F405206

General Info

Members Datasets Scaffolds Average Seq Length
319 90 638 181

Family's Representative Sequence

Representative Sequence 3300046452|Ga0495617_000656|Ga0495617_000656_14810_15403
Length 197
Sequence MLARRLSPLNILSQEAIRMTQFQLNGAMVAATMALFIAALALNEILFSYLAFAPGISWMYLPAGVRLLCTLLFGEAGALGLLLVSWLVCFTYFFPDDPVRSFAGGIMASAAPYLVYRGAQRFFGLTAALTNLSPQRLLGCAAAFSLASPLLHHLWFAIYEHKANLAHSFVVMAVGDFGGTLVVLYAAKFLLSRLPRR

Samples

Sample ID Description Type Environment
1 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
2 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
3 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
6 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
7 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
8 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
9 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
10 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
11 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
12 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
13 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
14 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
15 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
16 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
17 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
18 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
19 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
20 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
21 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
22 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
23 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
24 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
25 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
26 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
27 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
28 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
29 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
30 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
31 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
32 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
33 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
34 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
35 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
36 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
37 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
38 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
39 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
40 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
41 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
42 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
43 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
44 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
45 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
46 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
47 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
48 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
49 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
50 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
51 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
52 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
53 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
54 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
55 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
56 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
57 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
58 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
