F406930
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 323 | 169 | 323 | 258 |
Family's Representative Sequence
| Representative Sequence | 3300013307|Ga0157372_10001118|Ga0157372_1000111814 |
| Length | 237 |
| Sequence | MRSIWTGAIGFGLVNIPVKLYSATQGSELDLDMLDKKDLSNIRFKRVNENTGKEVAWENIVKGYKLDDRYVVLTDEDFKKIDGIYYETPYYLEPEKSGGRAYVLLRDALHKTGMVGFGSFVMRNKEGLCLIKPMEDILVLNRIRWGQEIRGTEEIKVPDSAPKPAEMKMAMELIKQLSGPFDIAKYRDTYSDELLALIKAKAKGKAPKAPLRVVHKAKSEDLLSQLKASLGGKKKAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 20 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 23 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 26 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 28 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 29 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 30 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 31 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 32 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 33 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 34 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 35 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 36 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 37 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 38 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 39 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 41 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 42 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 43 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 66 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 67 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 68 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 69 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 111 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 112 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 113 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 114 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 115 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 116 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 117 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 118 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 119 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 120 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 121 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 122 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 123 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 124 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 125 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 126 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 127 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 128 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 129 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 130 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 131 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 132 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 138 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 139 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 140 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 141 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 142 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 143 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 144 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 145 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 146 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 147 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 148 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 149 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 150 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 152 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 153 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 154 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 155 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 156 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 157 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 158 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 159 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 160 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 161 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 162 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 163 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 164 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 165 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 166 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 167 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 168 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 169 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.76 |
| Metatranscriptomes | 1.24 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.81 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 89.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.72 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10005386 | 3300003320 | Bacteria | 74798 |
| 2 | rootH2_10154567 | 3300003320 | Bacteria | 8794 |
| 3 | rootH2_10194423 | 3300003320 | Bacteria | 2211 |
| 4 | rootL2_10304334 | 3300003322 | Bacteria | 1621 |
| 5 | rootH1_10285853 | 3300003323 | Unclassified | 2265 |
| 6 | rootH1_10303872 | 3300003323 | Bacteria | 1565 |
| 7 | Ga0065714_10068843 | 3300005288 | Bacteria | 4514 |
| 8 | Ga0070658_10114340 | 3300005327 | Bacteria | 2238 |
| 9 | Ga0070683_100072634 | 3300005329 | Unclassified | 3212 |
| 10 | Ga0070670_100093545 | 3300005331 | Bacteria | 2585 |
| 11 | Ga0068869_100060516 | 3300005334 | Bacteria | 2775 |
| 12 | Ga0070666_10028089 | 3300005335 | Unclassified | 3690 |
| 13 | Ga0068868_100082447 | 3300005338 | Bacteria | 2579 |
| 14 | Ga0070687_100018453 | 3300005343 | Bacteria | 3228 |
| 15 | Ga0070668_100048133 | 3300005347 | Bacteria | 3279 |
| 16 | Ga0070671_100072275 | 3300005355 | Bacteria | 2880 |
| 17 | Ga0070671_100103389 | 3300005355 | Bacteria | 2390 |
| 18 | Ga0070671_100273983 | 3300005355 | Bacteria | 1434 |
| 19 | Ga0070674_100006543 | 3300005356 | Bacteria | 6808 |
