteria 240089
277 Ga0495686_0010710 3300047472 Bacteria 6507
278 Ga0495686_0019592 3300047472 Unclassified 4521
279 Ga0495686_0189221 3300047472 Bacteria 1187
280 Ga0501032_0009769 3300049569 Bacteria 6944
281 Ga0501034_0002588 3300049571 Bacteria 21513
282 Ga0501036_0180094 3300049572 Bacteria 1779
283 Ga0501037_0006989 3300049573 Bacteria 8241
284 Ga0501039_0043991 3300049575 Bacteria 3449
285 Ga0501043_0032485 3300049579 Unclassified 4104
286 Ga0501043_0084610 3300049579 Unclassified 2493
287 Ga0501043_0160289 3300049579 Bacteria 1758
288 Ga0501046_0537100 3300049580 Bacteria 835
289 Ga0501047_0034975 3300049581 Bacteria 4852
290 Ga0501047_0050085 3300049581 Bacteria 4033
291 Ga0501047_0131086 3300049581 Bacteria 2388
292 Ga0501047_0131252 3300049581 Bacteria 2386
293 Ga0501202_033030 3300049652 Bacteria 1088
294 Ga0501236_005654 3300049670 Unclassified 1516
295 Ga0501257_003492 3300049686 Unclassified 3374
296 Ga0501080_0329142 3300049742 Bacteria 1382
297 Ga0501264_000921 3300049761 Bacteria 3697
298 Ga0501035_0004710 3300049822 Bacteria 12951
299 Ga0501044_0015808 3300049823 Bacteria 8124
300 nmdc:mga0k408_42060_c1 3300050493 Bacteria 2632
301 nmdc:mga06r32_48007_c1 3300050510 Bacteria 4080
302 nmdc:mga08y16_152243_c1 3300050511 Bacteria 2404
303 Ga0500644_0016176 3300053088 Bacteria 2144
304 Ga0500583_0000002 3300053092 Bacteria 232826
305 Ga0500583_0034170 3300053092 Unclassified 2258
306 Ga0500651_0189458 3300053093 Bacteria 1218
307 Ga0500641_0082044 3300053096 Bacteria 1369
308 Ga0500650_0075216 3300053098 Bacteria 1579
309 Ga0500555_026325 3300053103 Bacteria 1662
310 Ga0500562_001277 3300053108 Bacteria 6215
311 Ga0500655_012672 3300053133 Bacteria 1534
312 Ga0500658_0074986 3300053134 Bacteria 1435
313 Ga0500658_0129904 3300053134 Bacteria 1123
314 Ga0500568_0013364 3300053139 Bacteria 3745
315 Ga0500589_003680 3300053147 Bacteria 5587
316 Ga0500604_0002030 3300053151 Bacteria 5597
317 Ga0500622_0000089 3300053156 Bacteria 97574
318 Ga0500622_0000122 3300053156 Bacteria 81786
319 Ga0500622_0001005 3300053156 Bacteria 23792
320 Ga0500622_0020307 3300053156 Bacteria 3527
321 Ga0500622_0124210 3300053156 Bacteria 1248
322 Ga0500611_013474 3300053727 Bacteria 1404
323 Ga0500587_005075 3300053739 Bacteria 1786

