F406154

General Info

Members Datasets Scaffolds Average Seq Length
321 197 296 321

Family's Representative Sequence

Representative Sequence 3300048927|Ga0496124_0005804|Ga0496124_0005804_2159_3268
Length 369
Sequence MRAGFPALHGCRGTRALAMAPGGDVSGPVHAMGNRWGRIMADMLTVNRAAMPGDCKGFRRMFAPHRLTLGVFFPIEAFAGDQPTMAGQERLARRAEALGYAALWCRDVPLRDPAFGDVGQVYDPWVYLGWVAAQTTDIALATGALVLTLRHPLHTAKGVASVDRLSGNRLVLGVASGDRPVEFPAFGIDFDQRSALFRDNLRVVKTVLGEEFPQLQWPHGTLDGSADLIPKPITPVPMLVTGHSGQSLEWIAKHADGWITYPRGLPRQAEVAAQWRAAVEIAAPGSFKPFVQSLYVDLSDDPDAAPTPIHLGFRGGRHFVLRFLEALRSVGVNHVILNLKYGARNAGDVLDEIGQEILPRLADGQADAG

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
5 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
6 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
7 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
8 2738541277 Variovorax sp. GV051 Isolate Unclassified
9 2738543019 Variovorax sp. GV040 Isolate Unclassified
10 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
11 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
12 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
13 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
14 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
15 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
16 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
17 2857553236 Duganella sp. R-74557 Isolate Unclassified
18 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
19 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
20 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
21 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
22 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
23 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
24 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
25 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
26 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
27 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
28 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
29 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
30 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
31 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
32 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
33 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
34 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
67 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
68 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
70 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
72 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
87 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
91 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
92 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
93 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
94 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
95 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
96 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
97 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
98 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
99 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
100 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
101 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
102 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
103 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
104 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
105 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
106 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
107 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
108 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
109 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
110 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
111 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
112 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
113 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
114 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
115 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
116 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
117 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
118 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
119 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
120 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
121 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
122 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
123 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
124 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
125 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
126 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
127 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
128 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
129 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
130 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
131 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
132 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
133 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
134 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
135 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
136 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
137 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
138 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
139 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
