F405121

General Info

Members Datasets Scaffolds Average Seq Length
319 169 638 154

Family's Representative Sequence

Representative Sequence 3300025941|Ga0207711_11186660|Ga0207711_111866601
Length 199
Sequence MATSSARRRGGRSPRSRAIHSVTKGDGGSRGGVSDILVILTQALLTAVGIGIAGLVAAAVFGLAGTDVSRHISFGFFSALFLLLAHSMMMFYLIGKGKAVKDALKEGGYGETDPNYRTFVGRISKARRPVFSIGTLAMVVIMGAAILGGGVDTGALPPIVHAWLAYGGIVCNLAALKIEIDALSESGRVVQEVNRLLGA

Samples

Sample ID Description Type Environment
1 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
118 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
119 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
120 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
121 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
122 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
123 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
124 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
125 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
126 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
127 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
128 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
129 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
130 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
131 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
132 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
133 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
134 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
135 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
136 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
137 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
141 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
142 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
143 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
144 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
145 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
146 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
147 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
148 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
149 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
150 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
151 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
152 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
153 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
161 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
162 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
163 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
164 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
167 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
168 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
169 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.45
Rhizosphere 96.55
Stem 0
Stem Tuber 0
Unclassified 26.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207711_11186660 3300025941 Bacteria 705
2 Ga0065715_10202579 3300005293 Unclassified 1354
3 Ga0065715_10563216 3300005293 Unclassified 732
4 Ga0070676_10002047 3300005328 Bacteria 10252
5 Ga0070676_10101492 3300005328 Unclassified 1778
6 Ga0070676_10622155 3300005328 Unclassified 781
7 Ga0070690_100127077 3300005330 Bacteria 1718
8 Ga0070670_100417373 3300005331 Unclassified 1186
9 Ga0068869_101011252 3300005334 Unclassified 724
10 Ga0070666_10045753 3300005335 Bacteria 2933
11 Ga0070666_10146911 3300005335 Unclassified 1644