59 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
60 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
61 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
62 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
63 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
64 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
65 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
66 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
67 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
68 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
69 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
70 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
71 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
72 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
73 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
74 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
75 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
76 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
77 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
78 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
79 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
80 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
81 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
82 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
83 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
84 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
85 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
86 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
87 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
88 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
89 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
90 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0
Isolates 0.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.57
Nodule 0
Rhizoplane 2.51
Rhizosphere 95.92
Stem 0
Stem Tuber 0
Unclassified 4.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495617_000656 3300046452 Bacteria 17375
2 Ga0055540_1002460 3300003792 Bacteria 9751
3 Ga0055531_10000234 3300003794 Bacteria 60772
4 Ga0065714_10148715 3300005288 Bacteria 1120
5 Ga0209673_1037142 3300025273 Bacteria 1435
6 Ga0209051_1000025 3300025303 Bacteria 415397
7 Ga0209257_1000039 3300025304 Bacteria 591694
8 Ga0466957_0128045 3300044842 Bacteria 1624
9 Ga0466967_0654355 3300045976 Unclassified 1039
10 Ga0495617_000002 3300046452 Bacteria 710121
11 Ga0495617_016462 3300046452 Bacteria 2500
12 Ga0495617_097632 3300046452 Bacteria 956
13 Ga0495627_000174 3300046453 Bacteria 72709
14 Ga0495627_006740 3300046453 Bacteria 4470
15 Ga0495603_0005743 3300046455 Bacteria 7422
16 Ga0495603_0077115 3300046455 Bacteria 1955
17 Ga0495629_0015991 3300046459 Bacteria 5392
18 Ga0495638_0005095 3300046460 Bacteria 9845
19 Ga0495653_0167122 3300046463 Bacteria 1522
20 Ga0495650_0015295 3300046471 Bacteria 3941
21 Ga0495582_0009039 3300046473 Bacteria 5499
22 Ga0495582_0015553 3300046473 Bacteria 4178
23 Ga0495605_0000133 3300046474 Bacteria 97036
24 Ga0495605_0012360 3300046474 Bacteria 4739
25 Ga0495605_0021419 3300046474 Bacteria 3423
26 Ga0495605_0055380 3300046474 Bacteria 1916
27 Ga0495584_0000015 3300046491 Bacteria 169335
28 Ga0495584_0001068 3300046491 Bacteria 16997
29 Ga0495584_0003726 3300046491 Bacteria 8313
30 Ga0495584_0007106 3300046491 Bacteria 5849
31 Ga0495584_0007697 3300046491 Bacteria 5611
32 Ga0495584_0018042 3300046491 Bacteria 3587
33 Ga0495584_0047340 3300046491 Bacteria 2168
34 Ga0495584_0058291 3300046491 Bacteria 1942
35 Ga0495584_0059775 3300046491 Bacteria 1916