140 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
141 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
142 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
143 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
144 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
145 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
146 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
147 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
148 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
149 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
150 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
151 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
152 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
153 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
154 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
155 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
156 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
157 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
158 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
159 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
160 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
161 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
162 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
178 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
179 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
180 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
181 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
182 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
183 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
184 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
185 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
186 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
187 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
188 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
191 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
192 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
193 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
194 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
195 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
196 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
197 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.21
Metatranscriptomes 0
Isolates 7.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.17
Nodule 1.25
Rhizoplane 6.54
Rhizosphere 75.08
Stem 0
Stem Tuber 0
Unclassified 9.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10045824 3300001989 Bacteria 1433
2 JGI24735J21928_10000870 3300002067 Bacteria 10771
3 JGI25156J39149_1000205 3300002705 Bacteria 40906
4 JGI25156J39149_1000546 3300002705 Bacteria 21611
5 JGI25165J46597_1000441 3300003214 Bacteria 41844
6 rootL2_10153945 3300003322 Bacteria 2849
7 rootH1_10371374 3300003323 Bacteria 1301
8 Ga0055533_1000094 3300003756 Bacteria 115741
9 Ga0055532_1000003 3300003758 Bacteria 494004
10 Ga0055525_1003438 3300003759 Bacteria 1422
11 Ga0055527_1000006 3300003760 Bacteria 494004
12 Ga0055535_1000003 3300003761 Bacteria 494004
13 Ga0055542_1000007 3300003762 Bacteria 494004
14 Ga0055529_1000003 3300003763 Bacteria 494004
15 Ga0068869_100304415 3300005334 Bacteria 1288
16 Ga0070668_100015822 3300005347 Bacteria 5642
17 Ga0070669_100059050 3300005353 Unclassified 2816
18 Ga0070674_100031943 3300005356 Bacteria 3493
19 Ga0070673_100067944 3300005364 Bacteria 2852
20 Ga0070701_10184497 3300005438 Bacteria 1224
21 Ga0070662_100024518 3300005457 Bacteria 4157
22 Ga0070697_100350891 3300005536 Unclassified 1274
23 Ga0070672_100058731 3300005543 Bacteria 3024
24 Ga0070686_100086097 3300005544 Bacteria 2092
25 Ga0070664_100072078 3300005564 Bacteria 2962
26 Ga0070664_100184502 3300005564 Bacteria 1856
27 Ga0070717_10055673 3300006028 Bacteria 3264
28 Ga0105251_10000175 3300009011 Bacteria 64566
29 Ga0111539_10260037 3300009094 Bacteria 2021
30 Ga0111539_10528587 3300009094 Bacteria 1374
31 Ga0105243_10016494 3300009148 Bacteria 5584
32 Ga0105248_10183982 3300009177 Bacteria 2355
33 Ga0105238_10006479 3300009551 Bacteria 11643
34 Ga0157371_10009618 3300013102 Bacteria 7600
35 Ga0157370_10232934 3300013104 Bacteria 1704
36 Ga0157369_10308576 3300013105 Bacteria 1645
37 Ga0157374_10170506 3300013296 Bacteria 2123
38 Ga0163162_10114036 3300013306 Bacteria 2801
39 Ga0157380_10011047 3300014326 Bacteria 6514
40 Ga0182008_10000219 3300014497 Bacteria 44976
41 Ga0163161_10024628 3300017792 Bacteria 4253
42 Ga0209674_100025 3300025226 Bacteria 515942
43 Ga0209672_100002 3300025228 Bacteria 1733325
44 Ga0209147_100003 3300025229 Bacteria 1733325
45 Ga0209563_100390 3300025230 Bacteria 15705
46 Ga0209258_100005 3300025242 Bacteria 1087938
47 Ga0209148_1000006 3300025254 Bacteria 1733325
48 Ga0209759_1000002 3300025256 Bacteria 1027596
49 Ga0209759_1000014 3300025256 Bacteria 396291
50 Ga0209233_1000018 3300025261 Bacteria 886857
51 Ga0209455_1000003 3300025272 Bacteria 1471893
52 Ga0209025_1010682 3300025294 Bacteria 6180
53 Ga0209564_1012403 3300025295 Bacteria 3717
54 Ga0207426_1003902 3300025302 Bacteria 7669
55 Ga0207713_1014103 3300025735 Bacteria 4171
56 Ga0207647_10121199 3300025904 Bacteria 1542
57 Ga0207643_10002957 3300025908 Bacteria 9171
58 Ga0207694_10330660 3300025924 Bacteria 1259
59 Ga0207706_10050585 3300025933 Bacteria 3672
60 Ga0207709_10001401 3300025935 Bacteria 16856