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003323 rootH1_10303872 rootH1_103038721 213
2 3300005366 Ga0070659_100047717 Ga0070659_1000477173 213
3 3300025932 Ga0207690_10019742 Ga0207690_100197422 213
4 3300013307 Ga0157372_10001118 Ga0157372_1000111814 222
5 3300044684 Ga0466966_0170035 Ga0466966_0170035_589_1308 222
6 3300047320 Ga0495672_0005163 Ga0495672_0005163_1657_2430 224
7 3300013297 Ga0157378_10197672 Ga0157378_101976722 225
8 3300026142 Ga0207698_10917983 Ga0207698_109179831 230
9 3300013102 Ga0157371_10499962 Ga0157371_104999621 232
10 3300037471 Ga0395905_0375329 Ga0395905_0375329_515_1288 232
11 3300009553 Ga0105249_10259009 Ga0105249_102590092 235
12 3300025942 Ga0207689_10167700 Ga0207689_101677002 235
13 3300026118 Ga0207675_100243261 Ga0207675_1002432612 235
14 3300003323 rootH1_10285853 rootH1_102858532 237
15 3300005539 Ga0068853_100099462 Ga0068853_1000994623 237
16 3300005616 Ga0068852_100187888 Ga0068852_1001878882 237
17 3300009093 Ga0105240_10000100 Ga0105240_1000010085 237
18 3300009093 Ga0105240_10385401 Ga0105240_103854012 237
19 3300010375 Ga0105239_10000211 Ga0105239_1000021136 237
20 3300010375 Ga0105239_10015520 Ga0105239_100155204 237
21 3300025913 Ga0207695_10000027 Ga0207695_10000027422 237
22 3300025913 Ga0207695_10026860 Ga0207695_100268605 237
23 3300026041 Ga0207639_10006238 Ga0207639_100062385 237
24 3300009545 Ga0105237_10201883 Ga0105237_102018832 238
25 3300025913 Ga0207695_10000164 Ga0207695_1000016429 238
26 3300025914 Ga0207671_10054208 Ga0207671_100542082 238
27 3300041509 Ga0451843_0377230 Ga0451843_0377230_54_851 239
28 3300053133 Ga0500655_012672 Ga0500655_012672_189_947 240
29 3300003320 rootH2_10154567 rootH2_101545673 241
30 3300003320 rootH2_10194423 rootH2_101944232 241
31 3300009545 Ga0105237_10002867 Ga0105237_1000286714 241
32 3300010375 Ga0105239_10000089 Ga0105239_1000008940 241
33 3300013296 Ga0157374_10000004 Ga0157374_10000004250 241
34 3300014969 Ga0157376_10000546 Ga0157376_1000054616 241
35 3300025914 Ga0207671_10008707 Ga0207671_100087074 241
36 3300025924 Ga0207694_10213068 Ga0207694_102130682 241
37 3300025949 Ga0207667_10060863 Ga0207667_100608632 241
38 3300044719 Ga0466971_0133150 Ga0466971_0133150_104_880 241
39 3300044765 Ga0466970_0090551 Ga0466970_0090551_240_1016 241
40 3300049652 Ga0501202_033030 Ga0501202_033030_195_956 241
41 3300049670 Ga0501236_005654 Ga0501236_005654_527_1288 241
42 3300049686 Ga0501257_003492 Ga0501257_003492_2542_3303 241
43 3300049761 Ga0501264_000921 Ga0501264_000921_2901_3662 241
44 3300053108 Ga0500562_001277 Ga0500562_001277_1400_2161 241
45 3300053151 Ga0500604_0002030 Ga0500604_0002030_740_1501 241
46 3300053156 Ga0500622_0000089 Ga0500622_0000089_89653_90414 241
47 3300053156 Ga0500622_0000122 Ga0500622_0000122_45096_45857 241
48 3300003320 rootH2_10005386 rootH2_1000538650 242
49 3300003322 rootL2_10304334 rootL2_103043342 242
50 3300005288 Ga0065714_10068843 Ga0065714_100688435 242
51 3300005327 Ga0070658_10114340 Ga0070658_101143402 242
52 3300005329 Ga0070683_100072634 Ga0070683_1000726344 242
53 3300005331 Ga0070670_100093545 Ga0070670_1000935453 242
54 3300005334 Ga0068869_100060516 Ga0068869_1000605163 242