12 Ga0070666_10203741 3300005335 Bacteria 1392
13 Ga0070680_100442968 3300005336 Bacteria 1109
14 Ga0068868_100288975 3300005338 Archaea 1390
15 Ga0070691_10089324 3300005341 Bacteria 1517
16 Ga0070687_100003131 3300005343 Bacteria 6376
17 Ga0070692_10222294 3300005345 Bacteria 1117
18 Ga0070668_100034086 3300005347 Bacteria 3880
19 Ga0070668_100254475 3300005347 Bacteria 1459
20 Ga0070669_100011466 3300005353 Bacteria 6294
21 Ga0070669_100524811 3300005353 Unclassified 985
22 Ga0070669_101025712 3300005353 Bacteria 708
23 Ga0070675_100000942 3300005354 Bacteria 20711
24 Ga0070675_100027281 3300005354 Bacteria 4587
25 Ga0070671_100100843 3300005355 Bacteria 2422
26 Ga0070671_101071937 3300005355 Unclassified 707
27 Ga0070674_100022061 3300005356 Bacteria 4101
28 Ga0070674_100135375 3300005356 Unclassified 1842
29 Ga0070674_100176944 3300005356 Bacteria 1631
30 Ga0070673_100005350 3300005364 Bacteria 8202
31 Ga0070673_100644943 3300005364 Unclassified 969
32 Ga0070688_100099048 3300005365 Bacteria 1919
33 Ga0070659_100393483 3300005366 Unclassified 1169
34 Ga0070709_10287394 3300005434 Bacteria 1197
35 Ga0070701_10014746 3300005438 Bacteria 3590
36 Ga0070701_10184143 3300005438 Bacteria 1225
37 Ga0070705_100027409 3300005440 Bacteria 3110
38 Ga0070700_100006048 3300005441 Bacteria 6443
39 Ga0070700_100102912 3300005441 Bacteria 1885
40 Ga0070694_100070441 3300005444 Bacteria 2408
41 Ga0070708_100083772 3300005445 Bacteria 2892
42 Ga0070662_100163077 3300005457 Bacteria 1745
43 Ga0070662_100342195 3300005457 Bacteria 1224
44 Ga0068867_100043646 3300005459 Unclassified 3283
45 Ga0068867_100050163 3300005459 Bacteria 3074
46 Ga0068867_100105591 3300005459 Bacteria 2157
47 Ga0070685_10407501 3300005466 Bacteria 943
48 Ga0070706_100249770 3300005467 Unclassified 1656
49 Ga0070707_100437878 3300005468 Unclassified 1268
50 Ga0070707_100496570 3300005468 Bacteria 1182
51 Ga0070698_100042016 3300005471 Bacteria 4690
52 Ga0070698_100205254 3300005471 Bacteria 1906
53 Ga0070698_100323064 3300005471 Bacteria 1474
54 Ga0070698_100467642 3300005471 Bacteria 1197
55 Ga0070698_100632973 3300005471 Bacteria 1011
56 Ga0070699_100141157 3300005518 Unclassified 2127
57 Ga0070697_100207491 3300005536 Bacteria 1667
58 Ga0070697_100247406 3300005536 Unclassified 1524
59 Ga0070697_100541183 3300005536 Bacteria 1021
60 Ga0068853_100513548 3300005539 Unclassified 1132
61 Ga0070672_101805843 3300005543 Bacteria 550
62 Ga0070686_100001028 3300005544 Bacteria 16042
63 Ga0070686_100333407 3300005544 Unclassified 1135
64 Ga0070686_100407877 3300005544 Bacteria 1035
65 Ga0070686_100457141 3300005544 Bacteria 983
66 Ga0070686_100711623 3300005544 Unclassified 802
67 Ga0070686_101012558 3300005544 Unclassified 682
68 Ga0070686_101145670 3300005544 Unclassified 644
69 Ga0070695_100027730 3300005545 Bacteria 3510
70 Ga0070695_100132220 3300005545 Bacteria 1721
71 Ga0070696_100009261 3300005546 Bacteria 6594
72 Ga0070696_100599646 3300005546 Bacteria 888
73 Ga0070693_100162469 3300005547 Unclassified 1423
74 Ga0070704_100008489 3300005549 Bacteria 6162
75 Ga0070704_100050575 3300005549 Bacteria 2922
76 Ga0070664_100357389 3300005564 Bacteria 1330
77 Ga0068854_100014195 3300005578 Bacteria 5244
78 Ga0068854_100022358 3300005578 Bacteria 4306
79 Ga0068854_100102356 3300005578 Bacteria 2149
80 Ga0068854_100332045 3300005578 Bacteria 1239
81 Ga0068854_100361054 3300005578 Unclassified 1192
82 Ga0068854_101180253 3300005578 Bacteria 685
83 Ga0068854_101274987 3300005578 Bacteria 661