61 Ga0207691_10067720 3300025940 Bacteria 3227
62 Ga0207691_10132609 3300025940 Bacteria 2199
63 Ga0207679_10153410 3300025945 Bacteria 1878
64 Ga0207679_10216565 3300025945 Bacteria 1609
65 Ga0207712_10006164 3300025961 Bacteria 7559
66 Ga0207668_10010760 3300025972 Bacteria 5540
67 Ga0207674_10007807 3300026116 Bacteria 12442
68 Ga0207675_100021428 3300026118 Bacteria 6020
69 Ga0268266_10474685 3300028379 Bacteria 1192
70 Ga0268265_10005288 3300028380 Bacteria 8841
71 Ga0307408_100007070 3300031548 Bacteria 7426
72 Ga0307408_100112837 3300031548 Bacteria 2091
73 Ga0307407_10149775 3300031903 Unclassified 1515
74 Ga0307409_100183279 3300031995 Unclassified 1856
75 Ga0307416_100197111 3300032002 Bacteria 1906
76 Ga0307411_10230331 3300032005 Unclassified 1444
77 Ga0373936_0000024 3300035113 Bacteria 127202
78 Ga0436365_0477510 3300039437 Bacteria 2597
79 Ga0451577_0049740 3300042876 Bacteria 3742
80 Ga0495617_000043 3300046452 Bacteria 121136
81 Ga0495617_051677 3300046452 Bacteria 1366
82 Ga0495627_000007 3300046453 Bacteria 575915
83 Ga0495627_000286 3300046453 Bacteria 50832
84 Ga0495590_0000219 3300046457 Bacteria 31359
85 Ga0495590_0000420 3300046457 Bacteria 21382
86 Ga0495590_0003389 3300046457 Bacteria 6517
87 Ga0495629_0001851 3300046459 Bacteria 16570
88 Ga0495638_0000034 3300046460 Bacteria 282038
89 Ga0495638_0081179 3300046460 Bacteria 1969
90 Ga0495650_0000916 3300046471 Bacteria 34676
91 Ga0495650_0007274 3300046471 Bacteria 6698
92 Ga0495580_0002236 3300046472 Bacteria 16913
93 Ga0495580_0006758 3300046472 Bacteria 9300
94 Ga0495580_0025385 3300046472 Bacteria 4331
95 Ga0495580_0092632 3300046472 Bacteria 2104
96 Ga0495582_0005592 3300046473 Bacteria 6998
97 Ga0495582_0031148 3300046473 Bacteria 2930
98 Ga0495605_0000793 3300046474 Bacteria 22660
99 Ga0495605_0001275 3300046474 Bacteria 16694
100 Ga0495605_0034830 3300046474 Bacteria 2547
101 Ga0495605_0046946 3300046474 Bacteria 2120
102 Ga0495605_0056456 3300046474 Bacteria 1893
103 Ga0495662_0178683 3300046476 Bacteria 1046
104 Ga0495664_0124690 3300046477 Bacteria 1558
105 Ga0495664_0152402 3300046477 Bacteria 1402
106 Ga0495584_0000148 3300046491 Bacteria 48720
107 Ga0495584_0001714 3300046491 Bacteria 12832
108 Ga0495584_0004711 3300046491 Bacteria 7308
109 Ga0495584_0006257 3300046491 Bacteria 6246
110 Ga0495584_0023862 3300046491 Bacteria 3100
111 Ga0495584_0025741 3300046491 Bacteria 2982
112 Ga0495585_0001119 3300046492 Bacteria 22022
113 Ga0495585_0004313 3300046492 Bacteria 9259
114 Ga0495585_0015124 3300046492 Bacteria 4485
115 Ga0495585_0022447 3300046492 Bacteria 3623
116 Ga0495585_0163056 3300046492 Bacteria 1155
117 Ga0495594_0002053 3300046499 Bacteria 10491
118 Ga0495594_0137881 3300046499 Bacteria 1383
119 Ga0495596_0005361 3300046500 Bacteria 6070
120 Ga0495596_0005590 3300046500 Bacteria 5908
121 Ga0495607_0000010 3300046501 Bacteria 206525
122 Ga0495607_0006945 3300046501 Bacteria 7889
123 Ga0495607_0032834 3300046501 Bacteria 3164
124 Ga0495607_0037349 3300046501 Bacteria 2918
125 Ga0495583_0000690 3300046506 Bacteria 43729
126 Ga0495583_0001661 3300046506 Bacteria 21575
127 Ga0495606_0020518 3300046507 Bacteria 4868
128 Ga0495606_0027720 3300046507 Bacteria 4010
129 Ga0495606_0035114 3300046507 Bacteria 3432
130 Ga0495606_0069791 3300046507 Bacteria 2218
131 Ga0495608_0081285 3300046511 Bacteria 2106
132 Ga0495616_0021997 3300046513 Bacteria 3446
133 Ga0495620_0042660 3300046515 Bacteria 1980
134 Ga0495628_0003373 3300046516 Bacteria 14279
135 Ga0495628_0020412 3300046516 Bacteria 5464
136 Ga0495631_0006738 3300046518 Bacteria 5896
137 Ga0495631_0018862 3300046518 Bacteria 3242
138 Ga0495631_0028280 3300046518 Bacteria 2557
139 Ga0495643_0001036 3300046522 Bacteria 28185
140 Ga0495643_0004686 3300046522 Bacteria 9495
141 Ga0495643_0017545 3300046522 Bacteria 4181
142 Ga0495644_0008115 3300046523 Bacteria 4039
143 Ga0495644_0043970 3300046523 Bacteria 1680
144 Ga0495648_0000468 3300046524 Bacteria 43502
145 Ga0495648_0001041 3300046524 Bacteria 28146
146 Ga0495648_0082687 3300046524 Bacteria 1822
147 Ga0495663_0001481 3300046525 Bacteria 7390
148 Ga0495663_0016992 3300046525 Bacteria 2061
149 Ga0495666_0000311 3300046526 Bacteria 21164
150 Ga0495666_0000355 3300046526 Bacteria 20140
151 Ga0495642_0000970 3300046528 Bacteria 13358
152 Ga0495642_0012250 3300046528 Bacteria 3304
153 Ga0495642_0013496 3300046528 Bacteria 3161
154 Ga0495652_0058513 3300046529 Bacteria 3262
155 Ga0495654_0008325 3300046530 Bacteria 5735
156 Ga0495654_0026768 3300046530 Bacteria 2962
157 Ga0495665_0000544 3300046531 Bacteria 19125
158 Ga0495665_0003618 3300046531 Bacteria 8386
159 Ga0495665_0083155 3300046531 Bacteria 1683
160 Ga0495586_0085119 3300046535 Bacteria 1741
161 Ga0495609_0001136 3300046538 Bacteria 18419
162 Ga0495609_0015502 3300046538 Bacteria 3567
163 Ga0495609_0028058 3300046538 Bacteria 2570
164 Ga0495609_0028373 3300046538 Bacteria 2554
165 Ga0495609_0042506 3300046538 Bacteria 2041
166 Ga0495597_0000071 3300046542 Bacteria 88148
167 Ga0495597_0002487 3300046542 Bacteria 11628
168 Ga0495597_0003129 3300046542 Bacteria 9915
169 Ga0495597_0012515 3300046542 Bacteria 4093
170 Ga0495597_0032169 3300046542 Bacteria 2381
171 Ga0495645_0010269 3300046543 Bacteria 6563
172 Ga0495645_0104630 3300046543 Bacteria 2009
173 Ga0495622_0000681 3300046557 Bacteria 19308
174 Ga0495622_0025644 3300046557 Bacteria 2753
175 Ga0495633_0004924 3300046558 Bacteria 8343
176 Ga0495633_0006274 3300046558 Bacteria 7086