| 20 | Ga0070674_100033345 | 3300005356 | Bacteria | 3427 |
| 21 | Ga0070673_100091595 | 3300005364 | Bacteria | 2485 |
| 22 | Ga0070659_100047717 | 3300005366 | Bacteria | 3361 |
| 23 | Ga0070667_100024892 | 3300005367 | Bacteria | 4972 |
| 24 | Ga0070662_100045752 | 3300005457 | Unclassified | 3141 |
| 25 | Ga0068867_100442164 | 3300005459 | Bacteria | 1106 |
| 26 | Ga0070685_10134809 | 3300005466 | Unclassified | 1548 |
| 27 | Ga0070684_100035618 | 3300005535 | Bacteria | 4261 |
| 28 | Ga0068853_100057310 | 3300005539 | Bacteria | 3362 |
| 29 | Ga0068853_100099462 | 3300005539 | Unclassified | 2569 |
| 30 | Ga0068853_100334737 | 3300005539 | Bacteria | 1405 |
| 31 | Ga0070672_100083938 | 3300005543 | Bacteria | 2557 |
| 32 | Ga0070672_100110518 | 3300005543 | Unclassified | 2239 |
| 33 | Ga0070665_100000006 | 3300005548 | Bacteria | 718034 |
| 34 | Ga0070665_100051804 | 3300005548 | Bacteria | 4116 |
| 35 | Ga0068855_100000729 | 3300005563 | Bacteria | 40389 |
| 36 | Ga0068855_100003624 | 3300005563 | Bacteria | 18883 |
| 37 | Ga0070664_100016212 | 3300005564 | Bacteria | 6108 |
| 38 | Ga0068857_100000893 | 3300005577 | Bacteria | 22552 |
| 39 | Ga0068857_100034016 | 3300005577 | Bacteria | 4509 |
| 40 | Ga0068857_100072158 | 3300005577 | Bacteria | 3077 |
| 41 | Ga0068854_100069020 | 3300005578 | Unclassified | 2579 |
| 42 | Ga0068854_100110713 | 3300005578 | Unclassified | 2071 |
| 43 | Ga0068854_100472536 | 3300005578 | Bacteria | 1051 |
| 44 | Ga0068854_100484451 | 3300005578 | Bacteria | 1039 |
| 45 | Ga0068856_100046205 | 3300005614 | Bacteria | 4289 |
| 46 | Ga0068856_100050870 | 3300005614 | Unclassified | 4086 |
| 47 | Ga0068856_100077327 | 3300005614 | Bacteria | 3297 |
| 48 | Ga0068852_100000186 | 3300005616 | Bacteria | 42147 |
| 49 | Ga0068852_100003015 | 3300005616 | Bacteria | 11714 |
| 50 | Ga0068852_100146306 | 3300005616 | Bacteria | 2192 |
| 51 | Ga0068852_100177357 | 3300005616 | Bacteria | 2001 |
| 52 | Ga0068852_100187888 | 3300005616 | Unclassified | 1947 |
| 53 | Ga0068852_100281239 | 3300005616 | Bacteria | 1604 |
| 54 | Ga0068859_100003950 | 3300005617 | Bacteria | 15131 |
| 55 | Ga0068859_100043727 | 3300005617 | Bacteria | 4502 |
| 56 | Ga0068859_100152865 | 3300005617 | Bacteria | 2384 |
| 57 | Ga0068864_100026260 | 3300005618 | Bacteria | 4911 |
| 58 | Ga0068864_100029827 | 3300005618 | Bacteria | 4622 |
| 59 | Ga0068864_100038280 | 3300005618 | Bacteria | 4096 |
| 60 | Ga0068866_10048512 | 3300005718 | Unclassified | 2148 |
| 61 | Ga0068851_10096638 | 3300005834 | Bacteria | 1562 |
| 62 | Ga0068863_100025880 | 3300005841 | Bacteria | 5598 |
| 63 | Ga0068863_100548039 | 3300005841 | Unclassified | 1142 |
| 64 | Ga0068863_100860966 | 3300005841 | Unclassified | 905 |
| 65 | Ga0068858_100006865 | 3300005842 | Bacteria | 11063 |
| 66 | Ga0068858_100020178 | 3300005842 | Bacteria | 6232 |
| 67 | Ga0068858_100485013 | 3300005842 | Bacteria | 1193 |
| 68 | Ga0068860_100005701 | 3300005843 | Bacteria | 12574 |
| 69 | Ga0068860_100010863 | 3300005843 | Bacteria | 8979 |
| 70 | Ga0068860_100057965 | 3300005843 | Bacteria | 3682 |
| 71 | Ga0068860_100069495 | 3300005843 | Bacteria | 3348 |
| 72 | Ga0068862_100093792 | 3300005844 | Bacteria | 2618 |
| 73 | Ga0097621_100211198 | 3300006237 | Bacteria | 1689 |
| 74 | Ga0097621_100306903 | 3300006237 | Bacteria | 1403 |
| 75 | Ga0068871_100026281 | 3300006358 | Bacteria | 4541 |
| 76 | Ga0075431_100002152 | 3300006847 | Bacteria | 18843 |
| 77 | Ga0075429_100023604 | 3300006880 | Bacteria | 5338 |
| 78 | Ga0097620_100003950 | 3300006931 | Bacteria | 15131 |
| 79 | Ga0097620_100043730 | 3300006931 | Bacteria | 4502 |
| 80 | Ga0097620_100152857 | 3300006931 | Bacteria | 2384 |
| 81 | Ga0105240_10000100 | 3300009093 | Bacteria | 176640 |
| 82 | Ga0105240_10000351 | 3300009093 | Bacteria | 86310 |
| 83 | Ga0105240_10002264 | 3300009093 | Bacteria | 31205 |
| 84 | Ga0105240_10007119 | 3300009093 | Bacteria | 16295 |
| 85 | Ga0105240_10014167 | 3300009093 | Bacteria | 10892 |
| 86 | Ga0105240_10385401 | 3300009093 | Bacteria | 1582 |
| 87 | Ga0105247_10003538 | 3300009101 | Bacteria | 10151 |
| 88 | Ga0105247_10006991 | 3300009101 | Bacteria | 6945 |
| 89 | Ga0105241_10000346 | 3300009174 | Bacteria | 35174 |
| 90 | Ga0105241_10001476 | 3300009174 | Bacteria | 18013 |
| 91 | Ga0105241_10020015 | 3300009174 | Bacteria | 4942 |
| 92 | Ga0105242_10023669 | 3300009176 | Bacteria | 4842 |
| 93 | Ga0105242_10381093 | 3300009176 | Unclassified | 1311 |
| 94 | Ga0105237_10000256 | 3300009545 | Bacteria | 75634 |
| 95 | Ga0105237_10002867 | 3300009545 | Bacteria | 20963 |
| 96 | Ga0105237_10004608 | 3300009545 | Bacteria | 15895 |
| 97 | Ga0105237_10015667 | 3300009545 | Bacteria | 7880 |
| 98 | Ga0105237_10030640 | 3300009545 | Bacteria | 5462 |
| 99 | Ga0105237_10102969 | 3300009545 | Bacteria | 2846 |
| 100 | Ga0105237_10201883 | 3300009545 | Unclassified | 1988 |
| 101 | Ga0105237_10215506 | 3300009545 | Bacteria | 1920 |
| 102 | Ga0105238_10000808 | 3300009551 | Bacteria | 32462 |
| 103 | Ga0105238_10484925 | 3300009551 | Bacteria | 1236 |
| 104 | Ga0105249_10000336 | 3300009553 | Bacteria | 47472 |
| 105 | Ga0105249_10029294 | 3300009553 | Bacteria | 4971 |
| 106 | Ga0105249_10047148 | 3300009553 | Bacteria | 3925 |
| 107 | Ga0105249_10116247 | 3300009553 | Unclassified | 2535 |
| 108 | Ga0105249_10145963 | 3300009553 | Bacteria | 2273 |
| 109 | Ga0105249_10213316 | 3300009553 | Bacteria | 1896 |
| 110 | Ga0105249_10259009 | 3300009553 | Bacteria | 1728 |
| 111 | Ga0105239_10000089 | 3300010375 | Bacteria | 129415 |
| 112 | Ga0105239_10000211 | 3300010375 | Bacteria | 85890 |
| 113 | Ga0105239_10000848 | 3300010375 | Bacteria | 43534 |
| 114 | Ga0105239_10002624 | 3300010375 | Bacteria | 22738 |
| 115 | Ga0105239_10015520 | 3300010375 | Bacteria | 8435 |
| 116 | Ga0105239_10016783 | 3300010375 | Bacteria | 8093 |
| 117 | Ga0105239_10033117 | 3300010375 | Bacteria | 5676 |
| 118 | Ga0105239_10258423 | 3300010375 | Bacteria | 1957 |
| 119 | Ga0105246_10033967 | 3300011119 | Bacteria | 3393 |
| 120 | Ga0105246_10551830 | 3300011119 | Bacteria | 988 |
| 121 | Ga0157371_10275938 | 3300013102 | Bacteria | 1214 |