84 Ga0070702_100054234 3300005615 Bacteria 2305
85 Ga0068852_100837941 3300005616 Unclassified 935
86 Ga0068859_101018403 3300005617 Bacteria 910
87 Ga0068859_101045267 3300005617 Bacteria 898
88 Ga0068859_101486675 3300005617 Unclassified 747
89 Ga0068864_100186622 3300005618 Unclassified 1898
90 Ga0068864_100395905 3300005618 Bacteria 1312
91 Ga0068866_10001947 3300005718 Bacteria 8603
92 Ga0068866_10200113 3300005718 Unclassified 1193
93 Ga0068861_100000304 3300005719 Bacteria 27558
94 Ga0068861_100144540 3300005719 Unclassified 1945
95 Ga0068861_100167180 3300005719 Unclassified 1820
96 Ga0068861_100188710 3300005719 Bacteria 1721
97 Ga0068861_100593283 3300005719 Bacteria 1016
98 Ga0068861_101255920 3300005719 Bacteria 718
99 Ga0068863_100342835 3300005841 Unclassified 1454
100 Ga0068858_100022816 3300005842 Bacteria 5837
101 Ga0068858_100026911 3300005842 Bacteria 5342
102 Ga0068858_100162450 3300005842 Unclassified 2103
103 Ga0068858_100665762 3300005842 Bacteria 1012
104 Ga0068860_100794446 3300005843 Unclassified 959
105 Ga0068860_101332568 3300005843 Bacteria 739
106 Ga0068860_102320675 3300005843 Bacteria 557
107 Ga0068862_100004142 3300005844 Bacteria 12285
108 Ga0068862_100050173 3300005844 Bacteria 3566
109 Ga0068862_100200887 3300005844 Bacteria 1797
110 Ga0081455_10039861 3300005937 Bacteria 4147
111 Ga0081540_1063694 3300005983 Bacteria 1744
112 Ga0075432_10114497 3300006058 Bacteria 1008
113 Ga0097621_100002631 3300006237 Bacteria 12293
114 Ga0068871_100002545 3300006358 Bacteria 12442
115 Ga0075428_100235971 3300006844 Bacteria 1973
116 Ga0075428_100292905 3300006844 Bacteria 1750
117 Ga0075431_100066859 3300006847 Bacteria 3711
118 Ga0075433_10062899 3300006852 Bacteria 3251
119 Ga0075433_10194619 3300006852 Bacteria 1803
120 Ga0075433_10703363 3300006852 Bacteria 885
121 Ga0075434_100168604 3300006871 Bacteria 2209
122 Ga0075434_101003123 3300006871 Bacteria 849
123 Ga0075434_101185396 3300006871 Bacteria 776
124 Ga0068865_100009977 3300006881 Bacteria 5901
125 Ga0075436_100001272 3300006914 Bacteria 17125
126 Ga0075436_100048410 3300006914 Bacteria 2933
127 Ga0075436_100133694 3300006914 Bacteria 1740
128 Ga0097620_101018513 3300006931 Bacteria 910
129 Ga0097620_101045149 3300006931 Bacteria 898
130 Ga0097620_101486725 3300006931 Unclassified 747
131 Ga0075435_100000132 3300007076 Bacteria 41961
132 Ga0075435_100000370 3300007076 Bacteria 27562
133 Ga0075435_100006061 3300007076 Bacteria 8517
134 Ga0075435_100120194 3300007076 Bacteria 2192
135 Ga0075435_100230611 3300007076 Bacteria 1573
136 Ga0105251_10123040 3300009011 Bacteria 1178
137 Ga0111539_10198826 3300009094 Unclassified 2338
138 Ga0105245_10248382 3300009098 Unclassified 1727
139 Ga0105245_10269415 3300009098 Archaea 1660
140 Ga0105245_10376297 3300009098 Bacteria 1413
141 Ga0105245_10515615 3300009098 Unclassified 1213
142 Ga0105245_10957566 3300009098 Bacteria 899
143 Ga0105247_10066224 3300009101 Bacteria 2249
144 Ga0114129_10001935 3300009147 Bacteria 28337
145 Ga0114129_10019054 3300009147 Bacteria 9775
146 Ga0114129_10030147 3300009147 Bacteria 7683
147 Ga0114129_10095589 3300009147 Unclassified 4115
148 Ga0114129_10473678 3300009147 Unclassified 1639
149 Ga0105243_10011283 3300009148 Bacteria 6759
150 Ga0105241_10334288 3300009174 Bacteria 1310
151 Ga0105242_10073392 3300009176 Unclassified 2844
152 Ga0105242_10157496 3300009176 Bacteria 1985
153 Ga0105248_10015823 3300009177 Bacteria 8313
154 Ga0105248_10103345 3300009177 Unclassified 3212