177 Ga0495633_0007638 3300046558 Bacteria 6190
178 Ga0495633_0016787 3300046558 Bacteria 3761
179 Ga0495656_0004096 3300046615 Bacteria 4967
180 Ga0495668_0006621 3300046616 Bacteria 7554
181 Ga0495668_0009109 3300046616 Bacteria 6123
182 Ga0495668_0017624 3300046616 Bacteria 4138
183 Ga0495668_0026610 3300046616 Bacteria 3281
184 Ga0495668_0028302 3300046616 Bacteria 3170
185 Ga0495668_0037278 3300046616 Bacteria 2720
186 Ga0495668_0103768 3300046616 Bacteria 1555
187 Ga0495611_0000001 3300046648 Bacteria 2628469
188 Ga0495611_0004070 3300046648 Bacteria 6361
189 Ga0495611_0016329 3300046648 Bacteria 3173
190 Ga0495625_0000001 3300046660 Bacteria 1641829
191 Ga0495625_0021485 3300046660 Bacteria 4971
192 Ga0495659_0043179 3300046664 Bacteria 1616
193 Ga0495661_0000659 3300046665 Bacteria 34605
194 Ga0495661_0019527 3300046665 Bacteria 4440
195 Ga0495661_0023573 3300046665 Bacteria 3993
196 Ga0495661_0034118 3300046665 Bacteria 3204
197 Ga0495669_0086534 3300046684 Bacteria 1443
198 Ga0495624_0048221 3300046690 Bacteria 2704
199 Ga0495670_0004923 3300046691 Bacteria 6560
200 Ga0495670_0031224 3300046691 Unclassified 2647
201 Ga0495671_0000419 3300046692 Bacteria 33808
202 Ga0495671_0000951 3300046692 Bacteria 20368
203 Ga0495671_0044730 3300046692 Bacteria 2219
204 Ga0495649_0009811 3300046694 Bacteria 5669
205 Ga0495649_0042500 3300046694 Bacteria 2483
206 Ga0495589_0000077 3300046794 Bacteria 90550
207 Ga0495589_0000969 3300046794 Bacteria 17519
208 Ga0495589_0008007 3300046794 Bacteria 5529
209 Ga0495589_0026722 3300046794 Bacteria 2923
210 Ga0495589_0030655 3300046794 Bacteria 2708
211 Ga0495600_0120391 3300046809 Bacteria 1707
212 Ga0495660_0000008 3300046810 Bacteria 435769
213 Ga0495660_0031221 3300046810 Bacteria 2996
214 Ga0495660_0078630 3300046810 Bacteria 1733
215 Ga0495581_0000385 3300047315 Bacteria 22158
216 Ga0495581_0022075 3300047315 Bacteria 3688
217 Ga0495581_0205079 3300047315 Bacteria 1153
218 Ga0495604_0012538 3300047317 Bacteria 6742
219 Ga0495636_0000821 3300047318 Bacteria 11452
220 Ga0495674_0001581 3300047319 Bacteria 22299
221 Ga0495674_0059612 3300047319 Bacteria 3333
222 Ga0495672_0008498 3300047320 Bacteria 7562
223 Ga0495672_0019863 3300047320 Bacteria 4418
224 Ga0495672_0074409 3300047320 Bacteria 1913
225 Ga0495676_0016953 3300047321 Bacteria 6450
226 Ga0495676_0082173 3300047321 Bacteria 2439
227 Ga0495683_0000036 3300047323 Bacteria 144974
228 Ga0495683_0000968 3300047323 Bacteria 20095
229 Ga0495683_0001009 3300047323 Bacteria 19627
230 Ga0495687_000065 3300047443 Bacteria 162721
231 Ga0495687_000241 3300047443 Bacteria 75515
232 Ga0495687_054686 3300047443 Bacteria 1674
233 Ga0495687_073850 3300047443 Bacteria 1358
234 Ga0495675_0082663 3300047444 Bacteria 2022
235 Ga0495677_0004774 3300047445 Bacteria 5164
236 Ga0495677_0005302 3300047445 Bacteria 4891
237 Ga0495677_0007964 3300047445 Bacteria 3938
238 Ga0495677_0017795 3300047445 Bacteria 2575
239 Ga0495679_000001 3300047446 Bacteria 1607568
240 Ga0495673_0000003 3300047469 Bacteria 1491337
241 Ga0495673_0001731 3300047469 Bacteria 16662
242 Ga0495681_0003460 3300047470 Bacteria 10977
243 Ga0495681_0012089 3300047470 Bacteria 5089
244 Ga0495686_0021691 3300047472 Bacteria 4260
245 Ga0495686_0024388 3300047472 Bacteria 3976
246 Ga0495593_0077555 3300047673 Bacteria 1721
247 Ga0495602_0001810 3300048088 Bacteria 21379
248 Ga0495626_0001699 3300048091 Bacteria 16911
249 Ga0495626_0004317 3300048091 Bacteria 8766
250 Ga0495626_0015077 3300048091 Bacteria 3961
251 Ga0495626_0069038 3300048091 Bacteria 1592
252 Ga0495626_0069240 3300048091 Bacteria 1589
253 Ga0496100_0022525 3300048903 Bacteria 3812
254 Ga0496101_0015728 3300048904 Bacteria 5106
255 Ga0496102_0000362 3300048905 Bacteria 54816
256 Ga0496102_0010431 3300048905 Bacteria 7991
257 Ga0496102_0035374 3300048905 Bacteria 4495
258 Ga0496103_0002165 3300048906 Bacteria 12485
259 Ga0496103_0005917 3300048906 Bacteria 7310
260 Ga0496104_0147743 3300048907 Bacteria 2257
261 Ga0496104_0153786 3300048907 Unclassified 2208
262 Ga0496105_0196451 3300048908 Bacteria 1648
263 Ga0496106_0011504 3300048909 Bacteria 6544
264 Ga0496107_0017309 3300048910 Bacteria 5068
265 Ga0496109_0325035 3300048912 Bacteria 1452
266 Ga0496109_0474716 3300048912 Bacteria 1181
267 Ga0496109_0569095 3300048912 Unclassified 1068
268 Ga0496110_0032114 3300048913 Bacteria 4532
269 Ga0496112_0035345 3300048915 Bacteria 4867
270 Ga0496113_0012045 3300048916 Bacteria 5800
271 Ga0496114_0022163 3300048917 Bacteria 5174
272 Ga0496114_0280159 3300048917 Unclassified 1470
273 Ga0496115_0175171 3300048918 Bacteria 1774
274 Ga0496116_0060355 3300048919 Bacteria 2460
275 Ga0496117_0015362 3300048920 Bacteria 6532
276 Ga0496118_0119196 3300048921 Bacteria 1726
277 Ga0496121_0037667 3300048924 Bacteria 4292
278 Ga0496122_0129584 3300048925 Bacteria 1606
279 Ga0496123_0022214 3300048926 Bacteria 4898
280 Ga0496124_0005804 3300048927 Bacteria 13729
281 Ga0496124_0028192 3300048927 Bacteria 5026
282 Ga0496124_0068690 3300048927 Bacteria 2944
283 Ga0496125_0006860 3300048928 Bacteria 12209
284 Ga0496125_0013595 3300048928 Bacteria 7993
285 Ga0495678_000004 3300049459 Bacteria 532920
286 Ga0495678_002304 3300049459 Bacteria 13170
287 Ga0495682_0000741 3300049460 Bacteria 21137
288 Ga0495682_0006213 3300049460 Bacteria 4859
289 Ga0501283_007279 3300049779 Unclassified 1572
290 nmdc:mga05p37_386174_c1 3300050507 Bacteria 1639