| 122 | Ga0157371_10499962 | 3300013102 | Bacteria | 898 |
| 123 | Ga0157370_10016708 | 3300013104 | Bacteria | 7426 |
| 124 | Ga0157370_10035168 | 3300013104 | Bacteria | 4872 |
| 125 | Ga0157370_10036409 | 3300013104 | Bacteria | 4775 |
| 126 | Ga0157369_10010939 | 3300013105 | Bacteria | 10330 |
| 127 | Ga0157374_10000004 | 3300013296 | Bacteria | 759774 |
| 128 | Ga0157374_10097696 | 3300013296 | Bacteria | 2810 |
| 129 | Ga0157374_10129246 | 3300013296 | Bacteria | 2443 |
| 130 | Ga0157378_10016330 | 3300013297 | Bacteria | 6501 |
| 131 | Ga0157378_10038460 | 3300013297 | Bacteria | 4241 |
| 132 | Ga0157378_10078445 | 3300013297 | Unclassified | 2979 |
| 133 | Ga0157378_10197672 | 3300013297 | Bacteria | 1900 |
| 134 | Ga0163162_10000549 | 3300013306 | Bacteria | 34654 |
| 135 | Ga0163162_10000578 | 3300013306 | Bacteria | 33905 |
| 136 | Ga0157372_10001118 | 3300013307 | Bacteria | 29130 |
| 137 | Ga0157372_10001557 | 3300013307 | Bacteria | 24967 |
| 138 | Ga0157375_10071294 | 3300013308 | Bacteria | 3487 |
| 139 | Ga0157375_10104789 | 3300013308 | Bacteria | 2917 |
| 140 | Ga0163163_10156620 | 3300014325 | Bacteria | 2322 |
| 141 | Ga0163163_10354965 | 3300014325 | Unclassified | 1522 |
| 142 | Ga0163163_10385577 | 3300014325 | Bacteria | 1459 |
| 143 | Ga0157377_10058160 | 3300014745 | Bacteria | 2201 |
| 144 | Ga0157379_10031590 | 3300014968 | Bacteria | 4718 |
| 145 | Ga0157376_10000546 | 3300014969 | Bacteria | 24167 |
| 146 | Ga0157376_10014879 | 3300014969 | Bacteria | 5858 |
| 147 | Ga0197907_10093024 | 3300020069 | Unclassified | 1649 |
| 148 | Ga0206352_10451156 | 3300020078 | Bacteria | 3607 |
| 149 | Ga0206350_10948500 | 3300020080 | Unclassified | 1888 |
| 150 | Ga0224712_10059669 | 3300022467 | Unclassified | 1515 |
| 151 | Ga0207697_10021762 | 3300025315 | Bacteria | 2627 |
| 152 | Ga0207710_10007962 | 3300025900 | Bacteria | 4480 |
| 153 | Ga0207710_10009656 | 3300025900 | Bacteria | 4053 |
| 154 | Ga0207688_10005338 | 3300025901 | Bacteria | 6980 |
| 155 | Ga0207688_10010181 | 3300025901 | Bacteria | 5117 |
| 156 | Ga0207680_10000021 | 3300025903 | Bacteria | 87712 |
| 157 | Ga0207680_10021672 | 3300025903 | Unclassified | 3480 |
| 158 | Ga0207680_10144095 | 3300025903 | Bacteria | 1582 |
| 159 | Ga0207647_10140238 | 3300025904 | Bacteria | 1417 |
| 160 | Ga0207645_10023805 | 3300025907 | Bacteria | 3976 |
| 161 | Ga0207645_10026059 | 3300025907 | Unclassified | 3780 |
| 162 | Ga0207643_10053744 | 3300025908 | Unclassified | 2288 |
| 163 | Ga0207654_10002905 | 3300025911 | Bacteria | 8680 |
| 164 | Ga0207654_10007894 | 3300025911 | Bacteria | 5364 |
| 165 | Ga0207654_10106767 | 3300025911 | Bacteria | 1735 |
| 166 | Ga0207695_10000027 | 3300025913 | Bacteria | 612456 |
| 167 | Ga0207695_10000073 | 3300025913 | Bacteria | 312565 |
| 168 | Ga0207695_10000164 | 3300025913 | Bacteria | 196777 |
| 169 | Ga0207695_10000706 | 3300025913 | Bacteria | 65089 |
| 170 | Ga0207695_10008241 | 3300025913 | Bacteria | 13080 |
| 171 | Ga0207695_10026860 | 3300025913 | Bacteria | 6419 |
| 172 | Ga0207695_10089366 | 3300025913 | Bacteria | 3098 |
| 173 | Ga0207671_10006526 | 3300025914 | Bacteria | 10369 |
| 174 | Ga0207671_10008707 | 3300025914 | Bacteria | 8563 |
| 175 | Ga0207671_10010655 | 3300025914 | Bacteria | 7564 |
| 176 | Ga0207671_10023108 | 3300025914 | Bacteria | 4691 |
| 177 | Ga0207671_10054208 | 3300025914 | Unclassified | 2971 |
| 178 | Ga0207694_10006125 | 3300025924 | Bacteria | 9192 |
| 179 | Ga0207694_10011131 | 3300025924 | Bacteria | 6792 |
| 180 | Ga0207694_10213068 | 3300025924 | Bacteria | 1574 |
| 181 | Ga0207644_10122399 | 3300025931 | Bacteria | 1982 |
| 182 | Ga0207690_10019742 | 3300025932 | Bacteria | 4155 |
| 183 | Ga0207706_10027620 | 3300025933 | Bacteria | 5073 |
| 184 | Ga0207706_10048113 | 3300025933 | Bacteria | 3772 |
| 185 | Ga0207686_10081477 | 3300025934 | Bacteria | 2113 |
| 186 | Ga0207709_10176843 | 3300025935 | Bacteria | 1503 |
| 187 | Ga0207670_10033207 | 3300025936 | Bacteria | 3324 |
| 188 | Ga0207669_10059454 | 3300025937 | Bacteria | 2338 |
| 189 | Ga0207704_10075283 | 3300025938 | Bacteria | 2158 |
| 190 | Ga0207704_10093952 | 3300025938 | Unclassified | 1979 |
| 191 | Ga0207691_10031320 | 3300025940 | Bacteria | 4965 |
| 192 | Ga0207689_10001626 | 3300025942 | Bacteria | 21283 |
| 193 | Ga0207689_10019614 | 3300025942 | Bacteria | 5699 |
| 194 | Ga0207689_10028551 | 3300025942 | Bacteria | 4667 |
| 195 | Ga0207689_10167700 | 3300025942 | Bacteria | 1809 |
| 196 | Ga0207661_10117260 | 3300025944 | Unclassified | 2261 |
| 197 | Ga0207667_10000519 | 3300025949 | Bacteria | 50770 |
| 198 | Ga0207667_10004401 | 3300025949 | Bacteria | 17259 |
| 199 | Ga0207667_10006731 | 3300025949 | Bacteria | 13883 |
| 200 | Ga0207667_10060863 | 3300025949 | Bacteria | 3952 |
| 201 | Ga0207651_10293902 | 3300025960 | Bacteria | 1348 |
| 202 | Ga0207651_10438184 | 3300025960 | Unclassified | 1119 |
| 203 | Ga0207712_10001697 | 3300025961 | Bacteria | 14784 |
| 204 | Ga0207712_10027199 | 3300025961 | Bacteria | 3818 |
| 205 | Ga0207712_10086905 | 3300025961 | Unclassified | 2291 |
| 206 | Ga0207668_10205591 | 3300025972 | Bacteria | 1571 |
| 207 | Ga0207640_10014596 | 3300025981 | Unclassified | 4526 |
| 208 | Ga0207640_10073629 | 3300025981 | Unclassified | 2309 |
| 209 | Ga0207640_10343605 | 3300025981 | Unclassified | 1196 |
| 210 | Ga0207677_10078497 | 3300026023 | Bacteria | 2358 |
| 211 | Ga0207677_10151991 | 3300026023 | Bacteria | 1787 |
| 212 | Ga0207677_10422434 | 3300026023 | Bacteria | 1136 |
| 213 | Ga0207677_10451592 | 3300026023 | Unclassified | 1101 |
| 214 | Ga0207703_10029921 | 3300026035 | Bacteria | 4300 |
| 215 | Ga0207639_10006238 | 3300026041 | Bacteria | 8100 |
| 216 | Ga0207639_10024321 | 3300026041 | Unclassified | 4383 |
| 217 | Ga0207639_10055256 | 3300026041 | Bacteria | 3038 |
| 218 | Ga0207639_10372122 | 3300026041 | Bacteria | 1281 |
| 219 | Ga0207708_10086125 | 3300026075 | Bacteria | 2418 |
| 220 | Ga0207641_10003759 | 3300026088 | Bacteria | 13330 |
| 221 | Ga0207641_10048643 | 3300026088 | Bacteria | 3580 |
| 222 | Ga0207641_10147319 | 3300026088 | Unclassified | 2130 |