55 3300005335 Ga0070666_10028089 Ga0070666_100280894 242
56 3300005338 Ga0068868_100082447 Ga0068868_1000824473 242
57 3300005343 Ga0070687_100018453 Ga0070687_1000184532 242
58 3300005347 Ga0070668_100048133 Ga0070668_1000481334 242
59 3300005355 Ga0070671_100072275 Ga0070671_1000722751 242
60 3300005355 Ga0070671_100103389 Ga0070671_1001033893 242
61 3300005355 Ga0070671_100273983 Ga0070671_1002739832 242
62 3300005356 Ga0070674_100006543 Ga0070674_1000065434 242
63 3300005356 Ga0070674_100033345 Ga0070674_1000333452 242
64 3300005364 Ga0070673_100091595 Ga0070673_1000915952 242
65 3300005367 Ga0070667_100024892 Ga0070667_1000248923 242
66 3300005457 Ga0070662_100045752 Ga0070662_1000457523 242
67 3300005459 Ga0068867_100442164 Ga0068867_1004421641 242
68 3300005466 Ga0070685_10134809 Ga0070685_101348093 242
69 3300005535 Ga0070684_100035618 Ga0070684_1000356181 242
70 3300005539 Ga0068853_100057310 Ga0068853_1000573103 242
71 3300005539 Ga0068853_100334737 Ga0068853_1003347371 242
72 3300005543 Ga0070672_100083938 Ga0070672_1000839382 242
73 3300005543 Ga0070672_100110518 Ga0070672_1001105182 242
74 3300005548 Ga0070665_100000006 Ga0070665_100000006220 242
75 3300005548 Ga0070665_100051804 Ga0070665_1000518044 242
76 3300005563 Ga0068855_100000729 Ga0068855_10000072917 242
77 3300005563 Ga0068855_100003624 Ga0068855_1000036247 242
78 3300005564 Ga0070664_100016212 Ga0070664_1000162122 242
79 3300005577 Ga0068857_100000893 Ga0068857_1000008932 242
80 3300005577 Ga0068857_100034016 Ga0068857_1000340164 242
81 3300005577 Ga0068857_100072158 Ga0068857_1000721583 242
82 3300005578 Ga0068854_100069020 Ga0068854_1000690202 242
83 3300005578 Ga0068854_100110713 Ga0068854_1001107132 242
84 3300005578 Ga0068854_100472536 Ga0068854_1004725361 242
85 3300005578 Ga0068854_100484451 Ga0068854_1004844511 242
86 3300005614 Ga0068856_100046205 Ga0068856_1000462054 242
87 3300005614 Ga0068856_100050870 Ga0068856_1000508702 242
88 3300005614 Ga0068856_100077327 Ga0068856_1000773273 242
89 3300005616 Ga0068852_100000186 Ga0068852_10000018619 242
90 3300005616 Ga0068852_100003015 Ga0068852_1000030159 242
91 3300005616 Ga0068852_100146306 Ga0068852_1001463062 242
92 3300005616 Ga0068852_100177357 Ga0068852_1001773572 242
93 3300005616 Ga0068852_100281239 Ga0068852_1002812392 242
94 3300005617 Ga0068859_100003950 Ga0068859_1000039508 242
95 3300005617 Ga0068859_100043727 Ga0068859_1000437278 242
96 3300005617 Ga0068859_100152865 Ga0068859_1001528652 242
97 3300005618 Ga0068864_100026260 Ga0068864_1000262604 242
98 3300005618 Ga0068864_100029827 Ga0068864_1000298273 242
99 3300005618 Ga0068864_100038280 Ga0068864_1000382805 242
100 3300005718 Ga0068866_10048512 Ga0068866_100485122 242
101 3300005834 Ga0068851_10096638 Ga0068851_100966382 242
102 3300005841 Ga0068863_100025880 Ga0068863_1000258806 242
103 3300005841 Ga0068863_100548039 Ga0068863_1005480392 242
104 3300005841 Ga0068863_100860966 Ga0068863_1008609661 242
105 3300005842 Ga0068858_100006865 Ga0068858_1000068652 242
106 3300005842 Ga0068858_100020178 Ga0068858_1000201784 242
107 3300005842 Ga0068858_100485013 Ga0068858_1004850132 242
108 3300005843 Ga0068860_100005701 Ga0068860_10000570111 242
109 3300005843 Ga0068860_100010863 Ga0068860_1000108636 242