291 nmdc:mga08y16_142856_c1 3300050511 Unclassified 2488
292 nmdc:mga08y16_316757_c1 3300050511 Bacteria 1606
293 Ga0500643_000002 3300053087 Bacteria 1277657
294 Ga0500555_000019 3300053103 Bacteria 175470
295 Ga0500618_003023 3300053125 Bacteria 5979
296 Ga0500634_0000167 3300053161 Bacteria 21979

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025935 Ga0207709_10001401 Ga0207709_100014014 279
2 3300046459 Ga0495629_0001851 Ga0495629_0001851_12653_13519 287
3 3300046471 Ga0495650_0007274 Ga0495650_0007274_3181_4047 287
4 3300046476 Ga0495662_0178683 Ga0495662_0178683_97_963 287
5 3300046511 Ga0495608_0081285 Ga0495608_0081285_106_972 287
6 3300046528 Ga0495642_0012250 Ga0495642_0012250_443_1309 287
7 3300046543 Ga0495645_0010269 Ga0495645_0010269_2680_3546 287
8 3300046684 Ga0495669_0086534 Ga0495669_0086534_460_1326 287
9 3300046794 Ga0495589_0026722 Ga0495589_0026722_27_893 287
10 3300046809 Ga0495600_0120391 Ga0495600_0120391_150_1016 287
11 3300048917 Ga0496114_0022163 Ga0496114_0022163_2854_3720 287
12 3300047321 Ga0495676_0016953 Ga0495676_0016953_1315_2235 291
13 3300046538 Ga0495609_0042506 Ga0495609_0042506_14_916 294
14 3300003322 rootL2_10153945 rootL2_101539453 300
15 3300005353 Ga0070669_100059050 Ga0070669_1000590501 300
16 3300009094 Ga0111539_10528587 Ga0111539_105285872 300
17 3300009148 Ga0105243_10016494 Ga0105243_100164943 300
18 3300014326 Ga0157380_10011047 Ga0157380_100110473 300
19 3300025933 Ga0207706_10050585 Ga0207706_100505852 300
20 3300025940 Ga0207691_10067720 Ga0207691_100677204 300
21 3300025961 Ga0207712_10006164 Ga0207712_100061642 300
22 3300025972 Ga0207668_10010760 Ga0207668_100107603 300
23 3300026116 Ga0207674_10007807 Ga0207674_100078078 300
24 3300026118 Ga0207675_100021428 Ga0207675_1000214285 300
25 3300035113 Ga0373936_0000024 Ga0373936_0000024_24649_25575 300
26 3300046452 Ga0495617_051677 Ga0495617_051677_60_980 300
27 3300046460 Ga0495638_0081179 Ga0495638_0081179_639_1559 300
28 3300046473 Ga0495582_0031148 Ga0495582_0031148_665_1585 300
29 3300046474 Ga0495605_0034830 Ga0495605_0034830_680_1600 300
30 3300046474 Ga0495605_0056456 Ga0495605_0056456_322_1242 300
31 3300046491 Ga0495584_0001714 Ga0495584_0001714_1837_2757 300
32 3300046491 Ga0495584_0004711 Ga0495584_0004711_922_1842 300
33 3300046491 Ga0495584_0006257 Ga0495584_0006257_4699_5619 300
34 3300046492 Ga0495585_0004313 Ga0495585_0004313_2633_3553 300
35 3300046500 Ga0495596_0005361 Ga0495596_0005361_1655_2575 300
36 3300046501 Ga0495607_0032834 Ga0495607_0032834_997_1917 300
37 3300046523 Ga0495644_0043970 Ga0495644_0043970_146_1066 300
38 3300046525 Ga0495663_0001481 Ga0495663_0001481_5039_5959 300
39 3300046525 Ga0495663_0016992 Ga0495663_0016992_17_937 300
40 3300046530 Ga0495654_0008325 Ga0495654_0008325_2207_3127 300
41 3300046538 Ga0495609_0028373 Ga0495609_0028373_906_1826 300
42 3300046542 Ga0495597_0003129 Ga0495597_0003129_5183_6103 300
43 3300046542 Ga0495597_0032169 Ga0495597_0032169_780_1700 300
44 3300046558 Ga0495633_0004924 Ga0495633_0004924_4067_4987 300
45 3300046616 Ga0495668_0006621 Ga0495668_0006621_2795_3715 300
46 3300046616 Ga0495668_0009109 Ga0495668_0009109_2169_3089 300
47 3300046616 Ga0495668_0037278 Ga0495668_0037278_851_1771 300
48 3300046648 Ga0495611_0016329 Ga0495611_0016329_1487_2407 300
49 3300046664 Ga0495659_0043179 Ga0495659_0043179_534_1472 300
50 3300046665 Ga0495661_0000659 Ga0495661_0000659_12104_13024 300
51 3300046665 Ga0495661_0023573 Ga0495661_0023573_2551_3471 300
52 3300046691 Ga0495670_0004923 Ga0495670_0004923_895_1815 300
53 3300046810 Ga0495660_0031221 Ga0495660_0031221_1943_2863 300
54 3300047315 Ga0495581_0022075 Ga0495581_0022075_1518_2438 300
55 3300047320 Ga0495672_0019863 Ga0495672_0019863_2688_3608 300
56 3300047445 Ga0495677_0004774 Ga0495677_0004774_606_1526 300
57 3300047445 Ga0495677_0017795 Ga0495677_0017795_1157_2077 300
58 3300047470 Ga0495681_0003460 Ga0495681_0003460_6178_7098 300
59 3300047472 Ga0495686_0024388 Ga0495686_0024388_2716_3636 300
60 3300047673 Ga0495593_0077555 Ga0495593_0077555_326_1246 300
61 3300048091 Ga0495626_0004317 Ga0495626_0004317_773_1693 300
62 3300048905 Ga0496102_0010431 Ga0496102_0010431_3387_4307 300
63 3300048906 Ga0496103_0005917 Ga0496103_0005917_4242_5162 300
64 3300049779 Ga0501283_007279 Ga0501283_007279_491_1396 300
65 3300050511 nmdc:mga08y16_142856_c1 nmdc:mga08y16_142856_c1_1438_2343 300
66 3300048917 Ga0496114_0280159 Ga0496114_0280159_45_989 302
67 3300005544 Ga0070686_100086097 Ga0070686_1000860973 303
68 3300009094 Ga0111539_10260037 Ga0111539_102600372 305
69 3300042876 Ga0451577_0049740 Ga0451577_0049740_1981_2937 305
70 3300050511 nmdc:mga08y16_316757_c1 nmdc:mga08y16_316757_c1_631_1587 305
71 3300046460 Ga0495638_0000034 Ga0495638_0000034_95946_96902 306
72 3300046501 Ga0495607_0000010 Ga0495607_0000010_126724_127680 306
73 3300046506 Ga0495583_0001661 Ga0495583_0001661_8703_9659 306
74 3300046524 Ga0495648_0001041 Ga0495648_0001041_10468_11424 306
75 3300046538 Ga0495609_0001136 Ga0495609_0001136_11276_12232 306
76 3300046648 Ga0495611_0000001 Ga0495611_0000001_1232403_1233359 306
77 3300046660 Ga0495625_0000001 Ga0495625_0000001_682680_683636 306
78 3300046691 Ga0495670_0031224 Ga0495670_0031224_1003_1959 306
79 3300046692 Ga0495671_0000951 Ga0495671_0000951_13583_14539 306
80 3300046794 Ga0495589_0000969 Ga0495589_0000969_8643_9599 306
81 3300046810 Ga0495660_0000008 Ga0495660_0000008_47709_48665 306
82 3300047446 Ga0495679_000001 Ga0495679_000001_353598_354554 306