| 223 | Ga0207648_10000810 | 3300026089 | Bacteria | 35351 |
| 224 | Ga0207648_10325325 | 3300026089 | Bacteria | 1382 |
| 225 | Ga0207676_10084141 | 3300026095 | Bacteria | 2592 |
| 226 | Ga0207676_10486808 | 3300026095 | Bacteria | 1169 |
| 227 | Ga0207674_10002149 | 3300026116 | Bacteria | 24925 |
| 228 | Ga0207674_10080839 | 3300026116 | Bacteria | 3252 |
| 229 | Ga0207674_10091054 | 3300026116 | Bacteria | 3041 |
| 230 | Ga0207675_100243261 | 3300026118 | Bacteria | 1739 |
| 231 | Ga0207675_100417917 | 3300026118 | Bacteria | 1324 |
| 232 | Ga0207683_10002383 | 3300026121 | Bacteria | 16423 |
| 233 | Ga0207698_10009124 | 3300026142 | Bacteria | 6304 |
| 234 | Ga0207698_10052085 | 3300026142 | Bacteria | 3134 |
| 235 | Ga0207698_10187294 | 3300026142 | Bacteria | 1839 |
| 236 | Ga0207698_10917983 | 3300026142 | Bacteria | 883 |
| 237 | Ga0268266_10000010 | 3300028379 | Bacteria | 1030233 |
| 238 | Ga0268265_10091675 | 3300028380 | Unclassified | 2431 |
| 239 | Ga0268264_10000012 | 3300028381 | Bacteria | 521740 |
| 240 | Ga0268264_10001668 | 3300028381 | Bacteria | 20453 |
| 241 | Ga0268264_10008992 | 3300028381 | Bacteria | 8288 |
| 242 | Ga0268264_10060516 | 3300028381 | Bacteria | 3174 |
| 243 | Ga0268264_10205280 | 3300028381 | Unclassified | 1805 |
| 244 | Ga0268264_10481180 | 3300028381 | Bacteria | 1208 |
| 245 | Ga0268264_10699996 | 3300028381 | Bacteria | 1006 |
| 246 | Ga0307517_10273960 | 3300028786 | Bacteria | 968 |
| 247 | Ga0307511_10002561 | 3300030521 | Bacteria | 18975 |
| 248 | Ga0265327_10002557 | 3300031251 | Bacteria | 18876 |
| 249 | Ga0307509_10071606 | 3300031507 | Bacteria | 3615 |
| 250 | Ga0307509_10458720 | 3300031507 | Bacteria | 967 |
| 251 | Ga0307516_10002039 | 3300031730 | Bacteria | 27534 |
| 252 | Ga0307406_10195734 | 3300031901 | Bacteria | 1484 |
| 253 | Ga0307416_100180895 | 3300032002 | Unclassified | 1976 |
| 254 | Ga0373935_0302257 | 3300035692 | Bacteria | 1131 |
| 255 | Ga0395905_0375329 | 3300037471 | Bacteria | 1316 |
| 256 | Ga0439436_0000567 | 3300041404 | Bacteria | 9767 |
| 257 | Ga0439439_0000898 | 3300041406 | Bacteria | 5496 |
| 258 | Ga0451843_0377230 | 3300041509 | Bacteria | 1297 |
| 259 | Ga0439449_0013247 | 3300042007 | Bacteria | 3102 |
| 260 | Ga0439457_000087 | 3300042014 | Bacteria | 21111 |
| 261 | Ga0439462_0005385 | 3300042015 | Bacteria | 3154 |
| 262 | Ga0466972_0001672 | 3300044658 | Bacteria | 10853 |
| 263 | Ga0466966_0170035 | 3300044684 | Bacteria | 1325 |
| 264 | Ga0466971_0133150 | 3300044719 | Bacteria | 1155 |
| 265 | Ga0466968_0020985 | 3300044735 | Bacteria | 2642 |
| 266 | Ga0466970_0090551 | 3300044765 | Unclassified | 1660 |
| 267 | Ga0466957_0000636 | 3300044842 | Bacteria | 17762 |
| 268 | Ga0466957_0408263 | 3300044842 | Bacteria | 930 |
| 269 | Ga0466959_0000089 | 3300045049 | Bacteria | 57482 |
| 270 | Ga0495650_0019376 | 3300046471 | Bacteria | 3351 |
| 271 | Ga0495611_0000665 | 3300046648 | Bacteria | 19571 |
| 272 | Ga0495672_0005163 | 3300047320 | Bacteria | 10425 |
| 273 | Ga0495672_0030031 | 3300047320 | Bacteria | 3415 |
| 274 | Ga0495672_0093430 | 3300047320 | Bacteria | 1647 |
| 275 | Ga0495687_000009 | 3300047443 | Bacteria | 419317 |
| 276 | Ga0495686_0000058 | 3300047472 | Bacteria | 240089 |
| 277 | Ga0495686_0010710 | 3300047472 | Bacteria | 6507 |
| 278 | Ga0495686_0019592 | 3300047472 | Unclassified | 4521 |
| 279 | Ga0495686_0189221 | 3300047472 | Bacteria | 1187 |
| 280 | Ga0501032_0009769 | 3300049569 | Bacteria | 6944 |
| 281 | Ga0501034_0002588 | 3300049571 | Bacteria | 21513 |
| 282 | Ga0501036_0180094 | 3300049572 | Bacteria | 1779 |
| 283 | Ga0501037_0006989 | 3300049573 | Bacteria | 8241 |
| 284 | Ga0501039_0043991 | 3300049575 | Bacteria | 3449 |
| 285 | Ga0501043_0032485 | 3300049579 | Unclassified | 4104 |
| 286 | Ga0501043_0084610 | 3300049579 | Unclassified | 2493 |
| 287 | Ga0501043_0160289 | 3300049579 | Bacteria | 1758 |
| 288 | Ga0501046_0537100 | 3300049580 | Bacteria | 835 |
| 289 | Ga0501047_0034975 | 3300049581 | Bacteria | 4852 |
| 290 | Ga0501047_0050085 | 3300049581 | Bacteria | 4033 |
| 291 | Ga0501047_0131086 | 3300049581 | Bacteria | 2388 |
| 292 | Ga0501047_0131252 | 3300049581 | Bacteria | 2386 |
| 293 | Ga0501202_033030 | 3300049652 | Bacteria | 1088 |
| 294 | Ga0501236_005654 | 3300049670 | Unclassified | 1516 |
| 295 | Ga0501257_003492 | 3300049686 | Unclassified | 3374 |
| 296 | Ga0501080_0329142 | 3300049742 | Bacteria | 1382 |
| 297 | Ga0501264_000921 | 3300049761 | Bacteria | 3697 |
| 298 | Ga0501035_0004710 | 3300049822 | Bacteria | 12951 |
| 299 | Ga0501044_0015808 | 3300049823 | Bacteria | 8124 |
| 300 | nmdc:mga0k408_42060_c1 | 3300050493 | Bacteria | 2632 |
| 301 | nmdc:mga06r32_48007_c1 | 3300050510 | Bacteria | 4080 |
| 302 | nmdc:mga08y16_152243_c1 | 3300050511 | Bacteria | 2404 |
| 303 | Ga0500644_0016176 | 3300053088 | Bacteria | 2144 |
| 304 | Ga0500583_0000002 | 3300053092 | Bacteria | 232826 |
| 305 | Ga0500583_0034170 | 3300053092 | Unclassified | 2258 |
| 306 | Ga0500651_0189458 | 3300053093 | Bacteria | 1218 |
| 307 | Ga0500641_0082044 | 3300053096 | Bacteria | 1369 |
| 308 | Ga0500650_0075216 | 3300053098 | Bacteria | 1579 |
| 309 | Ga0500555_026325 | 3300053103 | Bacteria | 1662 |
| 310 | Ga0500562_001277 | 3300053108 | Bacteria | 6215 |
| 311 | Ga0500655_012672 | 3300053133 | Bacteria | 1534 |
| 312 | Ga0500658_0074986 | 3300053134 | Bacteria | 1435 |
| 313 | Ga0500658_0129904 | 3300053134 | Bacteria | 1123 |
| 314 | Ga0500568_0013364 | 3300053139 | Bacteria | 3745 |
| 315 | Ga0500589_003680 | 3300053147 | Bacteria | 5587 |
| 316 | Ga0500604_0002030 | 3300053151 | Bacteria | 5597 |
| 317 | Ga0500622_0000089 | 3300053156 | Bacteria | 97574 |
| 318 | Ga0500622_0000122 | 3300053156 | Bacteria | 81786 |
| 319 | Ga0500622_0001005 | 3300053156 | Bacteria | 23792 |
| 320 | Ga0500622_0020307 | 3300053156 | Bacteria | 3527 |
| 321 | Ga0500622_0124210 | 3300053156 | Bacteria | 1248 |
| 322 | Ga0500611_013474 | 3300053727 | Bacteria | 1404 |
| 323 | Ga0500587_005075 | 3300053739 | Bacteria | 1786 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003323 | rootH1_10303872 | rootH1_103038721 | 213 |
| 2 | 3300005366 | Ga0070659_100047717 | Ga0070659_1000477173 | 213 |