110 3300005843 Ga0068860_100057965 Ga0068860_1000579652 242
111 3300005843 Ga0068860_100069495 Ga0068860_1000694952 242
112 3300005844 Ga0068862_100093792 Ga0068862_1000937921 242
113 3300006237 Ga0097621_100211198 Ga0097621_1002111982 242
114 3300006237 Ga0097621_100306903 Ga0097621_1003069032 242
115 3300006358 Ga0068871_100026281 Ga0068871_1000262812 242
116 3300006847 Ga0075431_100002152 Ga0075431_10000215216 242
117 3300006880 Ga0075429_100023604 Ga0075429_1000236043 242
118 3300006931 Ga0097620_100003950 Ga0097620_10000395010 242
119 3300006931 Ga0097620_100043730 Ga0097620_1000437308 242
120 3300006931 Ga0097620_100152857 Ga0097620_1001528572 242
121 3300009093 Ga0105240_10000351 Ga0105240_1000035148 242
122 3300009093 Ga0105240_10002264 Ga0105240_100022643 242
123 3300009093 Ga0105240_10007119 Ga0105240_100071195 242
124 3300009093 Ga0105240_10014167 Ga0105240_100141674 242
125 3300009101 Ga0105247_10003538 Ga0105247_100035388 242
126 3300009101 Ga0105247_10006991 Ga0105247_100069913 242
127 3300009174 Ga0105241_10000346 Ga0105241_1000034617 242
128 3300009174 Ga0105241_10001476 Ga0105241_100014764 242
129 3300009174 Ga0105241_10020015 Ga0105241_100200154 242
130 3300009176 Ga0105242_10023669 Ga0105242_100236694 242
131 3300009176 Ga0105242_10381093 Ga0105242_103810933 242
132 3300009545 Ga0105237_10000256 Ga0105237_100002569 242
133 3300009545 Ga0105237_10004608 Ga0105237_100046085 242
134 3300009545 Ga0105237_10015667 Ga0105237_100156672 242
135 3300009545 Ga0105237_10030640 Ga0105237_100306407 242
136 3300009545 Ga0105237_10102969 Ga0105237_101029692 242
137 3300009545 Ga0105237_10215506 Ga0105237_102155062 242
138 3300009551 Ga0105238_10000808 Ga0105238_100008084 242
139 3300009551 Ga0105238_10484925 Ga0105238_104849253 242
140 3300009553 Ga0105249_10000336 Ga0105249_1000033626 242
141 3300009553 Ga0105249_10029294 Ga0105249_100292946 242
142 3300009553 Ga0105249_10047148 Ga0105249_100471482 242
143 3300009553 Ga0105249_10116247 Ga0105249_101162473 242
144 3300009553 Ga0105249_10145963 Ga0105249_101459633 242
145 3300009553 Ga0105249_10213316 Ga0105249_102133162 242
146 3300010375 Ga0105239_10000848 Ga0105239_1000084827 242
147 3300010375 Ga0105239_10002624 Ga0105239_1000262413 242
148 3300010375 Ga0105239_10016783 Ga0105239_100167836 242
149 3300010375 Ga0105239_10033117 Ga0105239_100331174 242
150 3300010375 Ga0105239_10258423 Ga0105239_102584232 242
151 3300011119 Ga0105246_10033967 Ga0105246_100339671 242
152 3300011119 Ga0105246_10551830 Ga0105246_105518302 242
153 3300013102 Ga0157371_10275938 Ga0157371_102759382 242
154 3300013104 Ga0157370_10016708 Ga0157370_100167082 242
155 3300013104 Ga0157370_10035168 Ga0157370_100351682 242
156 3300013104 Ga0157370_10036409 Ga0157370_100364094 242
157 3300013105 Ga0157369_10010939 Ga0157369_100109394 242
158 3300013296 Ga0157374_10097696 Ga0157374_100976963 242
159 3300013296 Ga0157374_10129246 Ga0157374_101292463 242
160 3300013297 Ga0157378_10016330 Ga0157378_100163305 242
161 3300013297 Ga0157378_10038460 Ga0157378_100384603 242
162 3300013297 Ga0157378_10078445 Ga0157378_100784454 242
163 3300013306 Ga0163162_10000549 Ga0163162_100005498 242
164 3300013306 Ga0163162_10000578 Ga0163162_1000057813 242