83 3300049460 Ga0495682_0000741 Ga0495682_0000741_11240_12196 306
84 3300053087 Ga0500643_000002 Ga0500643_000002_582341_583297 306
85 3300053103 Ga0500555_000019 Ga0500555_000019_157629_158585 306
86 3300006028 Ga0070717_10055673 Ga0070717_100556733 309
87 3300017792 Ga0163161_10024628 Ga0163161_100246284 309
88 3300046660 Ga0495625_0021485 Ga0495625_0021485_3313_4278 309
89 3300046692 Ga0495671_0000419 Ga0495671_0000419_13149_14114 309
90 iso_pu_bacteria 2773857672 2774129896 310
91 iso_pu_bacteria 3007252601 3007256418 310
92 iso_pu_bacteria 2857553236 2857554610 312
93 iso_pu_bacteria 651053060 651176253 313
94 3300013102 Ga0157371_10009618 Ga0157371_100096183 314
95 3300046453 Ga0495627_000007 Ga0495627_000007_237244_238221 314
96 3300049459 Ga0495678_000004 Ga0495678_000004_224663_225640 314
97 iso_pu_bacteria 2848858292 2848861547 314
98 3300046558 Ga0495633_0006274 Ga0495633_0006274_4242_5252 315
99 3300047469 Ga0495673_0000003 Ga0495673_0000003_1114542_1115537 315
100 3300053161 Ga0500634_0000167 Ga0500634_0000167_14647_15657 315
101 3300039437 Ga0436365_0477510 Ga0436365_0477510_433_1464 316
102 3300046452 Ga0495617_000043 Ga0495617_000043_98988_99962 316
103 3300046453 Ga0495627_000286 Ga0495627_000286_28691_29665 316
104 3300046457 Ga0495590_0000219 Ga0495590_0000219_17843_18835 316
105 3300046471 Ga0495650_0000916 Ga0495650_0000916_23612_24604 316
106 3300046472 Ga0495580_0006758 Ga0495580_0006758_2006_2989 316
107 3300046473 Ga0495582_0005592 Ga0495582_0005592_2277_3269 316
108 3300046474 Ga0495605_0000793 Ga0495605_0000793_21175_22149 316
109 3300046474 Ga0495605_0001275 Ga0495605_0001275_13374_14366 316
110 3300046474 Ga0495605_0046946 Ga0495605_0046946_637_1611 316
111 3300046491 Ga0495584_0000148 Ga0495584_0000148_11949_12932 316
112 3300046491 Ga0495584_0023862 Ga0495584_0023862_1347_2330 316
113 3300046492 Ga0495585_0001119 Ga0495585_0001119_964_1947 316
114 3300046492 Ga0495585_0015124 Ga0495585_0015124_3238_4221 316
115 3300046492 Ga0495585_0022447 Ga0495585_0022447_1319_2311 316
116 3300046492 Ga0495585_0163056 Ga0495585_0163056_122_1096 316
117 3300046500 Ga0495596_0005590 Ga0495596_0005590_1069_2061 316
118 3300046501 Ga0495607_0006945 Ga0495607_0006945_1235_2209 316
119 3300046501 Ga0495607_0037349 Ga0495607_0037349_279_1253 316
120 3300046507 Ga0495606_0027720 Ga0495606_0027720_65_1057 316
121 3300046507 Ga0495606_0035114 Ga0495606_0035114_929_1912 316
122 3300046507 Ga0495606_0069791 Ga0495606_0069791_731_1723 316
123 3300046513 Ga0495616_0021997 Ga0495616_0021997_788_1771 316
124 3300046518 Ga0495631_0018862 Ga0495631_0018862_583_1566 316
125 3300046518 Ga0495631_0028280 Ga0495631_0028280_378_1352 316
126 3300046522 Ga0495643_0001036 Ga0495643_0001036_11378_12379 316
127 3300046526 Ga0495666_0000311 Ga0495666_0000311_12126_13109 316
128 3300046526 Ga0495666_0000355 Ga0495666_0000355_2507_3490 316
129 3300046528 Ga0495642_0000970 Ga0495642_0000970_9683_10657 316
130 3300046531 Ga0495665_0000544 Ga0495665_0000544_6065_7048 316
131 3300046531 Ga0495665_0083155 Ga0495665_0083155_210_1193 316
132 3300046538 Ga0495609_0015502 Ga0495609_0015502_1749_2732 316
133 3300046538 Ga0495609_0028058 Ga0495609_0028058_428_1402 316
134 3300046542 Ga0495597_0000071 Ga0495597_0000071_52975_53967 316
135 3300046557 Ga0495622_0000681 Ga0495622_0000681_11299_12282 316
136 3300046558 Ga0495633_0007638 Ga0495633_0007638_837_1820 316
137 3300046558 Ga0495633_0016787 Ga0495633_0016787_1400_2383 316
138 3300046615 Ga0495656_0004096 Ga0495656_0004096_3639_4613 316
139 3300046616 Ga0495668_0017624 Ga0495668_0017624_463_1437 316
140 3300046616 Ga0495668_0103768 Ga0495668_0103768_496_1479 316
141 3300046665 Ga0495661_0019527 Ga0495661_0019527_2118_3101 316
142 3300046794 Ga0495589_0000077 Ga0495589_0000077_72757_73749 316
143 3300046794 Ga0495589_0008007 Ga0495589_0008007_3227_4201 316
144 3300046810 Ga0495660_0078630 Ga0495660_0078630_274_1248 316
145 3300047315 Ga0495581_0000385 Ga0495581_0000385_9739_10722 316
146 3300047317 Ga0495604_0012538 Ga0495604_0012538_4847_5830 316
147 3300047318 Ga0495636_0000821 Ga0495636_0000821_477_1460 316
148 3300047321 Ga0495676_0082173 Ga0495676_0082173_949_1941 316
149 3300047323 Ga0495683_0000036 Ga0495683_0000036_30230_31213 316
150 3300047443 Ga0495687_000065 Ga0495687_000065_104685_105677 316
151 3300047445 Ga0495677_0005302 Ga0495677_0005302_1148_2122 316
152 3300047470 Ga0495681_0012089 Ga0495681_0012089_1699_2682 316
153 3300047472 Ga0495686_0021691 Ga0495686_0021691_88_1062 316
154 3300048088 Ga0495602_0001810 Ga0495602_0001810_16735_17727 316
155 3300048091 Ga0495626_0001699 Ga0495626_0001699_8844_9836 316
156 3300048091 Ga0495626_0015077 Ga0495626_0015077_2559_3560 316
157 3300048091 Ga0495626_0069038 Ga0495626_0069038_253_1245 316
158 3300048091 Ga0495626_0069240 Ga0495626_0069240_336_1376 316
159 3300048905 Ga0496102_0000362 Ga0496102_0000362_42651_43625 316
160 3300048912 Ga0496109_0474716 Ga0496109_0474716_78_1118 316
161 3300048918 Ga0496115_0175171 Ga0496115_0175171_132_1115 316
162 3300048927 Ga0496124_0005804 Ga0496124_0005804_2159_3268 316
163 3300048927 Ga0496124_0028192 Ga0496124_0028192_2993_3976 316
164 3300049459 Ga0495678_002304 Ga0495678_002304_2232_3206 316
165 iso_pu_bacteria 2808606418 2809143880 316
166 3300005347 Ga0070668_100015822 Ga0070668_1000158223 317
167 3300005364 Ga0070673_100067944 Ga0070673_1000679443 317
168 3300005438 Ga0070701_10184497 Ga0070701_101844971 317