| 3 | 3300025932 | Ga0207690_10019742 | Ga0207690_100197422 | 213 |
| 4 | 3300013307 | Ga0157372_10001118 | Ga0157372_1000111814 | 222 |
| 5 | 3300044684 | Ga0466966_0170035 | Ga0466966_0170035_589_1308 | 222 |
| 6 | 3300047320 | Ga0495672_0005163 | Ga0495672_0005163_1657_2430 | 224 |
| 7 | 3300013297 | Ga0157378_10197672 | Ga0157378_101976722 | 225 |
| 8 | 3300026142 | Ga0207698_10917983 | Ga0207698_109179831 | 230 |
| 9 | 3300013102 | Ga0157371_10499962 | Ga0157371_104999621 | 232 |
| 10 | 3300037471 | Ga0395905_0375329 | Ga0395905_0375329_515_1288 | 232 |
| 11 | 3300009553 | Ga0105249_10259009 | Ga0105249_102590092 | 235 |
| 12 | 3300025942 | Ga0207689_10167700 | Ga0207689_101677002 | 235 |
| 13 | 3300026118 | Ga0207675_100243261 | Ga0207675_1002432612 | 235 |
| 14 | 3300003323 | rootH1_10285853 | rootH1_102858532 | 237 |
| 15 | 3300005539 | Ga0068853_100099462 | Ga0068853_1000994623 | 237 |
| 16 | 3300005616 | Ga0068852_100187888 | Ga0068852_1001878882 | 237 |
| 17 | 3300009093 | Ga0105240_10000100 | Ga0105240_1000010085 | 237 |
| 18 | 3300009093 | Ga0105240_10385401 | Ga0105240_103854012 | 237 |
| 19 | 3300010375 | Ga0105239_10000211 | Ga0105239_1000021136 | 237 |
| 20 | 3300010375 | Ga0105239_10015520 | Ga0105239_100155204 | 237 |
| 21 | 3300025913 | Ga0207695_10000027 | Ga0207695_10000027422 | 237 |
| 22 | 3300025913 | Ga0207695_10026860 | Ga0207695_100268605 | 237 |
| 23 | 3300026041 | Ga0207639_10006238 | Ga0207639_100062385 | 237 |
| 24 | 3300009545 | Ga0105237_10201883 | Ga0105237_102018832 | 238 |
| 25 | 3300025913 | Ga0207695_10000164 | Ga0207695_1000016429 | 238 |
| 26 | 3300025914 | Ga0207671_10054208 | Ga0207671_100542082 | 238 |
| 27 | 3300041509 | Ga0451843_0377230 | Ga0451843_0377230_54_851 | 239 |
| 28 | 3300053133 | Ga0500655_012672 | Ga0500655_012672_189_947 | 240 |
| 29 | 3300003320 | rootH2_10154567 | rootH2_101545673 | 241 |
| 30 | 3300003320 | rootH2_10194423 | rootH2_101944232 | 241 |
| 31 | 3300009545 | Ga0105237_10002867 | Ga0105237_1000286714 | 241 |
| 32 | 3300010375 | Ga0105239_10000089 | Ga0105239_1000008940 | 241 |
| 33 | 3300013296 | Ga0157374_10000004 | Ga0157374_10000004250 | 241 |
| 34 | 3300014969 | Ga0157376_10000546 | Ga0157376_1000054616 | 241 |
| 35 | 3300025914 | Ga0207671_10008707 | Ga0207671_100087074 | 241 |
| 36 | 3300025924 | Ga0207694_10213068 | Ga0207694_102130682 | 241 |
| 37 | 3300025949 | Ga0207667_10060863 | Ga0207667_100608632 | 241 |
| 38 | 3300044719 | Ga0466971_0133150 | Ga0466971_0133150_104_880 | 241 |
| 39 | 3300044765 | Ga0466970_0090551 | Ga0466970_0090551_240_1016 | 241 |
| 40 | 3300049652 | Ga0501202_033030 | Ga0501202_033030_195_956 | 241 |
| 41 | 3300049670 | Ga0501236_005654 | Ga0501236_005654_527_1288 | 241 |
| 42 | 3300049686 | Ga0501257_003492 | Ga0501257_003492_2542_3303 | 241 |
| 43 | 3300049761 | Ga0501264_000921 | Ga0501264_000921_2901_3662 | 241 |
| 44 | 3300053108 | Ga0500562_001277 | Ga0500562_001277_1400_2161 | 241 |
| 45 | 3300053151 | Ga0500604_0002030 | Ga0500604_0002030_740_1501 | 241 |
| 46 | 3300053156 | Ga0500622_0000089 | Ga0500622_0000089_89653_90414 | 241 |
| 47 | 3300053156 | Ga0500622_0000122 | Ga0500622_0000122_45096_45857 | 241 |
| 48 | 3300003320 | rootH2_10005386 | rootH2_1000538650 | 242 |
| 49 | 3300003322 | rootL2_10304334 | rootL2_103043342 | 242 |
| 50 | 3300005288 | Ga0065714_10068843 | Ga0065714_100688435 | 242 |
| 51 | 3300005327 | Ga0070658_10114340 | Ga0070658_101143402 | 242 |
| 52 | 3300005329 | Ga0070683_100072634 | Ga0070683_1000726344 | 242 |
| 53 | 3300005331 | Ga0070670_100093545 | Ga0070670_1000935453 | 242 |
| 54 | 3300005334 | Ga0068869_100060516 | Ga0068869_1000605163 | 242 |
| 55 | 3300005335 | Ga0070666_10028089 | Ga0070666_100280894 | 242 |
| 56 | 3300005338 | Ga0068868_100082447 | Ga0068868_1000824473 | 242 |
| 57 | 3300005343 | Ga0070687_100018453 | Ga0070687_1000184532 | 242 |
| 58 | 3300005347 | Ga0070668_100048133 | Ga0070668_1000481334 | 242 |
| 59 | 3300005355 | Ga0070671_100072275 | Ga0070671_1000722751 | 242 |
| 60 | 3300005355 | Ga0070671_100103389 | Ga0070671_1001033893 | 242 |
| 61 | 3300005355 | Ga0070671_100273983 | Ga0070671_1002739832 | 242 |
| 62 | 3300005356 | Ga0070674_100006543 | Ga0070674_1000065434 | 242 |
| 63 | 3300005356 | Ga0070674_100033345 | Ga0070674_1000333452 | 242 |
| 64 | 3300005364 | Ga0070673_100091595 | Ga0070673_1000915952 | 242 |
| 65 | 3300005367 | Ga0070667_100024892 | Ga0070667_1000248923 | 242 |
| 66 | 3300005457 | Ga0070662_100045752 | Ga0070662_1000457523 | 242 |
| 67 | 3300005459 | Ga0068867_100442164 | Ga0068867_1004421641 | 242 |
| 68 | 3300005466 | Ga0070685_10134809 | Ga0070685_101348093 | 242 |
| 69 | 3300005535 | Ga0070684_100035618 | Ga0070684_1000356181 | 242 |
| 70 | 3300005539 | Ga0068853_100057310 | Ga0068853_1000573103 | 242 |
| 71 | 3300005539 | Ga0068853_100334737 | Ga0068853_1003347371 | 242 |
| 72 | 3300005543 | Ga0070672_100083938 | Ga0070672_1000839382 | 242 |
| 73 | 3300005543 | Ga0070672_100110518 | Ga0070672_1001105182 | 242 |
| 74 | 3300005548 | Ga0070665_100000006 | Ga0070665_100000006220 | 242 |
| 75 | 3300005548 | Ga0070665_100051804 | Ga0070665_1000518044 | 242 |
| 76 | 3300005563 | Ga0068855_100000729 | Ga0068855_10000072917 | 242 |
| 77 | 3300005563 | Ga0068855_100003624 | Ga0068855_1000036247 | 242 |
| 78 | 3300005564 | Ga0070664_100016212 | Ga0070664_1000162122 | 242 |
| 79 | 3300005577 | Ga0068857_100000893 | Ga0068857_1000008932 | 242 |
| 80 | 3300005577 | Ga0068857_100034016 | Ga0068857_1000340164 | 242 |
| 81 | 3300005577 | Ga0068857_100072158 | Ga0068857_1000721583 | 242 |
| 82 | 3300005578 | Ga0068854_100069020 | Ga0068854_1000690202 | 242 |
| 83 | 3300005578 | Ga0068854_100110713 | Ga0068854_1001107132 | 242 |
| 84 | 3300005578 | Ga0068854_100472536 | Ga0068854_1004725361 | 242 |
| 85 | 3300005578 | Ga0068854_100484451 | Ga0068854_1004844511 | 242 |
| 86 | 3300005614 | Ga0068856_100046205 | Ga0068856_1000462054 | 242 |
| 87 | 3300005614 | Ga0068856_100050870 | Ga0068856_1000508702 | 242 |
| 88 | 3300005614 | Ga0068856_100077327 | Ga0068856_1000773273 | 242 |
| 89 | 3300005616 | Ga0068852_100000186 | Ga0068852_10000018619 | 242 |