165 3300013307 Ga0157372_10001557 Ga0157372_1000155719 242
166 3300013308 Ga0157375_10071294 Ga0157375_100712941 242
167 3300013308 Ga0157375_10104789 Ga0157375_101047892 242
168 3300014325 Ga0163163_10156620 Ga0163163_101566203 242
169 3300014325 Ga0163163_10354965 Ga0163163_103549651 242
170 3300014325 Ga0163163_10385577 Ga0163163_103855772 242
171 3300014745 Ga0157377_10058160 Ga0157377_100581601 242
172 3300014968 Ga0157379_10031590 Ga0157379_100315904 242
173 3300014969 Ga0157376_10014879 Ga0157376_100148792 242
174 3300020069 Ga0197907_10093024 Ga0197907_100930242 242
175 3300020078 Ga0206352_10451156 Ga0206352_104511563 242
176 3300020080 Ga0206350_10948500 Ga0206350_109485002 242
177 3300022467 Ga0224712_10059669 Ga0224712_100596692 242
178 3300025315 Ga0207697_10021762 Ga0207697_100217624 242
179 3300025900 Ga0207710_10007962 Ga0207710_100079628 242
180 3300025900 Ga0207710_10009656 Ga0207710_100096565 242
181 3300025901 Ga0207688_10005338 Ga0207688_100053385 242
182 3300025901 Ga0207688_10010181 Ga0207688_100101813 242
183 3300025903 Ga0207680_10000021 Ga0207680_1000002113 242
184 3300025903 Ga0207680_10021672 Ga0207680_100216722 242
185 3300025903 Ga0207680_10144095 Ga0207680_101440951 242
186 3300025904 Ga0207647_10140238 Ga0207647_101402382 242
187 3300025907 Ga0207645_10023805 Ga0207645_100238052 242
188 3300025907 Ga0207645_10026059 Ga0207645_100260592 242
189 3300025908 Ga0207643_10053744 Ga0207643_100537442 242
190 3300025911 Ga0207654_10002905 Ga0207654_100029055 242
191 3300025911 Ga0207654_10007894 Ga0207654_100078945 242
192 3300025911 Ga0207654_10106767 Ga0207654_101067672 242
193 3300025913 Ga0207695_10000073 Ga0207695_1000007359 242
194 3300025913 Ga0207695_10000706 Ga0207695_1000070628 242
195 3300025913 Ga0207695_10008241 Ga0207695_100082419 242
196 3300025913 Ga0207695_10089366 Ga0207695_100893663 242
197 3300025914 Ga0207671_10006526 Ga0207671_100065262 242
198 3300025914 Ga0207671_10010655 Ga0207671_100106556 242
199 3300025914 Ga0207671_10023108 Ga0207671_100231082 242
200 3300025924 Ga0207694_10006125 Ga0207694_100061253 242
201 3300025924 Ga0207694_10011131 Ga0207694_100111314 242
202 3300025931 Ga0207644_10122399 Ga0207644_101223991 242
203 3300025933 Ga0207706_10027620 Ga0207706_100276203 242
204 3300025933 Ga0207706_10048113 Ga0207706_100481132 242
205 3300025934 Ga0207686_10081477 Ga0207686_100814772 242
206 3300025935 Ga0207709_10176843 Ga0207709_101768433 242
207 3300025936 Ga0207670_10033207 Ga0207670_100332071 242
208 3300025937 Ga0207669_10059454 Ga0207669_100594543 242
209 3300025938 Ga0207704_10075283 Ga0207704_100752832 242
210 3300025938 Ga0207704_10093952 Ga0207704_100939522 242
211 3300025940 Ga0207691_10031320 Ga0207691_100313204 242
212 3300025942 Ga0207689_10001626 Ga0207689_1000162611 242
213 3300025942 Ga0207689_10019614 Ga0207689_100196146 242
214 3300025942 Ga0207689_10028551 Ga0207689_100285515 242
215 3300025944 Ga0207661_10117260 Ga0207661_101172602 242
216 3300025949 Ga0207667_10000519 Ga0207667_1000051933 242
217 3300025949 Ga0207667_10004401 Ga0207667_1000440115 242
218 3300025949 Ga0207667_10006731 Ga0207667_1000673111 242
219 3300025960 Ga0207651_10293902 Ga0207651_102939022 242