169 3300005457 Ga0070662_100024518 Ga0070662_1000245182 317
170 3300005543 Ga0070672_100058731 Ga0070672_1000587312 317
171 3300005564 Ga0070664_100072078 Ga0070664_1000720783 317
172 3300005564 Ga0070664_100184502 Ga0070664_1001845022 317
173 3300009177 Ga0105248_10183982 Ga0105248_101839822 317
174 3300025908 Ga0207643_10002957 Ga0207643_100029575 317
175 3300025940 Ga0207691_10132609 Ga0207691_101326092 317
176 3300025945 Ga0207679_10153410 Ga0207679_101534102 317
177 3300025945 Ga0207679_10216565 Ga0207679_102165652 317
178 3300028380 Ga0268265_10005288 Ga0268265_100052883 317
179 3300031903 Ga0307407_10149775 Ga0307407_101497752 317
180 3300031995 Ga0307409_100183279 Ga0307409_1001832792 317
181 3300032005 Ga0307411_10230331 Ga0307411_102303311 317
182 3300046472 Ga0495580_0002236 Ga0495580_0002236_536_1513 317
183 3300046472 Ga0495580_0025385 Ga0495580_0025385_2294_3271 317
184 3300046477 Ga0495664_0152402 Ga0495664_0152402_268_1245 317
185 3300046499 Ga0495594_0002053 Ga0495594_0002053_6171_7148 317
186 3300046516 Ga0495628_0003373 Ga0495628_0003373_209_1186 317
187 3300046529 Ga0495652_0058513 Ga0495652_0058513_1727_2704 317
188 3300046531 Ga0495665_0003618 Ga0495665_0003618_6394_7371 317
189 3300046535 Ga0495586_0085119 Ga0495586_0085119_269_1246 317
190 3300046543 Ga0495645_0104630 Ga0495645_0104630_529_1506 317
191 3300046690 Ga0495624_0048221 Ga0495624_0048221_575_1552 317
192 3300047315 Ga0495581_0205079 Ga0495581_0205079_42_1019 317
193 3300047319 Ga0495674_0001581 Ga0495674_0001581_5994_6971 317
194 3300048907 Ga0496104_0153786 Ga0496104_0153786_1126_2088 317
195 3300048912 Ga0496109_0569095 Ga0496109_0569095_56_1018 317
196 3300048928 Ga0496125_0013595 Ga0496125_0013595_1919_2959 317
197 iso_pu_bacteria 2501025502 2501080714 317
198 iso_pu_bacteria 2501025504 2501408999 317
199 iso_pu_bacteria 2510917013 2511086837 317
200 iso_pu_bacteria 2834641062 2834643367 317
201 iso_pu_bacteria 2920107658 2920109401 317
202 iso_pu_bacteria 8003400568 8003402612 317
203 3300046491 Ga0495584_0025741 Ga0495584_0025741_349_1320 318
204 3300046499 Ga0495594_0137881 Ga0495594_0137881_175_1146 318
205 3300046518 Ga0495631_0006738 Ga0495631_0006738_1087_2058 318
206 3300046522 Ga0495643_0004686 Ga0495643_0004686_4947_5918 318
207 3300046522 Ga0495643_0017545 Ga0495643_0017545_1643_2656 318
208 3300046523 Ga0495644_0008115 Ga0495644_0008115_508_1479 318
209 3300046524 Ga0495648_0082687 Ga0495648_0082687_473_1444 318
210 3300046528 Ga0495642_0013496 Ga0495642_0013496_1394_2407 318
211 3300046542 Ga0495597_0012515 Ga0495597_0012515_740_1753 318
212 3300046557 Ga0495622_0025644 Ga0495622_0025644_63_1034 318
213 3300046616 Ga0495668_0026610 Ga0495668_0026610_1937_2908 318
214 3300046616 Ga0495668_0028302 Ga0495668_0028302_924_1937 318
215 3300046648 Ga0495611_0004070 Ga0495611_0004070_3785_4756 318
216 3300046665 Ga0495661_0034118 Ga0495661_0034118_1920_2933 318
217 3300046794 Ga0495589_0030655 Ga0495589_0030655_1102_2073 318
218 3300047320 Ga0495672_0008498 Ga0495672_0008498_2785_3756 318
219 3300047445 Ga0495677_0007964 Ga0495677_0007964_1467_2438 318
220 iso_pu_bacteria 2643221588 2643950047 318
221 iso_pu_bacteria 2738541277 2738720632 318
222 iso_pu_bacteria 2738543019 2739279831 318
223 iso_pu_bacteria 2842324504 2842325810 318
224 iso_pu_bacteria 2842348783 2842350089 318
225 iso_pu_bacteria 2842454564 2842454715 318
226 iso_pu_bacteria 2904483920 2904486808 318
227 iso_pu_bacteria 2919527303 2919528140 318
228 iso_pu_bacteria 8055301274 8055306670 318
229 iso_pu_bacteria 8055817908 8055820985 318
230 3300048912 Ga0496109_0325035 Ga0496109_0325035_312_1325 319
231 3300050507 nmdc:mga05p37_386174_c1 nmdc:mga05p37_386174_c1_208_1206 319
232 3300005334 Ga0068869_100304415 Ga0068869_1003044151 320
233 3300005356 Ga0070674_100031943 Ga0070674_1000319435 320
234 3300005536 Ga0070697_100350891 Ga0070697_1003508911 320
235 3300013104 Ga0157370_10232934 Ga0157370_102329342 320
236 3300014497 Ga0182008_10000219 Ga0182008_1000021912 320
237 3300028379 Ga0268266_10474685 Ga0268266_104746851 320
238 3300048913 Ga0496110_0032114 Ga0496110_0032114_1155_2186 320
239 3300031548 Ga0307408_100007070 Ga0307408_1000070705 321
240 3300032002 Ga0307416_100197111 Ga0307416_1001971112 321
241 iso_pu_bacteria 2501025501 2501072310 321
242 iso_pu_bacteria 2510917014 2511098692 321
243 iso_pu_bacteria 2510917015 2511106282 321
244 3300001989 JGI24739J22299_10045824 JGI24739J22299_100458242 322
245 3300002067 JGI24735J21928_10000870 JGI24735J21928_100008707 322
246 3300002705 JGI25156J39149_1000205 JGI25156J39149_100020512 322
247 3300002705 JGI25156J39149_1000546 JGI25156J39149_100054611 322
248 3300003214 JGI25165J46597_1000441 JGI25165J46597_10004414 322
249 3300003323 rootH1_10371374 rootH1_103713741 322
250 3300003756 Ga0055533_1000094 Ga0055533_100009487 322
251 3300003758 Ga0055532_1000003 Ga0055532_1000003151 322
252 3300003759 Ga0055525_1003438 Ga0055525_10034381 322
253 3300003760 Ga0055527_1000006 Ga0055527_1000006304 322
254 3300003761 Ga0055535_1000003 Ga0055535_1000003151 322
255 3300003762 Ga0055542_1000007 Ga0055542_1000007151 322
256 3300003763 Ga0055529_1000003 Ga0055529_1000003304 322
257 3300009011 Ga0105251_10000175 Ga0105251_1000017549 322
258 3300009551 Ga0105238_10006479 Ga0105238_1000647914 322
259 3300013105 Ga0157369_10308576 Ga0157369_103085762 322
260 3300013296 Ga0157374_10170506 Ga0157374_101705061 322
261 3300013306 Ga0163162_10114036 Ga0163162_101140364 322