36 Ga0495584_0076054 3300046491 Bacteria 1688
37 Ga0495584_0156854 3300046491 Bacteria 1157
38 Ga0495585_0000055 3300046492 Bacteria 113899
39 Ga0495585_0000278 3300046492 Bacteria 51304
40 Ga0495585_0000434 3300046492 Bacteria 39978
41 Ga0495585_0000645 3300046492 Bacteria 32066
42 Ga0495585_0007274 3300046492 Bacteria 6795
43 Ga0495585_0009107 3300046492 Bacteria 5978
44 Ga0495585_0009879 3300046492 Bacteria 5704
45 Ga0495585_0011719 3300046492 Bacteria 5184
46 Ga0495585_0014563 3300046492 Bacteria 4579
47 Ga0495585_0033622 3300046492 Bacteria 2902
48 Ga0495585_0052289 3300046492 Bacteria 2261
49 Ga0495585_0068386 3300046492 Bacteria 1940
50 Ga0495585_0086594 3300046492 Bacteria 1692
51 Ga0495585_0120932 3300046492 Bacteria 1385
52 Ga0495594_0006217 3300046499 Bacteria 6140
53 Ga0495594_0082409 3300046499 Bacteria 1797
54 Ga0495594_0083869 3300046499 Bacteria 1781
55 Ga0495594_0134586 3300046499 Bacteria 1400
56 Ga0495596_0000384 3300046500 Bacteria 28244
57 Ga0495596_0001295 3300046500 Bacteria 14457
58 Ga0495596_0005135 3300046500 Bacteria 6232
59 Ga0495596_0007552 3300046500 Bacteria 4900
60 Ga0495596_0008516 3300046500 Bacteria 4560
61 Ga0495596_0009389 3300046500 Bacteria 4304
62 Ga0495596_0096214 3300046500 Bacteria 1149
63 Ga0495607_0003394 3300046501 Bacteria 12211
64 Ga0495607_0013723 3300046501 Bacteria 5295
65 Ga0495607_0016085 3300046501 Bacteria 4833
66 Ga0495607_0025638 3300046501 Bacteria 3665
67 Ga0495607_0086747 3300046501 Bacteria 1705
68 Ga0495607_0122384 3300046501 Bacteria 1364
69 Ga0495583_0000064 3300046506 Bacteria 192380
70 Ga0495583_0000337 3300046506 Bacteria 73928
71 Ga0495583_0000341 3300046506 Bacteria 73548
72 Ga0495583_0003060 3300046506 Bacteria 13280
73 Ga0495583_0010523 3300046506 Bacteria 5389
74 Ga0495583_0017732 3300046506 Bacteria 3771
75 Ga0495583_0020396 3300046506 Bacteria 3434
76 Ga0495583_0052036 3300046506 Bacteria 1864
77 Ga0495583_0145340 3300046506 Bacteria 985
78 Ga0495606_0006261 3300046507 Bacteria 11045
79 Ga0495606_0010934 3300046507 Bacteria 7466
80 Ga0495606_0013567 3300046507 Bacteria 6427
81 Ga0495606_0031333 3300046507 Bacteria 3699
82 Ga0495606_0111654 3300046507 Unclassified 1648
83 Ga0495616_0000139 3300046513 Bacteria 63327
84 Ga0495616_0002875 3300046513 Bacteria 11238
85 Ga0495616_0005261 3300046513 Bacteria 7986
86 Ga0495616_0007053 3300046513 Bacteria 6753
87 Ga0495616_0012658 3300046513 Bacteria 4780
88 Ga0495616_0019546 3300046513 Bacteria 3695
89 Ga0495616_0044739 3300046513 Bacteria 2244
90 Ga0495616_0152101 3300046513 Bacteria 1046
91 Ga0495620_0001276 3300046515 Bacteria 15358
92 Ga0495630_0039768 3300046517 Bacteria 3516
93 Ga0495631_0024354 3300046518 Bacteria 2794
94 Ga0495631_0029694 3300046518 Bacteria 2484
95 Ga0495631_0031587 3300046518 Bacteria 2393
96 Ga0495631_0040136 3300046518 Bacteria 2074
97 Ga0495631_0049681 3300046518 Bacteria 1835
98 Ga0495631_0054127 3300046518 Bacteria 1750
99 Ga0495632_0004588 3300046519 Bacteria 9359
100 Ga0495632_0017154 3300046519 Bacteria 4005
101 Ga0495637_0011441 3300046520 Bacteria 4265
102 Ga0495643_0001107 3300046522 Bacteria 26830
103 Ga0495643_0002104 3300046522 Bacteria 16470
104 Ga0495643_0011579 3300046522 Bacteria 5363
105 Ga0495643_0052594 3300046522 Unclassified 2186
106 Ga0495643_0066217 3300046522 Bacteria 1906
107 Ga0495643_0092882 3300046522 Bacteria 1554
108 Ga0495644_0008726 3300046523 Bacteria 3900
109 Ga0495644_0017342 3300046523 Bacteria 2753
110 Ga0495644_0032197 3300046523 Bacteria 1981
111 Ga0495644_0048631 3300046523 Bacteria 1593
112 Ga0495648_0000136 3300046524 Bacteria 87034
113 Ga0495648_0000646 3300046524 Bacteria 37146