155 Ga0105248_10173135 3300009177 Bacteria 2433
156 Ga0105248_10668498 3300009177 Bacteria 1172
157 Ga0105248_10821081 3300009177 Bacteria 1049
158 Ga0105248_10971907 3300009177 Unclassified 959
159 Ga0105249_11927080 3300009553 Bacteria 664
160 Ga0105239_11590687 3300010375 Unclassified 756
161 Ga0163163_10039763 3300014325 Bacteria 4592
162 Ga0157380_10378101 3300014326 Bacteria 1336
163 Ga0157380_11576849 3300014326 Bacteria 711
164 Ga0157377_10393687 3300014745 Unclassified 942
165 Ga0157379_10017234 3300014968 Bacteria 6363
166 Ga0157379_11298133 3300014968 Bacteria 703
167 Ga0157376_10072230 3300014969 Unclassified 2935
168 Ga0207642_10014129 3300025899 Bacteria 2936
169 Ga0207642_10092246 3300025899 Unclassified 1499
170 Ga0207699_10387835 3300025906 Bacteria 993
171 Ga0207645_10004607 3300025907 Bacteria 10161
172 Ga0207645_10325547 3300025907 Bacteria 1026
173 Ga0207684_10481080 3300025910 Bacteria 1065
174 Ga0207654_10074496 3300025911 Bacteria 2026
175 Ga0207654_10666371 3300025911 Bacteria 746
176 Ga0207662_10002585 3300025918 Bacteria 9122
177 Ga0207646_10373395 3300025922 Bacteria 1288
178 Ga0207646_10644210 3300025922 Unclassified 949
179 Ga0207646_10859652 3300025922 Bacteria 806
180 Ga0207681_10019528 3300025923 Bacteria 4283
181 Ga0207681_10022357 3300025923 Bacteria 4033
182 Ga0207681_10056022 3300025923 Bacteria 2688
183 Ga0207659_10000159 3300025926 Bacteria 40400
184 Ga0207659_10052968 3300025926 Bacteria 2893
185 Ga0207687_10356851 3300025927 Unclassified 1192
186 Ga0207644_10094753 3300025931 Bacteria 2231
187 Ga0207690_10394898 3300025932 Unclassified 1102
188 Ga0207706_10098254 3300025933 Bacteria 2575
189 Ga0207706_10171043 3300025933 Bacteria 1909
190 Ga0207686_10046491 3300025934 Bacteria 2677
191 Ga0207686_10113732 3300025934 Unclassified 1830
192 Ga0207686_10509331 3300025934 Unclassified 935
193 Ga0207686_11196295 3300025934 Unclassified 622
194 Ga0207709_10213127 3300025935 Bacteria 1388
195 Ga0207709_11372387 3300025935 Unclassified 585
196 Ga0207669_10005173 3300025937 Bacteria 5820
197 Ga0207669_10141492 3300025937 Bacteria 1671
198 Ga0207669_10566752 3300025937 Bacteria 919
199 Ga0207704_10014712 3300025938 Bacteria 3961
200 Ga0207691_10969153 3300025940 Unclassified 710
201 Ga0207711_11158175 3300025941 Unclassified 714
202 Ga0207689_10214297 3300025942 Bacteria 1591
203 Ga0207689_10233237 3300025942 Unclassified 1521
204 Ga0207679_10436453 3300025945 Unclassified 1159
205 Ga0207667_10501730 3300025949 Bacteria 1231
206 Ga0207651_10204730 3300025960 Bacteria 1584
207 Ga0207651_10799104 3300025960 Bacteria 836
208 Ga0207651_10869444 3300025960 Bacteria 802
209 Ga0207712_10132859 3300025961 Bacteria 1899
210 Ga0207712_10145115 3300025961 Bacteria 1826
211 Ga0207668_10078423 3300025972 Bacteria 2385
212 Ga0207668_10085021 3300025972 Bacteria 2307
213 Ga0207640_10338592 3300025981 Bacteria 1204
214 Ga0207640_10344530 3300025981 Unclassified 1195
215 Ga0207640_10412377 3300025981 Bacteria 1103
216 Ga0207640_11793068 3300025981 Bacteria 555
217 Ga0207703_10023406 3300026035 Bacteria 4851
218 Ga0207703_10041427 3300026035 Unclassified 3689
219 Ga0207703_10811062 3300026035 Bacteria 894
220 Ga0207639_10331835 3300026041 Bacteria 1354
221 Ga0207708_10002548 3300026075 Bacteria 13404
222 Ga0207708_10009073 3300026075 Bacteria 7360
223 Ga0207708_10660152 3300026075 Bacteria 891
224 Ga0207648_10028835 3300026089 Bacteria 4920
225 Ga0207648_10030957 3300026089 Bacteria 4733