220 3300025960 Ga0207651_10438184 Ga0207651_104381841 242
221 3300025961 Ga0207712_10001697 Ga0207712_100016979 242
222 3300025961 Ga0207712_10027199 Ga0207712_100271993 242
223 3300025961 Ga0207712_10086905 Ga0207712_100869053 242
224 3300025972 Ga0207668_10205591 Ga0207668_102055911 242
225 3300025981 Ga0207640_10014596 Ga0207640_100145963 242
226 3300025981 Ga0207640_10073629 Ga0207640_100736292 242
227 3300025981 Ga0207640_10343605 Ga0207640_103436052 242
228 3300026023 Ga0207677_10078497 Ga0207677_100784972 242
229 3300026023 Ga0207677_10151991 Ga0207677_101519912 242
230 3300026023 Ga0207677_10422434 Ga0207677_104224342 242
231 3300026023 Ga0207677_10451592 Ga0207677_104515922 242
232 3300026035 Ga0207703_10029921 Ga0207703_100299216 242
233 3300026041 Ga0207639_10024321 Ga0207639_100243212 242
234 3300026041 Ga0207639_10055256 Ga0207639_100552562 242
235 3300026041 Ga0207639_10372122 Ga0207639_103721221 242
236 3300026075 Ga0207708_10086125 Ga0207708_100861252 242
237 3300026088 Ga0207641_10003759 Ga0207641_100037599 242
238 3300026088 Ga0207641_10048643 Ga0207641_100486435 242
239 3300026088 Ga0207641_10147319 Ga0207641_101473193 242
240 3300026089 Ga0207648_10000810 Ga0207648_1000081029 242
241 3300026089 Ga0207648_10325325 Ga0207648_103253252 242
242 3300026095 Ga0207676_10084141 Ga0207676_100841413 242
243 3300026095 Ga0207676_10486808 Ga0207676_104868082 242
244 3300026116 Ga0207674_10002149 Ga0207674_1000214919 242
245 3300026116 Ga0207674_10080839 Ga0207674_100808393 242
246 3300026116 Ga0207674_10091054 Ga0207674_100910542 242
247 3300026118 Ga0207675_100417917 Ga0207675_1004179173 242
248 3300026121 Ga0207683_10002383 Ga0207683_100023832 242
249 3300026142 Ga0207698_10009124 Ga0207698_100091242 242
250 3300026142 Ga0207698_10052085 Ga0207698_100520852 242
251 3300026142 Ga0207698_10187294 Ga0207698_101872942 242
252 3300028379 Ga0268266_10000010 Ga0268266_10000010301 242
253 3300028380 Ga0268265_10091675 Ga0268265_100916752 242
254 3300028381 Ga0268264_10000012 Ga0268264_10000012145 242
255 3300028381 Ga0268264_10001668 Ga0268264_1000166812 242
256 3300028381 Ga0268264_10008992 Ga0268264_100089927 242
257 3300028381 Ga0268264_10060516 Ga0268264_100605162 242
258 3300028381 Ga0268264_10205280 Ga0268264_102052802 242
259 3300028381 Ga0268264_10481180 Ga0268264_104811802 242
260 3300028381 Ga0268264_10699996 Ga0268264_106999961 242
261 3300028786 Ga0307517_10273960 Ga0307517_102739601 242
262 3300030521 Ga0307511_10002561 Ga0307511_1000256114 242
263 3300031251 Ga0265327_10002557 Ga0265327_1000255716 242
264 3300031507 Ga0307509_10071606 Ga0307509_100716062 242
265 3300031507 Ga0307509_10458720 Ga0307509_104587201 242
266 3300031730 Ga0307516_10002039 Ga0307516_1000203915 242
267 3300031901 Ga0307406_10195734 Ga0307406_101957342 242
268 3300032002 Ga0307416_100180895 Ga0307416_1001808952 242
269 3300035692 Ga0373935_0302257 Ga0373935_0302257_280_1074 242
270 3300041404 Ga0439436_0000567 Ga0439436_0000567_2159_2947 242
271 3300041406 Ga0439439_0000898 Ga0439439_0000898_3069_3857 242
272 3300042007 Ga0439449_0013247 Ga0439449_0013247_435_1223 242
273 3300042014 Ga0439457_000087 Ga0439457_000087_1797_2585 242
274 3300042015 Ga0439462_0005385 Ga0439462_0005385_732_1520 242