114 Ga0495648_0025539 3300046524 Bacteria 3997
115 Ga0495648_0086229 3300046524 Bacteria 1771
116 Ga0495648_0320434 3300046524 Bacteria 719
117 Ga0495663_0001532 3300046525 Bacteria 7265
118 Ga0495663_0006683 3300046525 Bacteria 3183
119 Ga0495663_0025016 3300046525 Bacteria 1739
120 Ga0495666_0000520 3300046526 Bacteria 17135
121 Ga0495666_0002678 3300046526 Bacteria 8882
122 Ga0495666_0055803 3300046526 Bacteria 1892
123 Ga0495666_0085109 3300046526 Bacteria 1493
124 Ga0495666_0093028 3300046526 Bacteria 1422
125 Ga0495666_0377373 3300046526 Bacteria 638
126 Ga0495642_0000166 3300046528 Bacteria 38365
127 Ga0495642_0006472 3300046528 Bacteria 4493
128 Ga0495642_0008844 3300046528 Bacteria 3851
129 Ga0495642_0012776 3300046528 Bacteria 3241
130 Ga0495642_0014683 3300046528 Bacteria 3037
131 Ga0495642_0016005 3300046528 Bacteria 2920
132 Ga0495642_0074811 3300046528 Bacteria 1420
133 Ga0495642_0075905 3300046528 Bacteria 1410
134 Ga0495642_0161828 3300046528 Bacteria 970
135 Ga0495642_0217793 3300046528 Unclassified 833
136 Ga0495652_0109029 3300046529 Bacteria 2230
137 Ga0495654_0005753 3300046530 Bacteria 7140
138 Ga0495654_0086713 3300046530 Unclassified 1458
139 Ga0495665_0034937 3300046531 Bacteria 2687
140 Ga0495665_0054449 3300046531 Bacteria 2114
141 Ga0495665_0236330 3300046531 Bacteria 943
142 Ga0495586_0033588 3300046535 Bacteria 2753
143 Ga0495587_0033765 3300046536 Bacteria 3086
144 Ga0495587_0040395 3300046536 Bacteria 2789
145 Ga0495609_0008185 3300046538 Bacteria 5134
146 Ga0495609_0008862 3300046538 Bacteria 4895
147 Ga0495609_0029606 3300046538 Unclassified 2493
148 Ga0495609_0030201 3300046538 Bacteria 2466
149 Ga0495609_0330641 3300046538 Bacteria 617
150 Ga0495597_0000094 3300046542 Bacteria 78516
151 Ga0495597_0002943 3300046542 Bacteria 10335
152 Ga0495597_0003438 3300046542 Bacteria 9244
153 Ga0495597_0076327 3300046542 Bacteria 1437
154 Ga0495597_0111149 3300046542 Bacteria 1149
155 Ga0495597_0140091 3300046542 Bacteria 998
156 Ga0495645_0354144 3300046543 Unclassified 945
157 Ga0495622_0011051 3300046557 Bacteria 4167
158 Ga0495622_0063369 3300046557 Bacteria 1710
159 Ga0495633_0002861 3300046558 Bacteria 11842
160 Ga0495633_0007632 3300046558 Bacteria 6191
161 Ga0495633_0017560 3300046558 Bacteria 3655
162 Ga0495633_0017880 3300046558 Bacteria 3610
163 Ga0495633_0023720 3300046558 Bacteria 3037
164 Ga0495633_0120583 3300046558 Bacteria 1215
165 Ga0495633_0161379 3300046558 Bacteria 1034
166 Ga0495656_0002708 3300046615 Bacteria 5917
167 Ga0495656_0005687 3300046615 Bacteria 4318
168 Ga0495656_0011358 3300046615 Bacteria 3268
169 Ga0495656_0014985 3300046615 Bacteria 2917
170 Ga0495656_0183375 3300046615 Bacteria 1030
171 Ga0495656_0211699 3300046615 Bacteria 966
172 Ga0495668_0000835 3300046616 Bacteria 34975
173 Ga0495668_0004943 3300046616 Bacteria 9236
174 Ga0495668_0014053 3300046616 Bacteria 4704
175 Ga0495668_0045889 3300046616 Bacteria 2428
176 Ga0495668_0072097 3300046616 Bacteria 1898
177 Ga0495668_0086196 3300046616 Bacteria 1722
178 Ga0495668_0091131 3300046616 Bacteria 1670
179 Ga0495668_0105458 3300046616 Bacteria 1541
180 Ga0495668_0210146 3300046616 Bacteria 1065
181 Ga0495611_0006221 3300046648 Bacteria 5095
182 Ga0495611_0008602 3300046648 Bacteria 4317
183 Ga0495611_0009547 3300046648 Bacteria 4098
184 Ga0495611_0015863 3300046648 Bacteria 3219
185 Ga0495611_0063334 3300046648 Bacteria 1683
186 Ga0495611_0083811 3300046648 Bacteria 1469
187 Ga0495611_0107184 3300046648 Bacteria 1299
188 Ga0495625_0128820 3300046660 Bacteria 1715
189 Ga0495635_0304472 3300046663 Bacteria 1068
190 Ga0495635_0404608 3300046663 Bacteria 906
191 Ga0495661_0002129 3300046665 Bacteria 15518