226 Ga0207648_10066228 3300026089 Bacteria 3150
227 Ga0207648_10455282 3300026089 Bacteria 1166
228 Ga0207648_11170760 3300026089 Unclassified 722
229 Ga0207676_10011039 3300026095 Bacteria 6445
230 Ga0207676_10065946 3300026095 Bacteria 2885
231 Ga0207676_10316925 3300026095 Bacteria 1430
232 Ga0207675_100000688 3300026118 Bacteria 33349
233 Ga0207675_100014385 3300026118 Bacteria 7377
234 Ga0207675_100146105 3300026118 Unclassified 2249
235 Ga0207675_100218056 3300026118 Unclassified 1837
236 Ga0207675_100321078 3300026118 Unclassified 1512
237 Ga0207675_100697136 3300026118 Bacteria 1024
238 Ga0207698_10917696 3300026142 Unclassified 883
239 Ga0268265_10026732 3300028380 Bacteria 4108
240 Ga0268265_10037689 3300028380 Bacteria 3550
241 Ga0268265_10039591 3300028380 Bacteria 3475
242 Ga0268264_10440205 3300028381 Unclassified 1261
243 Ga0265330_10159515 3300031235 Unclassified 958
244 Ga0265314_10053456 3300031711 Bacteria 2801
245 Ga0373930_0014773 3300034816 Unclassified 1458
246 Ga0373950_0000609 3300034818 Bacteria 4422
247 Ga0373958_0002366 3300034819 Bacteria 2631
248 Ga0373959_0010625 3300034820 Unclassified 1611
249 Ga0373938_0000845 3300034957 Bacteria 4941
250 Ga0373928_0001552 3300035084 Bacteria 4459
251 Ga0373929_0008173 3300035085 Unclassified 1926
252 Ga0373940_0001561 3300035088 Bacteria 4192
253 Ga0373949_0009199 3300035090 Unclassified 2165
254 Ga0373951_0000438 3300035091 Bacteria 12144
255 Ga0373952_0000451 3300035092 Bacteria 7161
256 Ga0373932_0003835 3300035112 Bacteria 3591
257 Ga0373939_0010980 3300035114 Unclassified 2277
258 Ga0373941_0004147 3300035115 Bacteria 3328
259 Ga0373960_0000749 3300035121 Bacteria 6771
260 Ga0373942_0000601 3300035207 Bacteria 10108
261 Ga0373961_0001213 3300035241 Bacteria 7925
262 Ga0373961_0009726 3300035241 Bacteria 2357
263 Ga0373962_0000229 3300035242 Bacteria 11793
264 Ga0373931_0002387 3300035691 Bacteria 8314
265 Ga0373937_0246128 3300036401 Unclassified 1685
266 Ga0373937_0990720 3300036401 Bacteria 789
267 Ga0395900_1623117 3300037418 Unclassified 558
268 Ga0451576_0011162 3300045051 Bacteria 10241
269 Ga0451576_0128640 3300045051 Bacteria 2640
270 Ga0495603_0490096 3300046455 Bacteria 704
271 Ga0495629_0157626 3300046459 Bacteria 1577
272 Ga0495629_0613921 3300046459 Unclassified 727
273 Ga0495653_0202164 3300046463 Bacteria 1348
274 Ga0495664_0339974 3300046477 Bacteria 904
275 Ga0495608_0235347 3300046511 Unclassified 1146
276 Ga0495645_0116834 3300046543 Bacteria 1882
277 Ga0495667_0245559 3300046559 Unclassified 1140
278 Ga0495635_0049488 3300046663 Bacteria 2897
279 Ga0495659_0192682 3300046664 Unclassified 834
280 Ga0495658_0062615 3300046683 Unclassified 2139
281 Ga0495669_0031151 3300046684 Bacteria 2342
282 Ga0495613_0594770 3300046689 Bacteria 737
283 Ga0496101_0763671 3300048904 Bacteria 763
284 Ga0496102_0155360 3300048905 Unclassified 2151
285 Ga0496102_0442527 3300048905 Unclassified 1219
286 Ga0496106_0256716 3300048909 Bacteria 1398
287 Ga0496107_0142940 3300048910 Bacteria 1769
288 Ga0496108_0034691 3300048911 Bacteria 4191
289 Ga0496109_1343127 3300048912 Unclassified 651
290 Ga0496112_0085547 3300048915 Unclassified 3120
291 Ga0496112_0557790 3300048915 Bacteria 1079
292 Ga0496113_0034773 3300048916 Bacteria 3680
293 Ga0496114_0782661 3300048917 Unclassified 832
294 Ga0501073_0129359 3300049589 Bacteria 1750
295 nmdc:mga05p37_238690_c1 3300050507 Unclassified 2187
296 nmdc:mga05p37_3171_c1 3300050507 Bacteria 19133
297 nmdc:mga05p37_55310_c1 3300050507 Bacteria 4883