275 3300044658 Ga0466972_0001672 Ga0466972_0001672_1429_2211 242
276 3300044735 Ga0466968_0020985 Ga0466968_0020985_1489_2271 242
277 3300044842 Ga0466957_0000636 Ga0466957_0000636_7471_8244 242
278 3300044842 Ga0466957_0408263 Ga0466957_0408263_77_862 242
279 3300045049 Ga0466959_0000089 Ga0466959_0000089_50481_51254 242
280 3300046471 Ga0495650_0019376 Ga0495650_0019376_985_1758 242
281 3300046648 Ga0495611_0000665 Ga0495611_0000665_7029_7799 242
282 3300047320 Ga0495672_0030031 Ga0495672_0030031_2489_3262 242
283 3300047320 Ga0495672_0093430 Ga0495672_0093430_16_789 242
284 3300047443 Ga0495687_000009 Ga0495687_000009_50180_50962 242
285 3300047472 Ga0495686_0000058 Ga0495686_0000058_167925_168698 242
286 3300047472 Ga0495686_0010710 Ga0495686_0010710_2872_3645 242
287 3300047472 Ga0495686_0019592 Ga0495686_0019592_619_1392 242
288 3300047472 Ga0495686_0189221 Ga0495686_0189221_329_1117 242
289 3300049569 Ga0501032_0009769 Ga0501032_0009769_1876_2649 242
290 3300049571 Ga0501034_0002588 Ga0501034_0002588_14926_15699 242
291 3300049572 Ga0501036_0180094 Ga0501036_0180094_301_1074 242
292 3300049573 Ga0501037_0006989 Ga0501037_0006989_1642_2415 242
293 3300049575 Ga0501039_0043991 Ga0501039_0043991_1546_2319 242
294 3300049579 Ga0501043_0032485 Ga0501043_0032485_2613_3386 242
295 3300049579 Ga0501043_0084610 Ga0501043_0084610_1071_1844 242
296 3300049579 Ga0501043_0160289 Ga0501043_0160289_539_1330 242
297 3300049580 Ga0501046_0537100 Ga0501046_0537100_21_800 242
298 3300049581 Ga0501047_0034975 Ga0501047_0034975_2176_2949 242
299 3300049581 Ga0501047_0050085 Ga0501047_0050085_734_1513 242
300 3300049581 Ga0501047_0131086 Ga0501047_0131086_798_1571 242
301 3300049581 Ga0501047_0131252 Ga0501047_0131252_1219_1995 242
302 3300049742 Ga0501080_0329142 Ga0501080_0329142_461_1246 242
303 3300049822 Ga0501035_0004710 Ga0501035_0004710_9947_10720 242
304 3300049823 Ga0501044_0015808 Ga0501044_0015808_2297_3070 242
305 3300050493 nmdc:mga0k408_42060_c1 nmdc:mga0k408_42060_c1_1308_2081 242
306 3300050510 nmdc:mga06r32_48007_c1 nmdc:mga06r32_48007_c1_1503_2276 242
307 3300050511 nmdc:mga08y16_152243_c1 nmdc:mga08y16_152243_c1_1578_2351 242
308 3300053088 Ga0500644_0016176 Ga0500644_0016176_71_859 242
309 3300053092 Ga0500583_0000002 Ga0500583_0000002_122512_123297 242
310 3300053092 Ga0500583_0034170 Ga0500583_0034170_36_818 242
311 3300053093 Ga0500651_0189458 Ga0500651_0189458_134_919 242
312 3300053096 Ga0500641_0082044 Ga0500641_0082044_366_1139 242
313 3300053098 Ga0500650_0075216 Ga0500650_0075216_611_1399 242
314 3300053103 Ga0500555_026325 Ga0500555_026325_618_1406 242
315 3300053134 Ga0500658_0074986 Ga0500658_0074986_346_1134 242
316 3300053134 Ga0500658_0129904 Ga0500658_0129904_252_1037 242
317 3300053139 Ga0500568_0013364 Ga0500568_0013364_577_1359 242
318 3300053147 Ga0500589_003680 Ga0500589_003680_2068_2853 242
319 3300053156 Ga0500622_0001005 Ga0500622_0001005_19674_20456 242
320 3300053156 Ga0500622_0020307 Ga0500622_0020307_1868_2653 242
321 3300053156 Ga0500622_0124210 Ga0500622_0124210_203_988 242
322 3300053727 Ga0500611_013474 Ga0500611_013474_442_1227 242
323 3300053739 Ga0500587_005075 Ga0500587_005075_432_1217 242