192 Ga0495661_0011723 3300046665 Bacteria 5938
193 Ga0495661_0012225 3300046665 Bacteria 5798
194 Ga0495661_0020700 3300046665 Bacteria 4291
195 Ga0495661_0024979 3300046665 Bacteria 3866
196 Ga0495661_0026833 3300046665 Bacteria 3704
197 Ga0495661_0034058 3300046665 Bacteria 3208
198 Ga0495661_0042909 3300046665 Plasmid 2785
199 Ga0495661_0182876 3300046665 Unclassified 1109
200 Ga0495661_0281477 3300046665 Bacteria 838
201 Ga0495661_0338321 3300046665 Bacteria 744
202 Ga0495661_0407081 3300046665 Bacteria 660
203 Ga0495588_0002053 3300046674 Bacteria 8610
204 Ga0495588_0003927 3300046674 Bacteria 6521
205 Ga0495588_0009589 3300046674 Bacteria 4479
206 Ga0495588_0022905 3300046674 Bacteria 3088
207 Ga0495588_0035555 3300046674 Bacteria 2525
208 Ga0495588_0203968 3300046674 Bacteria 1044
209 Ga0495623_0010495 3300046679 Bacteria 5995
210 Ga0495669_0000077 3300046684 Bacteria 65061
211 Ga0495669_0012046 3300046684 Bacteria 3676
212 Ga0495669_0013438 3300046684 Bacteria 3488
213 Ga0495669_0048626 3300046684 Bacteria 1897
214 Ga0495669_0054714 3300046684 Bacteria 1797
215 Ga0495669_0244307 3300046684 Bacteria 862
216 Ga0495613_0036159 3300046689 Bacteria 3662
217 Ga0495613_0104043 3300046689 Bacteria 2050
218 Ga0495624_0253820 3300046690 Bacteria 1063
219 Ga0495670_0001573 3300046691 Bacteria 11157
220 Ga0495670_0006323 3300046691 Bacteria 5817
221 Ga0495670_0026415 3300046691 Bacteria 2874
222 Ga0495670_0030311 3300046691 Bacteria 2687
223 Ga0495670_0065014 3300046691 Bacteria 1838
224 Ga0495670_0082690 3300046691 Bacteria 1637
225 Ga0495670_0102278 3300046691 Bacteria 1476
226 Ga0495670_0102389 3300046691 Bacteria 1475
227 Ga0495670_0224692 3300046691 Bacteria 998
228 Ga0495670_0374657 3300046691 Unclassified 768
229 Ga0495670_0637459 3300046691 Bacteria 581
230 Ga0495671_0000192 3300046692 Bacteria 53483
231 Ga0495649_0013400 3300046694 Plasmid 4729
232 Ga0495649_0014435 3300046694 Bacteria 4528
233 Ga0495649_0017411 3300046694 Bacteria 4053
234 Ga0495649_0086030 3300046694 Unclassified 1678
235 Ga0495649_0101378 3300046694 Bacteria 1530
236 Ga0495649_0104142 3300046694 Bacteria 1507
237 Ga0495589_0003440 3300046794 Bacteria 8568
238 Ga0495589_0013430 3300046794 Bacteria 4226
239 Ga0495589_0060622 3300046794 Bacteria 1858
240 Ga0495600_0142343 3300046809 Bacteria 1555
241 Ga0495660_0000735 3300046810 Bacteria 24883
242 Ga0495660_0011659 3300046810 Bacteria 5098
243 Ga0495660_0038464 3300046810 Bacteria 2660
244 Ga0495660_0056292 3300046810 Unclassified 2125
245 Ga0495660_0458698 3300046810 Unclassified 550
246 Ga0495581_0057657 3300047315 Bacteria 2241
247 Ga0495581_0063001 3300047315 Bacteria 2142
248 Ga0495581_0118951 3300047315 Bacteria 1537
249 Ga0495604_0063227 3300047317 Bacteria 2824
250 Ga0495604_0066965 3300047317 Bacteria 2730
251 Ga0495604_0127319 3300047317 Bacteria 1834
252 Ga0495604_0316916 3300047317 Bacteria 1043
253 Ga0495636_0092899 3300047318 Bacteria 1311
254 Ga0495636_0453405 3300047318 Bacteria 616
255 Ga0495674_0105458 3300047319 Bacteria 2395
256 Ga0495672_0011378 3300047320 Bacteria 6286
257 Ga0495672_0047290 3300047320 Bacteria 2559
258 Ga0495676_0000093 3300047321 Bacteria 66312
259 Ga0495676_0011634 3300047321 Bacteria 7940
260 Ga0495676_0081127 3300047321 Bacteria 2460
261 Ga0495680_0033654 3300047322 Bacteria 4147
262 Ga0495683_0000145 3300047323 Bacteria 69835
263 Ga0495683_0023697 3300047323 Bacteria 3154
264 Ga0495683_0029044 3300047323 Bacteria 2826
265 Ga0495683_0040108 3300047323 Bacteria 2366
266 Ga0495683_0172981 3300047323 Bacteria 991
267 Ga0495687_053139 3300047443 Bacteria 1708
268 Ga0495675_0146150 3300047444 Bacteria 1463