298 nmdc:mga05p37_7543_c1 3300050507 Bacteria 12827
299 nmdc:mga06r32_82108_c1 3300050510 Bacteria 3139
300 nmdc:mga0n895_142623_c1 3300050512 Bacteria 2425
301 nmdc:mga0n895_1453972_c1 3300050512 Bacteria 653
302 nmdc:mga0n895_331488_c1 3300050512 Bacteria 1542
303 nmdc:mga0n895_607216_c1 3300050512 Bacteria 1096
304 nmdc:mga0n895_635379_c1 3300050512 Bacteria 1067
305 nmdc:mga0n895_64_c1 3300050512 Bacteria 62327
306 nmdc:mga0rr50_101_c1 3300050513 Bacteria 48216
307 nmdc:mga0rr50_153052_c1 3300050513 Bacteria 1866
308 nmdc:mga0rr50_523778_c1 3300050513 Bacteria 1009
309 nmdc:mga0rr50_59025_c1 3300050513 Bacteria 2878
310 nmdc:mga0rr50_87_c1 3300050513 Bacteria 52403
311 nmdc:mga08x19_10388_c1 3300050514 Bacteria 5588
312 nmdc:mga08x19_126_c1 3300050514 Bacteria 67080
313 nmdc:mga08x19_198341_c1 3300050514 Unclassified 1375
314 nmdc:mga08x19_26897_c1 3300050514 Bacteria 3594
315 nmdc:mga0a205_237756_c1 3300050515 Unclassified 1703
316 nmdc:mga0a205_41928_c1 3300050515 Bacteria 4409
317 nmdc:mga0a205_553035_c1 3300050515 Bacteria 1006
318 nmdc:mga0a205_766760_c1 3300050515 Bacteria 813
319 Ga0495619_0015545 3300053085 Bacteria 4816
320 Ga0207711_11186660
321 Ga0065715_10202579
322 Ga0065715_10563216
323 Ga0070676_10002047
324 Ga0070676_10101492
325 Ga0070676_10622155
326 Ga0070690_100127077
327 Ga0070670_100417373
328 Ga0068869_101011252
329 Ga0070666_10045753
330 Ga0070666_10146911
331 Ga0070666_10203741
332 Ga0070680_100442968
333 Ga0068868_100288975
334 Ga0070691_10089324
335 Ga0070687_100003131
336 Ga0070692_10222294
337 Ga0070668_100034086
338 Ga0070668_100254475
339 Ga0070669_100011466
340 Ga0070669_100524811
341 Ga0070669_101025712
342 Ga0070675_100000942
343 Ga0070675_100027281
344 Ga0070671_100100843
345 Ga0070671_101071937
346 Ga0070674_100022061
347 Ga0070674_100135375
348 Ga0070674_100176944
349 Ga0070673_100005350
350 Ga0070673_100644943
351 Ga0070688_100099048
352 Ga0070659_100393483
353 Ga0070709_10287394
354 Ga0070701_10014746
355 Ga0070701_10184143
356 Ga0070705_100027409
357 Ga0070700_100006048
358 Ga0070700_100102912
359 Ga0070694_100070441
360 Ga0070708_100083772
361 Ga0070662_100163077
362 Ga0070662_100342195
363 Ga0068867_100043646
364 Ga0068867_100050163
365 Ga0068867_100105591
366 Ga0070685_10407501
367 Ga0070706_100249770
368 Ga0070707_100437878
369 Ga0070707_100496570
370 Ga0070698_100042016
371 Ga0070698_100205254
372 Ga0070698_100323064
373 Ga0070698_100467642
374 Ga0070698_100632973
375 Ga0070699_100141157
376 Ga0070697_100207491
377 Ga0070697_100247406
378 Ga0070697_100541183
379 Ga0068853_100513548
380 Ga0070672_101805843
381 Ga0070686_100001028
382 Ga0070686_100333407
383 Ga0070686_100407877
384 Ga0070686_100457141
385 Ga0070686_100711623
386 Ga0070686_101012558
387 Ga0070686_101145670
388 Ga0070695_100027730
389 Ga0070695_100132220
390 Ga0070696_100009261
391 Ga0070696_100599646
392 Ga0070693_100162469
393 Ga0070704_100008489
394 Ga0070704_100050575
395 Ga0070664_100357389
396 Ga0068854_100014195
397 Ga0068854_100022358
398 Ga0068854_100102356
399 Ga0068854_100332045
400 Ga0068854_100361054
401 Ga0068854_101180253
402 Ga0068854_101274987
403 Ga0070702_100054234
404 Ga0068852_100837941
405 Ga0068859_101018403
406 Ga0068859_101045267
407 Ga0068859_101486675
408 Ga0068864_100186622
409 Ga0068864_100395905
410 Ga0068866_10001947
411 Ga0068866_10200113
412 Ga0068861_100000304
413 Ga0068861_100144540
414 Ga0068861_100167180
415 Ga0068861_100188710
416 Ga0068861_100593283
417 Ga0068861_101255920