| 90 | 3300005616 | Ga0068852_100003015 | Ga0068852_1000030159 | 242 |
| 91 | 3300005616 | Ga0068852_100146306 | Ga0068852_1001463062 | 242 |
| 92 | 3300005616 | Ga0068852_100177357 | Ga0068852_1001773572 | 242 |
| 93 | 3300005616 | Ga0068852_100281239 | Ga0068852_1002812392 | 242 |
| 94 | 3300005617 | Ga0068859_100003950 | Ga0068859_1000039508 | 242 |
| 95 | 3300005617 | Ga0068859_100043727 | Ga0068859_1000437278 | 242 |
| 96 | 3300005617 | Ga0068859_100152865 | Ga0068859_1001528652 | 242 |
| 97 | 3300005618 | Ga0068864_100026260 | Ga0068864_1000262604 | 242 |
| 98 | 3300005618 | Ga0068864_100029827 | Ga0068864_1000298273 | 242 |
| 99 | 3300005618 | Ga0068864_100038280 | Ga0068864_1000382805 | 242 |
| 100 | 3300005718 | Ga0068866_10048512 | Ga0068866_100485122 | 242 |
| 101 | 3300005834 | Ga0068851_10096638 | Ga0068851_100966382 | 242 |
| 102 | 3300005841 | Ga0068863_100025880 | Ga0068863_1000258806 | 242 |
| 103 | 3300005841 | Ga0068863_100548039 | Ga0068863_1005480392 | 242 |
| 104 | 3300005841 | Ga0068863_100860966 | Ga0068863_1008609661 | 242 |
| 105 | 3300005842 | Ga0068858_100006865 | Ga0068858_1000068652 | 242 |
| 106 | 3300005842 | Ga0068858_100020178 | Ga0068858_1000201784 | 242 |
| 107 | 3300005842 | Ga0068858_100485013 | Ga0068858_1004850132 | 242 |
| 108 | 3300005843 | Ga0068860_100005701 | Ga0068860_10000570111 | 242 |
| 109 | 3300005843 | Ga0068860_100010863 | Ga0068860_1000108636 | 242 |
| 110 | 3300005843 | Ga0068860_100057965 | Ga0068860_1000579652 | 242 |
| 111 | 3300005843 | Ga0068860_100069495 | Ga0068860_1000694952 | 242 |
| 112 | 3300005844 | Ga0068862_100093792 | Ga0068862_1000937921 | 242 |
| 113 | 3300006237 | Ga0097621_100211198 | Ga0097621_1002111982 | 242 |
| 114 | 3300006237 | Ga0097621_100306903 | Ga0097621_1003069032 | 242 |
| 115 | 3300006358 | Ga0068871_100026281 | Ga0068871_1000262812 | 242 |
| 116 | 3300006847 | Ga0075431_100002152 | Ga0075431_10000215216 | 242 |
| 117 | 3300006880 | Ga0075429_100023604 | Ga0075429_1000236043 | 242 |
| 118 | 3300006931 | Ga0097620_100003950 | Ga0097620_10000395010 | 242 |
| 119 | 3300006931 | Ga0097620_100043730 | Ga0097620_1000437308 | 242 |
| 120 | 3300006931 | Ga0097620_100152857 | Ga0097620_1001528572 | 242 |
| 121 | 3300009093 | Ga0105240_10000351 | Ga0105240_1000035148 | 242 |
| 122 | 3300009093 | Ga0105240_10002264 | Ga0105240_100022643 | 242 |
| 123 | 3300009093 | Ga0105240_10007119 | Ga0105240_100071195 | 242 |
| 124 | 3300009093 | Ga0105240_10014167 | Ga0105240_100141674 | 242 |
| 125 | 3300009101 | Ga0105247_10003538 | Ga0105247_100035388 | 242 |
| 126 | 3300009101 | Ga0105247_10006991 | Ga0105247_100069913 | 242 |
| 127 | 3300009174 | Ga0105241_10000346 | Ga0105241_1000034617 | 242 |
| 128 | 3300009174 | Ga0105241_10001476 | Ga0105241_100014764 | 242 |
| 129 | 3300009174 | Ga0105241_10020015 | Ga0105241_100200154 | 242 |
| 130 | 3300009176 | Ga0105242_10023669 | Ga0105242_100236694 | 242 |
| 131 | 3300009176 | Ga0105242_10381093 | Ga0105242_103810933 | 242 |
| 132 | 3300009545 | Ga0105237_10000256 | Ga0105237_100002569 | 242 |
| 133 | 3300009545 | Ga0105237_10004608 | Ga0105237_100046085 | 242 |
| 134 | 3300009545 | Ga0105237_10015667 | Ga0105237_100156672 | 242 |
| 135 | 3300009545 | Ga0105237_10030640 | Ga0105237_100306407 | 242 |
| 136 | 3300009545 | Ga0105237_10102969 | Ga0105237_101029692 | 242 |
| 137 | 3300009545 | Ga0105237_10215506 | Ga0105237_102155062 | 242 |
| 138 | 3300009551 | Ga0105238_10000808 | Ga0105238_100008084 | 242 |
| 139 | 3300009551 | Ga0105238_10484925 | Ga0105238_104849253 | 242 |
| 140 | 3300009553 | Ga0105249_10000336 | Ga0105249_1000033626 | 242 |
| 141 | 3300009553 | Ga0105249_10029294 | Ga0105249_100292946 | 242 |
| 142 | 3300009553 | Ga0105249_10047148 | Ga0105249_100471482 | 242 |
| 143 | 3300009553 | Ga0105249_10116247 | Ga0105249_101162473 | 242 |
| 144 | 3300009553 | Ga0105249_10145963 | Ga0105249_101459633 | 242 |
| 145 | 3300009553 | Ga0105249_10213316 | Ga0105249_102133162 | 242 |
| 146 | 3300010375 | Ga0105239_10000848 | Ga0105239_1000084827 | 242 |
| 147 | 3300010375 | Ga0105239_10002624 | Ga0105239_1000262413 | 242 |
| 148 | 3300010375 | Ga0105239_10016783 | Ga0105239_100167836 | 242 |
| 149 | 3300010375 | Ga0105239_10033117 | Ga0105239_100331174 | 242 |
| 150 | 3300010375 | Ga0105239_10258423 | Ga0105239_102584232 | 242 |
| 151 | 3300011119 | Ga0105246_10033967 | Ga0105246_100339671 | 242 |
| 152 | 3300011119 | Ga0105246_10551830 | Ga0105246_105518302 | 242 |
| 153 | 3300013102 | Ga0157371_10275938 | Ga0157371_102759382 | 242 |
| 154 | 3300013104 | Ga0157370_10016708 | Ga0157370_100167082 | 242 |
| 155 | 3300013104 | Ga0157370_10035168 | Ga0157370_100351682 | 242 |
| 156 | 3300013104 | Ga0157370_10036409 | Ga0157370_100364094 | 242 |
| 157 | 3300013105 | Ga0157369_10010939 | Ga0157369_100109394 | 242 |
| 158 | 3300013296 | Ga0157374_10097696 | Ga0157374_100976963 | 242 |
| 159 | 3300013296 | Ga0157374_10129246 | Ga0157374_101292463 | 242 |
| 160 | 3300013297 | Ga0157378_10016330 | Ga0157378_100163305 | 242 |
| 161 | 3300013297 | Ga0157378_10038460 | Ga0157378_100384603 | 242 |
| 162 | 3300013297 | Ga0157378_10078445 | Ga0157378_100784454 | 242 |
| 163 | 3300013306 | Ga0163162_10000549 | Ga0163162_100005498 | 242 |
| 164 | 3300013306 | Ga0163162_10000578 | Ga0163162_1000057813 | 242 |
| 165 | 3300013307 | Ga0157372_10001557 | Ga0157372_1000155719 | 242 |
| 166 | 3300013308 | Ga0157375_10071294 | Ga0157375_100712941 | 242 |
| 167 | 3300013308 | Ga0157375_10104789 | Ga0157375_101047892 | 242 |
| 168 | 3300014325 | Ga0163163_10156620 | Ga0163163_101566203 | 242 |
| 169 | 3300014325 | Ga0163163_10354965 | Ga0163163_103549651 | 242 |
| 170 | 3300014325 | Ga0163163_10385577 | Ga0163163_103855772 | 242 |
| 171 | 3300014745 | Ga0157377_10058160 | Ga0157377_100581601 | 242 |
| 172 | 3300014968 | Ga0157379_10031590 | Ga0157379_100315904 | 242 |
| 173 | 3300014969 | Ga0157376_10014879 | Ga0157376_100148792 | 242 |
| 174 | 3300020069 | Ga0197907_10093024 | Ga0197907_100930242 | 242 |
| 175 | 3300020078 | Ga0206352_10451156 | Ga0206352_104511563 | 242 |
| 176 | 3300020080 | Ga0206350_10948500 | Ga0206350_109485002 | 242 |
| 177 | 3300022467 | Ga0224712_10059669 | Ga0224712_100596692 | 242 |