269 Ga0495675_0186598 3300047444 Bacteria 1267
270 Ga0495677_0000897 3300047445 Bacteria 11998
271 Ga0495677_0001439 3300047445 Bacteria 9555
272 Ga0495677_0009526 3300047445 Bacteria 3586
273 Ga0495677_0009694 3300047445 Bacteria 3550
274 Ga0495677_0010657 3300047445 Bacteria 3368
275 Ga0495677_0017744 3300047445 Bacteria 2579
276 Ga0495677_0022261 3300047445 Bacteria 2299
277 Ga0495677_0040027 3300047445 Bacteria 1714
278 Ga0495677_0340497 3300047445 Bacteria 591
279 Ga0495685_010404 3300047447 Bacteria 3119
280 Ga0495685_014006 3300047447 Bacteria 2722
281 Ga0495685_219840 3300047447 Bacteria 606
282 Ga0495673_0000037 3300047469 Bacteria 307717
283 Ga0495673_0091642 3300047469 Bacteria 1241
284 Ga0495681_0000073 3300047470 Bacteria 92561
285 Ga0495681_0011120 3300047470 Bacteria 5394
286 Ga0495681_0013458 3300047470 Bacteria 4743
287 Ga0495681_0035662 3300047470 Bacteria 2468
288 Ga0495681_0065702 3300047470 Bacteria 1657
289 Ga0495681_0107581 3300047470 Bacteria 1211
290 Ga0495681_0257890 3300047470 Bacteria 686
291 Ga0495686_0000926 3300047472 Bacteria 36586
292 Ga0495686_0048920 3300047472 Plasmid 2663
293 Ga0495686_0290538 3300047472 Bacteria 905
294 Ga0495593_0029396 3300047673 Bacteria 3013
295 Ga0495593_0097431 3300047673 Bacteria 1510
296 Ga0495602_0021506 3300048088 Bacteria 6347
297 Ga0495614_0008378 3300048089 Bacteria 4598
298 Ga0495626_0001245 3300048091 Bacteria 20900
299 Ga0495626_0007353 3300048091 Bacteria 6137
300 Ga0495626_0009015 3300048091 Bacteria 5409
301 Ga0495626_0009258 3300048091 Bacteria 5329
302 Ga0495626_0025280 3300048091 Bacteria 2906
303 Ga0495626_0035175 3300048091 Bacteria 2391
304 Ga0495626_0042268 3300048091 Bacteria 2141
305 Ga0495626_0043208 3300048091 Bacteria 2115
306 Ga0495626_0063743 3300048091 Bacteria 1671
307 Ga0495626_0107416 3300048091 Bacteria 1211
308 Ga0495626_0140661 3300048091 Bacteria 1024
309 Ga0496102_0041369 3300048905 Bacteria 4172
310 Ga0496102_0304301 3300048905 Bacteria 1502
311 Ga0496102_0663418 3300048905 Bacteria 966
312 Ga0496103_0059060 3300048906 Bacteria 2383
313 Ga0496104_0851927 3300048907 Unclassified 817
314 Ga0496109_0284328 3300048912 Unclassified 1559
315 Ga0496115_0172874 3300048918 Bacteria 1786
316 Ga0496115_0364802 3300048918 Bacteria 1176
317 Ga0495682_0000718 3300049460 Bacteria 21602
318 Ga0501238_003739 3300049671 Bacteria 1880
319 2881104476 2881101125 Bacteria 4590519
320 Ga0495617_000656
321 Ga0055540_1002460
322 Ga0055531_10000234
323 Ga0065714_10148715
324 Ga0209673_1037142
325 Ga0209051_1000025
326 Ga0209257_1000039
327 Ga0466957_0128045
328 Ga0466967_0654355
329 Ga0495617_000002
330 Ga0495617_016462
331 Ga0495617_097632
332 Ga0495627_000174
333 Ga0495627_006740
334 Ga0495603_0005743
335 Ga0495603_0077115
336 Ga0495629_0015991
337 Ga0495638_0005095
338 Ga0495653_0167122
339 Ga0495650_0015295
340 Ga0495582_0009039
341 Ga0495582_0015553
342 Ga0495605_0000133
343 Ga0495605_0012360
344 Ga0495605_0021419
345 Ga0495605_0055380
346 Ga0495584_0000015
347 Ga0495584_0001068
348 Ga0495584_0003726
349 Ga0495584_0007106
350 Ga0495584_0007697
351 Ga0495584_0018042
352 Ga0495584_0047340
353 Ga0495584_0058291
354 Ga0495584_0059775
355 Ga0495584_0076054
356 Ga0495584_0156854
357 Ga0495585_0000055
358 Ga0495585_0000278
359 Ga0495585_0000434
360 Ga0495585_0000645
361 Ga0495585_0007274
362 Ga0495585_0009107
363 Ga0495585_0009879
364 Ga0495585_0011719
365 Ga0495585_0014563
366 Ga0495585_0033622
367 Ga0495585_0052289
368 Ga0495585_0068386
369 Ga0495585_0086594
370 Ga0495585_0120932
371 Ga0495594_0006217
372 Ga0495594_0082409
373 Ga0495594_0083869
374 Ga0495594_0134586
375 Ga0495596_0000384