418 Ga0068863_100342835
419 Ga0068858_100022816
420 Ga0068858_100026911
421 Ga0068858_100162450
422 Ga0068858_100665762
423 Ga0068860_100794446
424 Ga0068860_101332568
425 Ga0068860_102320675
426 Ga0068862_100004142
427 Ga0068862_100050173
428 Ga0068862_100200887
429 Ga0081455_10039861
430 Ga0081540_1063694
431 Ga0075432_10114497
432 Ga0097621_100002631
433 Ga0068871_100002545
434 Ga0075428_100235971
435 Ga0075428_100292905
436 Ga0075431_100066859
437 Ga0075433_10062899
438 Ga0075433_10194619
439 Ga0075433_10703363
440 Ga0075434_100168604
441 Ga0075434_101003123
442 Ga0075434_101185396
443 Ga0068865_100009977
444 Ga0075436_100001272
445 Ga0075436_100048410
446 Ga0075436_100133694
447 Ga0097620_101018513
448 Ga0097620_101045149
449 Ga0097620_101486725
450 Ga0075435_100000132
451 Ga0075435_100000370
452 Ga0075435_100006061
453 Ga0075435_100120194
454 Ga0075435_100230611
455 Ga0105251_10123040
456 Ga0111539_10198826
457 Ga0105245_10248382
458 Ga0105245_10269415
459 Ga0105245_10376297
460 Ga0105245_10515615
461 Ga0105245_10957566
462 Ga0105247_10066224
463 Ga0114129_10001935
464 Ga0114129_10019054
465 Ga0114129_10030147
466 Ga0114129_10095589
467 Ga0114129_10473678
468 Ga0105243_10011283
469 Ga0105241_10334288
470 Ga0105242_10073392
471 Ga0105242_10157496
472 Ga0105248_10015823
473 Ga0105248_10103345
474 Ga0105248_10173135
475 Ga0105248_10668498
476 Ga0105248_10821081
477 Ga0105248_10971907
478 Ga0105249_11927080
479 Ga0105239_11590687
480 Ga0163163_10039763
481 Ga0157380_10378101
482 Ga0157380_11576849
483 Ga0157377_10393687
484 Ga0157379_10017234
485 Ga0157379_11298133
486 Ga0157376_10072230
487 Ga0207642_10014129
488 Ga0207642_10092246
489 Ga0207699_10387835
490 Ga0207645_10004607
491 Ga0207645_10325547
492 Ga0207684_10481080
493 Ga0207654_10074496
494 Ga0207654_10666371
495 Ga0207662_10002585
496 Ga0207646_10373395
497 Ga0207646_10644210
498 Ga0207646_10859652
499 Ga0207681_10019528
500 Ga0207681_10022357
501 Ga0207681_10056022
502 Ga0207659_10000159
503 Ga0207659_10052968
504 Ga0207687_10356851
505 Ga0207644_10094753
506 Ga0207690_10394898
507 Ga0207706_10098254
508 Ga0207706_10171043
509 Ga0207686_10046491
510 Ga0207686_10113732
511 Ga0207686_10509331
512 Ga0207686_11196295
513 Ga0207709_10213127
514 Ga0207709_11372387
515 Ga0207669_10005173
516 Ga0207669_10141492
517 Ga0207669_10566752
518 Ga0207704_10014712
519 Ga0207691_10969153
520 Ga0207711_11158175
521 Ga0207689_10214297
522 Ga0207689_10233237
523 Ga0207679_10436453
524 Ga0207667_10501730
525 Ga0207651_10204730
526 Ga0207651_10799104
527 Ga0207651_10869444
528 Ga0207712_10132859
529 Ga0207712_10145115
530 Ga0207668_10078423
531 Ga0207668_10085021
532 Ga0207640_10338592
533 Ga0207640_10344530
534 Ga0207640_10412377
535 Ga0207640_11793068
536 Ga0207703_10023406
537 Ga0207703_10041427
538 Ga0207703_10811062
539 Ga0207639_10331835
540 Ga0207708_10002548
541 Ga0207708_10009073
542 Ga0207708_10660152
543 Ga0207648_10028835
544 Ga0207648_10030957
545 Ga0207648_10066228
546 Ga0207648_10455282
547 Ga0207648_11170760
548 Ga0207676_10011039
549 Ga0207676_10065946
550 Ga0207676_10316925
551 Ga0207675_100000688
552 Ga0207675_100014385
553 Ga0207675_100146105
554 Ga0207675_100218056
555 Ga0207675_100321078
556 Ga0207675_100697136
557 Ga0207698_10917696
558 Ga0268265_10026732
559 Ga0268265_10037689
560 Ga0268265_10039591
561 Ga0268264_10440205
562 Ga0265330_10159515
563 Ga0265314_10053456
564 Ga0373930_0014773
565 Ga0373950_0000609
566 Ga0373958_0002366
567 Ga0373959_0010625