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02735

Ku

Ku70/Ku80 beta-barrel domain

10

83

0.97

PF02735

Ku

Ku70/Ku80 beta-barrel domain

79

171

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5c5k-assembly1.cif.gz_A structure of the pfr form of a canonical phytochrome 0.7237 134 163
8avx-assembly1.cif.gz_A cryo-em structure of drbphp in pfr state 0.7174 134 163
7nfe-assembly1.cif.gz_C cryo-em structure of nhej super-complex (monomer) 0.7124 5 231
8asc-assembly1.cif.gz_B ku70/80 binds to the ku-binding motif of paxx 0.7098 1 197
5tsh-assembly1.cif.gz_A pilb from geobacter metallireducens bound to amp-pnp 0.7065 134 162
ID Description Score Start End Superfamily
6erfA02 Mainly Beta;Beta Barrel;Ku70; Chain: A; Domain 2; 0.752 2 164 2.40.290.10
af_A0A1D6ETJ1_1_68_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7493 132 165 2.40.50.140
af_P32807_339_451_2.40.290.10 Mainly Beta;Beta Barrel;Ku70; Chain: A; Domain 2; 0.7489 65 164 2.40.290.10
af_Q75IP6_213_415_2.40.290.10 Mainly Beta;Beta Barrel;Ku70; Chain: A; Domain 2; 0.7404 2 178 2.40.290.10
af_Q4DHP5_233_418_2.40.290.10 Mainly Beta;Beta Barrel;Ku70; Chain: A; Domain 2; 0.7323 6 175 2.40.290.10
ID Description Score Start End GO Terms
AF-A0A1X9XVN8-F1-model_v4 Clade I nitrous oxide reductase 0.9325 89 163 GO:0003690
GO:0006303
AF-A0A536VMD1-F1-model_v4 Ku protein 0.9246 89 201 GO:0003690
GO:0006303
AF-A0A536VMD1-F1-model_v4 Ku protein 0.9093 89 201 GO:0003690
GO:0006303
AF-A0A5S9M9T1-F1-model_v4 Ku domain-containing protein 0.9063 89 181 GO:0003690
GO:0006303
AF-A0A251XHP8-F1-model_v4 Putative DNA repair protein YkoV 0.8633 95 227 GO:0003690
GO:0006303
GO:0006310

Feature Viewer

pLDDT pTM Quality
78.01 0.58 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map