376 Ga0495596_0001295
377 Ga0495596_0005135
378 Ga0495596_0007552
379 Ga0495596_0008516
380 Ga0495596_0009389
381 Ga0495596_0096214
382 Ga0495607_0003394
383 Ga0495607_0013723
384 Ga0495607_0016085
385 Ga0495607_0025638
386 Ga0495607_0086747
387 Ga0495607_0122384
388 Ga0495583_0000064
389 Ga0495583_0000337
390 Ga0495583_0000341
391 Ga0495583_0003060
392 Ga0495583_0010523
393 Ga0495583_0017732
394 Ga0495583_0020396
395 Ga0495583_0052036
396 Ga0495583_0145340
397 Ga0495606_0006261
398 Ga0495606_0010934
399 Ga0495606_0013567
400 Ga0495606_0031333
401 Ga0495606_0111654
402 Ga0495616_0000139
403 Ga0495616_0002875
404 Ga0495616_0005261
405 Ga0495616_0007053
406 Ga0495616_0012658
407 Ga0495616_0019546
408 Ga0495616_0044739
409 Ga0495616_0152101
410 Ga0495620_0001276
411 Ga0495630_0039768
412 Ga0495631_0024354
413 Ga0495631_0029694
414 Ga0495631_0031587
415 Ga0495631_0040136
416 Ga0495631_0049681
417 Ga0495631_0054127
418 Ga0495632_0004588
419 Ga0495632_0017154
420 Ga0495637_0011441
421 Ga0495643_0001107
422 Ga0495643_0002104
423 Ga0495643_0011579
424 Ga0495643_0052594
425 Ga0495643_0066217
426 Ga0495643_0092882
427 Ga0495644_0008726
428 Ga0495644_0017342
429 Ga0495644_0032197
430 Ga0495644_0048631
431 Ga0495648_0000136
432 Ga0495648_0000646
433 Ga0495648_0025539
434 Ga0495648_0086229
435 Ga0495648_0320434
436 Ga0495663_0001532
437 Ga0495663_0006683
438 Ga0495663_0025016
439 Ga0495666_0000520
440 Ga0495666_0002678
441 Ga0495666_0055803
442 Ga0495666_0085109
443 Ga0495666_0093028
444 Ga0495666_0377373
445 Ga0495642_0000166
446 Ga0495642_0006472
447 Ga0495642_0008844
448 Ga0495642_0012776
449 Ga0495642_0014683
450 Ga0495642_0016005
451 Ga0495642_0074811
452 Ga0495642_0075905
453 Ga0495642_0161828
454 Ga0495642_0217793
455 Ga0495652_0109029
456 Ga0495654_0005753
457 Ga0495654_0086713
458 Ga0495665_0034937
459 Ga0495665_0054449
460 Ga0495665_0236330
461 Ga0495586_0033588
462 Ga0495587_0033765
463 Ga0495587_0040395
464 Ga0495609_0008185
465 Ga0495609_0008862
466 Ga0495609_0029606
467 Ga0495609_0030201
468 Ga0495609_0330641
469 Ga0495597_0000094
470 Ga0495597_0002943
471 Ga0495597_0003438
472 Ga0495597_0076327
473 Ga0495597_0111149
474 Ga0495597_0140091
475 Ga0495645_0354144
476 Ga0495622_0011051
477 Ga0495622_0063369
478 Ga0495633_0002861
479 Ga0495633_0007632
480 Ga0495633_0017560
481 Ga0495633_0017880
482 Ga0495633_0023720
483 Ga0495633_0120583
484 Ga0495633_0161379
485 Ga0495656_0002708
486 Ga0495656_0005687
487 Ga0495656_0011358
488 Ga0495656_0014985
489 Ga0495656_0183375
490 Ga0495656_0211699
491 Ga0495668_0000835
492 Ga0495668_0004943
493 Ga0495668_0014053
494 Ga0495668_0045889
495 Ga0495668_0072097
496 Ga0495668_0086196
497 Ga0495668_0091131
498 Ga0495668_0105458
499 Ga0495668_0210146
500 Ga0495611_0006221
501 Ga0495611_0008602
502 Ga0495611_0009547
503 Ga0495611_0015863
504 Ga0495611_0063334
505 Ga0495611_0083811
506 Ga0495611_0107184
507 Ga0495625_0128820
508 Ga0495635_0304472
509 Ga0495635_0404608
510 Ga0495661_0002129
511 Ga0495661_0011723
512 Ga0495661_0012225
513 Ga0495661_0020700
514 Ga0495661_0024979
515 Ga0495661_0026833
516 Ga0495661_0034058
517 Ga0495661_0042909
518 Ga0495661_0182876
519 Ga0495661_0281477
520 Ga0495661_0338321
521 Ga0495661_0407081
522 Ga0495588_0002053
523 Ga0495588_0003927
524 Ga0495588_0009589
525 Ga0495588_0022905
526 Ga0495588_0035555
527 Ga0495588_0203968
528 Ga0495623_0010495
529 Ga0495669_0000077
530 Ga0495669_0012046
531 Ga0495669_0013438
532 Ga0495669_0048626
533 Ga0495669_0054714
534 Ga0495669_0244307
535 Ga0495613_0036159
536 Ga0495613_0104043
537 Ga0495624_0253820
538 Ga0495670_0001573
539 Ga0495670_0006323
540 Ga0495670_0026415
541 Ga0495670_0030311