568 Ga0373938_0000845
569 Ga0373928_0001552
570 Ga0373929_0008173
571 Ga0373940_0001561
572 Ga0373949_0009199
573 Ga0373951_0000438
574 Ga0373952_0000451
575 Ga0373932_0003835
576 Ga0373939_0010980
577 Ga0373941_0004147
578 Ga0373960_0000749
579 Ga0373942_0000601
580 Ga0373961_0001213
581 Ga0373961_0009726
582 Ga0373962_0000229
583 Ga0373931_0002387
584 Ga0373937_0246128
585 Ga0373937_0990720
586 Ga0395900_1623117
587 Ga0451576_0011162
588 Ga0451576_0128640
589 Ga0495603_0490096
590 Ga0495629_0157626
591 Ga0495629_0613921
592 Ga0495653_0202164
593 Ga0495664_0339974
594 Ga0495608_0235347
595 Ga0495645_0116834
596 Ga0495667_0245559
597 Ga0495635_0049488
598 Ga0495659_0192682
599 Ga0495658_0062615
600 Ga0495669_0031151
601 Ga0495613_0594770
602 Ga0496101_0763671
603 Ga0496102_0155360
604 Ga0496102_0442527
605 Ga0496106_0256716
606 Ga0496107_0142940
607 Ga0496108_0034691
608 Ga0496109_1343127
609 Ga0496112_0085547
610 Ga0496112_0557790
611 Ga0496113_0034773
612 Ga0496114_0782661
613 Ga0501073_0129359
614 nmdc:mga05p37_238690_c1
615 nmdc:mga05p37_3171_c1
616 nmdc:mga05p37_55310_c1
617 nmdc:mga05p37_7543_c1
618 nmdc:mga06r32_82108_c1
619 nmdc:mga0n895_142623_c1
620 nmdc:mga0n895_1453972_c1
621 nmdc:mga0n895_331488_c1
622 nmdc:mga0n895_607216_c1
623 nmdc:mga0n895_635379_c1
624 nmdc:mga0n895_64_c1
625 nmdc:mga0rr50_101_c1
626 nmdc:mga0rr50_153052_c1
627 nmdc:mga0rr50_523778_c1
628 nmdc:mga0rr50_59025_c1
629 nmdc:mga0rr50_87_c1
630 nmdc:mga08x19_10388_c1
631 nmdc:mga08x19_126_c1
632 nmdc:mga08x19_198341_c1
633 nmdc:mga08x19_26897_c1
634 nmdc:mga0a205_237756_c1
635 nmdc:mga0a205_41928_c1
636 nmdc:mga0a205_553035_c1
637 nmdc:mga0a205_766760_c1
638 Ga0495619_0015545

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1y4c-assembly1.cif.gz_A designed helical protein fusion mbp 0.8073 2 133
6bfi-assembly2.cif.gz_B vinculin homolog in a sponge (phylum porifera) reveals vertebrate-like cell adhesions involved in early multicellular evolution 0.7219 5 140
6bfi-assembly1.cif.gz_A vinculin homolog in a sponge (phylum porifera) reveals vertebrate-like cell adhesions involved in early multicellular evolution 0.7215 5 140
4k0d-assembly1.cif.gz_B periplasmic sensor domain of sensor histidine kinase, adeh_2942 0.7063 2 154
6egc-assembly1.cif.gz_A single-chain version of 2l4hc2_23 (pdb 5j0k) 0.7002 2 150
ID Description Score Start End Superfamily
1y4cA03 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);IL-4 antagonist (De novo design) like domain 0.8073 2 133 1.20.120.660
1y4cA03 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);IL-4 antagonist (De novo design) like domain 0.7374 2 133 1.20.120.660
af_K7UBM2_100_278_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7312 30 148 1.20.120.550
4k34B00 Mainly Alpha;Up-down Bundle;Outer membrane efflux proteins (OEP);Outer membrane efflux proteins (OEP) 0.6933 62 148 1.20.1600.10
af_F4IDY5_607_777_1.20.120.520 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);nmb1532 protein domain like 0.6612 2 150 1.20.120.520
ID Description Score Start End GO Terms
AF-A0A2V8EEV3-F1-model_v4 Uncharacterized protein 0.9878 31 154 GO:0016020
AF-A0A2V8EEV3-F1-model_v4 Uncharacterized protein 0.9646 31 154 GO:0016020
AF-A0A2V9J975-F1-model_v4 Uncharacterized protein 0.9641 31 154 GO:0016020
AF-A0A1Q7AIP4-F1-model_v4 MotA/TolQ/ExbB proton channel domain-containing protein 0.9523 2 154 GO:0016020
AF-A0A7C7SF30-F1-model_v4 MotA/TolQ/ExbB proton channel domain-containing protein 0.947 52 154 GO:0016020

Map