| 178 | 3300025315 | Ga0207697_10021762 | Ga0207697_100217624 | 242 |
| 179 | 3300025900 | Ga0207710_10007962 | Ga0207710_100079628 | 242 |
| 180 | 3300025900 | Ga0207710_10009656 | Ga0207710_100096565 | 242 |
| 181 | 3300025901 | Ga0207688_10005338 | Ga0207688_100053385 | 242 |
| 182 | 3300025901 | Ga0207688_10010181 | Ga0207688_100101813 | 242 |
| 183 | 3300025903 | Ga0207680_10000021 | Ga0207680_1000002113 | 242 |
| 184 | 3300025903 | Ga0207680_10021672 | Ga0207680_100216722 | 242 |
| 185 | 3300025903 | Ga0207680_10144095 | Ga0207680_101440951 | 242 |
| 186 | 3300025904 | Ga0207647_10140238 | Ga0207647_101402382 | 242 |
| 187 | 3300025907 | Ga0207645_10023805 | Ga0207645_100238052 | 242 |
| 188 | 3300025907 | Ga0207645_10026059 | Ga0207645_100260592 | 242 |
| 189 | 3300025908 | Ga0207643_10053744 | Ga0207643_100537442 | 242 |
| 190 | 3300025911 | Ga0207654_10002905 | Ga0207654_100029055 | 242 |
| 191 | 3300025911 | Ga0207654_10007894 | Ga0207654_100078945 | 242 |
| 192 | 3300025911 | Ga0207654_10106767 | Ga0207654_101067672 | 242 |
| 193 | 3300025913 | Ga0207695_10000073 | Ga0207695_1000007359 | 242 |
| 194 | 3300025913 | Ga0207695_10000706 | Ga0207695_1000070628 | 242 |
| 195 | 3300025913 | Ga0207695_10008241 | Ga0207695_100082419 | 242 |
| 196 | 3300025913 | Ga0207695_10089366 | Ga0207695_100893663 | 242 |
| 197 | 3300025914 | Ga0207671_10006526 | Ga0207671_100065262 | 242 |
| 198 | 3300025914 | Ga0207671_10010655 | Ga0207671_100106556 | 242 |
| 199 | 3300025914 | Ga0207671_10023108 | Ga0207671_100231082 | 242 |
| 200 | 3300025924 | Ga0207694_10006125 | Ga0207694_100061253 | 242 |
| 201 | 3300025924 | Ga0207694_10011131 | Ga0207694_100111314 | 242 |
| 202 | 3300025931 | Ga0207644_10122399 | Ga0207644_101223991 | 242 |
| 203 | 3300025933 | Ga0207706_10027620 | Ga0207706_100276203 | 242 |
| 204 | 3300025933 | Ga0207706_10048113 | Ga0207706_100481132 | 242 |
| 205 | 3300025934 | Ga0207686_10081477 | Ga0207686_100814772 | 242 |
| 206 | 3300025935 | Ga0207709_10176843 | Ga0207709_101768433 | 242 |
| 207 | 3300025936 | Ga0207670_10033207 | Ga0207670_100332071 | 242 |
| 208 | 3300025937 | Ga0207669_10059454 | Ga0207669_100594543 | 242 |
| 209 | 3300025938 | Ga0207704_10075283 | Ga0207704_100752832 | 242 |
| 210 | 3300025938 | Ga0207704_10093952 | Ga0207704_100939522 | 242 |
| 211 | 3300025940 | Ga0207691_10031320 | Ga0207691_100313204 | 242 |
| 212 | 3300025942 | Ga0207689_10001626 | Ga0207689_1000162611 | 242 |
| 213 | 3300025942 | Ga0207689_10019614 | Ga0207689_100196146 | 242 |
| 214 | 3300025942 | Ga0207689_10028551 | Ga0207689_100285515 | 242 |
| 215 | 3300025944 | Ga0207661_10117260 | Ga0207661_101172602 | 242 |
| 216 | 3300025949 | Ga0207667_10000519 | Ga0207667_1000051933 | 242 |
| 217 | 3300025949 | Ga0207667_10004401 | Ga0207667_1000440115 | 242 |
| 218 | 3300025949 | Ga0207667_10006731 | Ga0207667_1000673111 | 242 |
| 219 | 3300025960 | Ga0207651_10293902 | Ga0207651_102939022 | 242 |
| 220 | 3300025960 | Ga0207651_10438184 | Ga0207651_104381841 | 242 |
| 221 | 3300025961 | Ga0207712_10001697 | Ga0207712_100016979 | 242 |
| 222 | 3300025961 | Ga0207712_10027199 | Ga0207712_100271993 | 242 |
| 223 | 3300025961 | Ga0207712_10086905 | Ga0207712_100869053 | 242 |
| 224 | 3300025972 | Ga0207668_10205591 | Ga0207668_102055911 | 242 |
| 225 | 3300025981 | Ga0207640_10014596 | Ga0207640_100145963 | 242 |
| 226 | 3300025981 | Ga0207640_10073629 | Ga0207640_100736292 | 242 |
| 227 | 3300025981 | Ga0207640_10343605 | Ga0207640_103436052 | 242 |
| 228 | 3300026023 | Ga0207677_10078497 | Ga0207677_100784972 | 242 |
| 229 | 3300026023 | Ga0207677_10151991 | Ga0207677_101519912 | 242 |
| 230 | 3300026023 | Ga0207677_10422434 | Ga0207677_104224342 | 242 |
| 231 | 3300026023 | Ga0207677_10451592 | Ga0207677_104515922 | 242 |
| 232 | 3300026035 | Ga0207703_10029921 | Ga0207703_100299216 | 242 |
| 233 | 3300026041 | Ga0207639_10024321 | Ga0207639_100243212 | 242 |
| 234 | 3300026041 | Ga0207639_10055256 | Ga0207639_100552562 | 242 |
| 235 | 3300026041 | Ga0207639_10372122 | Ga0207639_103721221 | 242 |
| 236 | 3300026075 | Ga0207708_10086125 | Ga0207708_100861252 | 242 |
| 237 | 3300026088 | Ga0207641_10003759 | Ga0207641_100037599 | 242 |
| 238 | 3300026088 | Ga0207641_10048643 | Ga0207641_100486435 | 242 |
| 239 | 3300026088 | Ga0207641_10147319 | Ga0207641_101473193 | 242 |
| 240 | 3300026089 | Ga0207648_10000810 | Ga0207648_1000081029 | 242 |
| 241 | 3300026089 | Ga0207648_10325325 | Ga0207648_103253252 | 242 |
| 242 | 3300026095 | Ga0207676_10084141 | Ga0207676_100841413 | 242 |
| 243 | 3300026095 | Ga0207676_10486808 | Ga0207676_104868082 | 242 |
| 244 | 3300026116 | Ga0207674_10002149 | Ga0207674_1000214919 | 242 |
| 245 | 3300026116 | Ga0207674_10080839 | Ga0207674_100808393 | 242 |
| 246 | 3300026116 | Ga0207674_10091054 | Ga0207674_100910542 | 242 |
| 247 | 3300026118 | Ga0207675_100417917 | Ga0207675_1004179173 | 242 |
| 248 | 3300026121 | Ga0207683_10002383 | Ga0207683_100023832 | 242 |
| 249 | 3300026142 | Ga0207698_10009124 | Ga0207698_100091242 | 242 |
| 250 | 3300026142 | Ga0207698_10052085 | Ga0207698_100520852 | 242 |
| 251 | 3300026142 | Ga0207698_10187294 | Ga0207698_101872942 | 242 |
| 252 | 3300028379 | Ga0268266_10000010 | Ga0268266_10000010301 | 242 |
| 253 | 3300028380 | Ga0268265_10091675 | Ga0268265_100916752 | 242 |
| 254 | 3300028381 | Ga0268264_10000012 | Ga0268264_10000012145 | 242 |
| 255 | 3300028381 | Ga0268264_10001668 | Ga0268264_1000166812 | 242 |
| 256 | 3300028381 | Ga0268264_10008992 | Ga0268264_100089927 | 242 |
| 257 | 3300028381 | Ga0268264_10060516 | Ga0268264_100605162 | 242 |
| 258 | 3300028381 | Ga0268264_10205280 | Ga0268264_102052802 | 242 |
| 259 | 3300028381 | Ga0268264_10481180 | Ga0268264_104811802 | 242 |
| 260 | 3300028381 | Ga0268264_10699996 | Ga0268264_106999961 | 242 |
| 261 | 3300028786 | Ga0307517_10273960 | Ga0307517_102739601 | 242 |
| 262 | 3300030521 | Ga0307511_10002561 | Ga0307511_1000256114 | 242 |
| 263 | 3300031251 | Ga0265327_10002557 | Ga0265327_1000255716 | 242 |
| 264 | 3300031507 | Ga0307509_10071606 | Ga0307509_100716062 | 242 |
| 265 | 3300031507 | Ga0307509_10458720 | Ga0307509_104587201 | 242 |