542 Ga0495670_0065014
543 Ga0495670_0082690
544 Ga0495670_0102278
545 Ga0495670_0102389
546 Ga0495670_0224692
547 Ga0495670_0374657
548 Ga0495670_0637459
549 Ga0495671_0000192
550 Ga0495649_0013400
551 Ga0495649_0014435
552 Ga0495649_0017411
553 Ga0495649_0086030
554 Ga0495649_0101378
555 Ga0495649_0104142
556 Ga0495589_0003440
557 Ga0495589_0013430
558 Ga0495589_0060622
559 Ga0495600_0142343
560 Ga0495660_0000735
561 Ga0495660_0011659
562 Ga0495660_0038464
563 Ga0495660_0056292
564 Ga0495660_0458698
565 Ga0495581_0057657
566 Ga0495581_0063001
567 Ga0495581_0118951
568 Ga0495604_0063227
569 Ga0495604_0066965
570 Ga0495604_0127319
571 Ga0495604_0316916
572 Ga0495636_0092899
573 Ga0495636_0453405
574 Ga0495674_0105458
575 Ga0495672_0011378
576 Ga0495672_0047290
577 Ga0495676_0000093
578 Ga0495676_0011634
579 Ga0495676_0081127
580 Ga0495680_0033654
581 Ga0495683_0000145
582 Ga0495683_0023697
583 Ga0495683_0029044
584 Ga0495683_0040108
585 Ga0495683_0172981
586 Ga0495687_053139
587 Ga0495675_0146150
588 Ga0495675_0186598
589 Ga0495677_0000897
590 Ga0495677_0001439
591 Ga0495677_0009526
592 Ga0495677_0009694
593 Ga0495677_0010657
594 Ga0495677_0017744
595 Ga0495677_0022261
596 Ga0495677_0040027
597 Ga0495677_0340497
598 Ga0495685_010404
599 Ga0495685_014006
600 Ga0495685_219840
601 Ga0495673_0000037
602 Ga0495673_0091642
603 Ga0495681_0000073
604 Ga0495681_0011120
605 Ga0495681_0013458
606 Ga0495681_0035662
607 Ga0495681_0065702
608 Ga0495681_0107581
609 Ga0495681_0257890
610 Ga0495686_0000926
611 Ga0495686_0048920
612 Ga0495686_0290538
613 Ga0495593_0029396
614 Ga0495593_0097431
615 Ga0495602_0021506
616 Ga0495614_0008378
617 Ga0495626_0001245
618 Ga0495626_0007353
619 Ga0495626_0009015
620 Ga0495626_0009258
621 Ga0495626_0025280
622 Ga0495626_0035175
623 Ga0495626_0042268
624 Ga0495626_0043208
625 Ga0495626_0063743
626 Ga0495626_0107416
627 Ga0495626_0140661
628 Ga0496102_0041369
629 Ga0496102_0304301
630 Ga0496102_0663418
631 Ga0496103_0059060
632 Ga0496104_0851927
633 Ga0496109_0284328
634 Ga0496115_0172874
635 Ga0496115_0364802
636 Ga0495682_0000718
637 Ga0501238_003739
638 2881104476

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hzu-assembly1.cif.gz_S structure of a bacterial energy-coupling factor transporter 0.6365 3 171
4hzu-assembly1.cif.gz_S structure of a bacterial energy-coupling factor transporter 0.6042 3 171
7tut-assembly1.cif.gz_6 structure of the rabbit 80s ribosome stalled on a 4-tmd rhodopsin intermediate in complex with the multipass translocon 0.4234 2 162
4fbs-assembly1.cif.gz_A structure of monomeric nt from euprosthenops australis major ampullate spidroin 1 (masp1) 0.4167 43 158
4rfs-assembly1.cif.gz_S structure of a pantothenate energy coupling factor transporter 0.4025 6 169
ID Description Score Start End Superfamily
4hzuS00 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.6365 3 171 1.10.1760.20
4hzuS00 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.6042 3 171 1.10.1760.20
af_Q2FUT1_1_180_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.4923 4 174 1.10.1760.20
af_Q2FUT1_1_180_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.4855 4 174 1.10.1760.20
af_P95210_10_113_1.10.287.1260 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.4846 51 158 1.10.287.1260
ID Description Score Start End GO Terms
AF-A0A6N8INH4-F1-model_v4 Uncharacterized protein 0.9611 2 169 GO:0016020
AF-A0A225SS85-F1-model_v4 MASE1 domain-containing protein 0.9521 2 169 GO:0016020
AF-A0A7X6I5K2-F1-model_v4 MASE1 domain-containing protein 0.9449 2 169 GO:0016020
AF-A0A1G6WWM8-F1-model_v4 deleted 0.9438 2 164
AF-A0A6B1J545-F1-model_v4 deleted 0.9434 1 172

Map