262 3300025226 Ga0209674_100025 Ga0209674_100025148 322
263 3300025228 Ga0209672_100002 Ga0209672_1000021050 322
264 3300025229 Ga0209147_100003 Ga0209147_1000031050 322
265 3300025230 Ga0209563_100390 Ga0209563_1003906 322
266 3300025242 Ga0209258_100005 Ga0209258_100005692 322
267 3300025254 Ga0209148_1000006 Ga0209148_10000061050 322
268 3300025256 Ga0209759_1000002 Ga0209759_1000002219 322
269 3300025256 Ga0209759_1000014 Ga0209759_1000014305 322
270 3300025261 Ga0209233_1000018 Ga0209233_1000018303 322
271 3300025272 Ga0209455_1000003 Ga0209455_10000031050 322
272 3300025294 Ga0209025_1010682 Ga0209025_10106824 322
273 3300025295 Ga0209564_1012403 Ga0209564_10124035 322
274 3300025302 Ga0207426_1003902 Ga0207426_10039028 322
275 3300025735 Ga0207713_1014103 Ga0207713_10141034 322
276 3300025904 Ga0207647_10121199 Ga0207647_101211992 322
277 3300025924 Ga0207694_10330660 Ga0207694_103306601 322
278 3300031548 Ga0307408_100112837 Ga0307408_1001128371 322
279 3300046457 Ga0495590_0000420 Ga0495590_0000420_1730_2698 322
280 3300046457 Ga0495590_0003389 Ga0495590_0003389_4509_5480 322
281 3300046472 Ga0495580_0092632 Ga0495580_0092632_370_1341 322
282 3300046477 Ga0495664_0124690 Ga0495664_0124690_488_1459 322
283 3300046506 Ga0495583_0000690 Ga0495583_0000690_35606_36577 322
284 3300046507 Ga0495606_0020518 Ga0495606_0020518_2872_3942 322
285 3300046515 Ga0495620_0042660 Ga0495620_0042660_65_1033 322
286 3300046516 Ga0495628_0020412 Ga0495628_0020412_1586_2557 322
287 3300046524 Ga0495648_0000468 Ga0495648_0000468_35594_36565 322
288 3300046530 Ga0495654_0026768 Ga0495654_0026768_696_1664 322
289 3300046542 Ga0495597_0002487 Ga0495597_0002487_9159_10127 322
290 3300046692 Ga0495671_0044730 Ga0495671_0044730_579_1550 322
291 3300046694 Ga0495649_0009811 Ga0495649_0009811_50_1021 322
292 3300046694 Ga0495649_0042500 Ga0495649_0042500_611_1582 322
293 3300047319 Ga0495674_0059612 Ga0495674_0059612_974_1945 322
294 3300047320 Ga0495672_0074409 Ga0495672_0074409_254_1225 322
295 3300047323 Ga0495683_0000968 Ga0495683_0000968_9529_10500 322
296 3300047323 Ga0495683_0001009 Ga0495683_0001009_11204_12172 322
297 3300047443 Ga0495687_000241 Ga0495687_000241_3902_4870 322
298 3300047443 Ga0495687_054686 Ga0495687_054686_644_1615 322
299 3300047443 Ga0495687_073850 Ga0495687_073850_241_1212 322
300 3300047444 Ga0495675_0082663 Ga0495675_0082663_541_1512 322
301 3300047469 Ga0495673_0001731 Ga0495673_0001731_13237_14208 322
302 3300048903 Ga0496100_0022525 Ga0496100_0022525_2321_3289 322
303 3300048904 Ga0496101_0015728 Ga0496101_0015728_1439_2407 322
304 3300048905 Ga0496102_0035374 Ga0496102_0035374_1879_2847 322
305 3300048906 Ga0496103_0002165 Ga0496103_0002165_11287_12255 322
306 3300048907 Ga0496104_0147743 Ga0496104_0147743_1046_2014 322
307 3300048908 Ga0496105_0196451 Ga0496105_0196451_204_1172 322
308 3300048909 Ga0496106_0011504 Ga0496106_0011504_511_1479 322
309 3300048910 Ga0496107_0017309 Ga0496107_0017309_386_1354 322
310 3300048915 Ga0496112_0035345 Ga0496112_0035345_3670_4638 322
311 3300048916 Ga0496113_0012045 Ga0496113_0012045_2590_3558 322
312 3300048919 Ga0496116_0060355 Ga0496116_0060355_1142_2110 322
313 3300048920 Ga0496117_0015362 Ga0496117_0015362_5237_6205 322
314 3300048921 Ga0496118_0119196 Ga0496118_0119196_511_1479 322
315 3300048924 Ga0496121_0037667 Ga0496121_0037667_2814_3782 322
316 3300048925 Ga0496122_0129584 Ga0496122_0129584_386_1354 322
317 3300048926 Ga0496123_0022214 Ga0496123_0022214_115_1083 322
318 3300048927 Ga0496124_0068690 Ga0496124_0068690_1864_2832 322
319 3300048928 Ga0496125_0006860 Ga0496125_0006860_1351_2319 322
320 3300049460 Ga0495682_0006213 Ga0495682_0006213_678_1649 322
321 3300053125 Ga0500618_003023 Ga0500618_003023_944_1945 322

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

67

368

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2b81-assembly2.cif.gz_C crystal structure of the luciferase-like monooxygenase from bacillus cereus 0.9613 9 320
2b81-assembly2.cif.gz_C crystal structure of the luciferase-like monooxygenase from bacillus cereus 0.9349 9 320
3rao-assembly2.cif.gz_B crystal structure of the luciferase-like monooxygenase from bacillus cereus atcc 10987. 0.8367 23 316
3rao-assembly2.cif.gz_A-2 crystal structure of the luciferase-like monooxygenase from bacillus cereus atcc 10987. 0.8312 23 318
7bip-assembly1.cif.gz_B crystal structure of monooxygenase rslo1 from streptomyces bottropensis 0.8203 25 318
ID Description Score Start End Superfamily
2b81A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9605 9 318 3.20.20.30
2b81A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9422 9 318 3.20.20.30
1rhcA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8201 23 316 3.20.20.30
3fgcC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.807 25 316 3.20.20.30
3raoB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8037 23 319 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A0S4LFC8-F1-model_v4 Luciferase-like domain-containing protein 0.9884 206 321 GO:0016705
AF-A0A173LQG1-F1-model_v4 Alkanal monooxygenase beta chain 0.9786 2 322 GO:0004497
GO:0016705
AF-A0A2W5X289-F1-model_v4 deleted 0.9735 102 322
AF-A0A173LQG1-F1-model_v4 Alkanal monooxygenase beta chain 0.9727 2 322 GO:0004497
GO:0016705
AF-A0A087F8S3-F1-model_v4 Luciferase-like domain-containing protein 0.9711 1 119 GO:0016705

Feature Viewer

pLDDT pTM Quality
91.94 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map