| 266 | 3300031730 | Ga0307516_10002039 | Ga0307516_1000203915 | 242 |
| 267 | 3300031901 | Ga0307406_10195734 | Ga0307406_101957342 | 242 |
| 268 | 3300032002 | Ga0307416_100180895 | Ga0307416_1001808952 | 242 |
| 269 | 3300035692 | Ga0373935_0302257 | Ga0373935_0302257_280_1074 | 242 |
| 270 | 3300041404 | Ga0439436_0000567 | Ga0439436_0000567_2159_2947 | 242 |
| 271 | 3300041406 | Ga0439439_0000898 | Ga0439439_0000898_3069_3857 | 242 |
| 272 | 3300042007 | Ga0439449_0013247 | Ga0439449_0013247_435_1223 | 242 |
| 273 | 3300042014 | Ga0439457_000087 | Ga0439457_000087_1797_2585 | 242 |
| 274 | 3300042015 | Ga0439462_0005385 | Ga0439462_0005385_732_1520 | 242 |
| 275 | 3300044658 | Ga0466972_0001672 | Ga0466972_0001672_1429_2211 | 242 |
| 276 | 3300044735 | Ga0466968_0020985 | Ga0466968_0020985_1489_2271 | 242 |
| 277 | 3300044842 | Ga0466957_0000636 | Ga0466957_0000636_7471_8244 | 242 |
| 278 | 3300044842 | Ga0466957_0408263 | Ga0466957_0408263_77_862 | 242 |
| 279 | 3300045049 | Ga0466959_0000089 | Ga0466959_0000089_50481_51254 | 242 |
| 280 | 3300046471 | Ga0495650_0019376 | Ga0495650_0019376_985_1758 | 242 |
| 281 | 3300046648 | Ga0495611_0000665 | Ga0495611_0000665_7029_7799 | 242 |
| 282 | 3300047320 | Ga0495672_0030031 | Ga0495672_0030031_2489_3262 | 242 |
| 283 | 3300047320 | Ga0495672_0093430 | Ga0495672_0093430_16_789 | 242 |
| 284 | 3300047443 | Ga0495687_000009 | Ga0495687_000009_50180_50962 | 242 |
| 285 | 3300047472 | Ga0495686_0000058 | Ga0495686_0000058_167925_168698 | 242 |
| 286 | 3300047472 | Ga0495686_0010710 | Ga0495686_0010710_2872_3645 | 242 |
| 287 | 3300047472 | Ga0495686_0019592 | Ga0495686_0019592_619_1392 | 242 |
| 288 | 3300047472 | Ga0495686_0189221 | Ga0495686_0189221_329_1117 | 242 |
| 289 | 3300049569 | Ga0501032_0009769 | Ga0501032_0009769_1876_2649 | 242 |
| 290 | 3300049571 | Ga0501034_0002588 | Ga0501034_0002588_14926_15699 | 242 |
| 291 | 3300049572 | Ga0501036_0180094 | Ga0501036_0180094_301_1074 | 242 |
| 292 | 3300049573 | Ga0501037_0006989 | Ga0501037_0006989_1642_2415 | 242 |
| 293 | 3300049575 | Ga0501039_0043991 | Ga0501039_0043991_1546_2319 | 242 |
| 294 | 3300049579 | Ga0501043_0032485 | Ga0501043_0032485_2613_3386 | 242 |
| 295 | 3300049579 | Ga0501043_0084610 | Ga0501043_0084610_1071_1844 | 242 |
| 296 | 3300049579 | Ga0501043_0160289 | Ga0501043_0160289_539_1330 | 242 |
| 297 | 3300049580 | Ga0501046_0537100 | Ga0501046_0537100_21_800 | 242 |
| 298 | 3300049581 | Ga0501047_0034975 | Ga0501047_0034975_2176_2949 | 242 |
| 299 | 3300049581 | Ga0501047_0050085 | Ga0501047_0050085_734_1513 | 242 |
| 300 | 3300049581 | Ga0501047_0131086 | Ga0501047_0131086_798_1571 | 242 |
| 301 | 3300049581 | Ga0501047_0131252 | Ga0501047_0131252_1219_1995 | 242 |
| 302 | 3300049742 | Ga0501080_0329142 | Ga0501080_0329142_461_1246 | 242 |
| 303 | 3300049822 | Ga0501035_0004710 | Ga0501035_0004710_9947_10720 | 242 |
| 304 | 3300049823 | Ga0501044_0015808 | Ga0501044_0015808_2297_3070 | 242 |
| 305 | 3300050493 | nmdc:mga0k408_42060_c1 | nmdc:mga0k408_42060_c1_1308_2081 | 242 |
| 306 | 3300050510 | nmdc:mga06r32_48007_c1 | nmdc:mga06r32_48007_c1_1503_2276 | 242 |
| 307 | 3300050511 | nmdc:mga08y16_152243_c1 | nmdc:mga08y16_152243_c1_1578_2351 | 242 |
| 308 | 3300053088 | Ga0500644_0016176 | Ga0500644_0016176_71_859 | 242 |
| 309 | 3300053092 | Ga0500583_0000002 | Ga0500583_0000002_122512_123297 | 242 |
| 310 | 3300053092 | Ga0500583_0034170 | Ga0500583_0034170_36_818 | 242 |
| 311 | 3300053093 | Ga0500651_0189458 | Ga0500651_0189458_134_919 | 242 |
| 312 | 3300053096 | Ga0500641_0082044 | Ga0500641_0082044_366_1139 | 242 |
| 313 | 3300053098 | Ga0500650_0075216 | Ga0500650_0075216_611_1399 | 242 |
| 314 | 3300053103 | Ga0500555_026325 | Ga0500555_026325_618_1406 | 242 |
| 315 | 3300053134 | Ga0500658_0074986 | Ga0500658_0074986_346_1134 | 242 |
| 316 | 3300053134 | Ga0500658_0129904 | Ga0500658_0129904_252_1037 | 242 |
| 317 | 3300053139 | Ga0500568_0013364 | Ga0500568_0013364_577_1359 | 242 |
| 318 | 3300053147 | Ga0500589_003680 | Ga0500589_003680_2068_2853 | 242 |
| 319 | 3300053156 | Ga0500622_0001005 | Ga0500622_0001005_19674_20456 | 242 |
| 320 | 3300053156 | Ga0500622_0020307 | Ga0500622_0020307_1868_2653 | 242 |
| 321 | 3300053156 | Ga0500622_0124210 | Ga0500622_0124210_203_988 | 242 |
| 322 | 3300053727 | Ga0500611_013474 | Ga0500611_013474_442_1227 | 242 |
| 323 | 3300053739 | Ga0500587_005075 | Ga0500587_005075_432_1217 | 242 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5c5k-assembly1.cif.gz_A | structure of the pfr form of a canonical phytochrome | 0.7237 | 134 | 163 |
| 8avx-assembly1.cif.gz_A | cryo-em structure of drbphp in pfr state | 0.7174 | 134 | 163 |
| 7nfe-assembly1.cif.gz_C | cryo-em structure of nhej super-complex (monomer) | 0.7124 | 5 | 231 |
| 8asc-assembly1.cif.gz_B | ku70/80 binds to the ku-binding motif of paxx | 0.7098 | 1 | 197 |
| 5tsh-assembly1.cif.gz_A | pilb from geobacter metallireducens bound to amp-pnp | 0.7065 | 134 | 162 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6erfA02 | Mainly Beta;Beta Barrel;Ku70; Chain: A; Domain 2; | 0.752 | 2 | 164 | 2.40.290.10 |
| af_A0A1D6ETJ1_1_68_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.7493 | 132 | 165 | 2.40.50.140 |
| af_P32807_339_451_2.40.290.10 | Mainly Beta;Beta Barrel;Ku70; Chain: A; Domain 2; | 0.7489 | 65 | 164 | 2.40.290.10 |
| af_Q75IP6_213_415_2.40.290.10 | Mainly Beta;Beta Barrel;Ku70; Chain: A; Domain 2; | 0.7404 | 2 | 178 | 2.40.290.10 |
| af_Q4DHP5_233_418_2.40.290.10 | Mainly Beta;Beta Barrel;Ku70; Chain: A; Domain 2; | 0.7323 | 6 | 175 | 2.40.290.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1X9XVN8-F1-model_v4 | Clade I nitrous oxide reductase | 0.9325 | 89 | 163 |
GO:0003690
GO:0006303 |
| AF-A0A536VMD1-F1-model_v4 | Ku protein | 0.9246 | 89 | 201 |
GO:0003690
GO:0006303 |
| AF-A0A536VMD1-F1-model_v4 | Ku protein | 0.9093 | 89 | 201 |
GO:0003690
GO:0006303 |
| AF-A0A5S9M9T1-F1-model_v4 | Ku domain-containing protein | 0.9063 | 89 | 181 |
GO:0003690
GO:0006303 |
| AF-A0A251XHP8-F1-model_v4 | Putative DNA repair protein YkoV | 0.8633 | 95 | 227 |
GO:0003690
GO:0006303 GO:0006310 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar