F404967

General Info

Members Datasets Scaffolds Average Seq Length
319 164 638 872

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100020656|Ga0070708_1000206561
Length 961
Sequence MTRWRFPLLLXXXXSAIYLYAYPAATIIYGGGVLLHTGAGILLAVLLIPILRQVFRNCSLEIRFGWLLIAAGTLLGLVLIKIGTPNRFRFWLYLHIALCVAGVLIVATSWLTRQGWLGKGFTGAVASFAALALLTFGIAAGSWWTRNIAWKNSNRVVNPHMPTETMDGEGDGPNGKFFPSSAQTRDGKNIPAKYFMQSQACERCHSDIYKQWNSSAHHFSSFNNQWYRKSIEYMQDVAGVKSSKWCAGCHDPALLFSGMFDTPIRQIENTPAAQAGLSCMMCHSIVEVKSTMGQGDFVLEYPKLHELAASENPVTRALHDFMVKVNPEPHRRTFLKPFMREQTAEFCSGCHKVHLDVPVNRYRWVRGFNEYDNWQASGVSGQGARSFYYPANSMMCADCHMPLLPSKDEGNVNGFVHSHRFPGANTAVPTANQDPVQLAQSVNFLQDKQVTVDVFGISPAEREIPHPAASPLANGQELSTTFAVGEEADVTSPQGPKXXARPITAPLGRVQASVRRGDDYLVDVVVRTRKVGHFFPGGTVDAFDVWLELQASDENGQILFWSGKVEDDGKGPVEPGAHFYRSQQIDAHGNVINKRNAWSNRAVVYVHLIPPGAADTVHFHMHVPENAGDKINLHAKLNYRKFMWWNTQFSYAGEEDPAQAKGATTPDYDDRKFVFHGDTSGVAGALKQIPDLPIITVAEDTKSISVMPKTSPPATPNAITAKEDWMRWNDYGIGLFLQNDFKGAEAAFINATEADPNNFDGWVNIGRVRTQEGDTAGAFKALDKALSLKPNLARANYFYARDLKEEGRYDEAIAKLQSVLQQYPRDRVVRNELGRIYFLQKKYSDAVKEFETTLTIDPEDLQAHYNLMLCYNGLGDEVKAEAHKIRYLRYKADESAQAITGPYRQNHPEDNNERQSIHEHVSVALNATKPISPNVQESANSSRKSANGRSTGSATSPAGTD

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
79 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
121 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
123 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
124 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
125 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
126 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
127 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
129 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
134 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
135 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
136 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
139 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
140 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
141 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
142 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
143 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
144 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
145 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
146 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
147 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
148 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
149 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
155 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
161 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
162 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
163 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
164 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.31
Nodule 0
Rhizoplane 3.76
Rhizosphere 94.98
Stem 0
Stem Tuber 0
Unclassified 3.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100020656 3300005445 Bacteria 5558
2 JGI24751J29686_10001523 3300002459 Bacteria 4808
3 Ga0065712_10001602 3300005290 Bacteria 6905
4 Ga0065715_10003840 3300005293 Bacteria 12080
5 Ga0070683_100000991 3300005329 Bacteria 21246
6 Ga0070683_100012145 3300005329 Bacteria 7475
7 Ga0070670_100002251 3300005331 Bacteria 15867
8 Ga0070670_100003579 3300005331 Bacteria 12928
9 Ga0070670_100015561 3300005331 Bacteria 6533
10 Ga0068869_100003202 3300005334 Bacteria 10002
11 Ga0070689_100003702 3300005340 Bacteria 10219
12 Ga0070661_100003343 3300005344 Bacteria 11063
13 Ga0070661_100004271 3300005344 Bacteria 9854
14 Ga0070671_100042528 3300005355 Bacteria 3777
15 Ga0070673_100006664 3300005364 Bacteria 7530
16 Ga0070673_100011730 3300005364 Bacteria 5992
17 Ga0070709_10001394 3300005434 Bacteria 13137
18 Ga0070709_10006466 3300005434 Bacteria 6391
19 Ga0070709_10007481 3300005434 Bacteria 5989
20 Ga0070714_100000669 3300005435 Bacteria 24237
21 Ga0070714_100000774 3300005435 Bacteria 22670
22 Ga0070713_100000078 3300005436 Bacteria 60357
23 Ga0070713_100000701 3300005436 Bacteria 21508
24 Ga0070713_100004392 3300005436 Bacteria 9475
25 Ga0070711_100000754 3300005439 Bacteria 16905
26 Ga0070711_100044225 3300005439 Bacteria 3022
27 Ga0070708_100000165 3300005445 Bacteria 47190
28 Ga0070708_100001224 3300005445 Bacteria 19744
29 Ga0070708_100053821 3300005445 Bacteria 3573
30 Ga0070681_10000112 3300005458 Bacteria 60515
31 Ga0068867_100012354 3300005459 Bacteria 6040
32 Ga0070685_10004826 3300005466 Bacteria 6823
33 Ga0070685_10015075 3300005466 Bacteria 4103
34 Ga0070706_100000915 3300005467 Bacteria 32338
35 Ga0070707_100000221 3300005468 Bacteria 57035
36 Ga0070707_100003322 3300005468 Bacteria 15188
37 Ga0070707_100004253 3300005468 Bacteria 13406
38 Ga0070707_100004396 3300005468 Bacteria 13205
39 Ga0070698_100000918 3300005471 Bacteria 32177
40 Ga0070698_100001730 3300005471 Bacteria 24348
41 Ga0070698_100017740 3300005471 Bacteria 7497
42 Ga0070698_100051405 3300005471 Bacteria 4197
43 Ga0070699_100001358 3300005518 Bacteria 22522
44 Ga0070699_100009270 3300005518 Bacteria 8524
45 Ga0070699_100012511 3300005518 Bacteria 7324
46 Ga0070679_100001393 3300005530 Bacteria 21282
47 Ga0070679_100004322 3300005530 Bacteria 13117
48 Ga0070684_100013065 3300005535 Bacteria 6682
49 Ga0070697_100000077 3300005536 Bacteria 77995
50 Ga0070697_100000219 3300005536 Bacteria 47258
51 Ga0070697_100000970 3300005536 Bacteria 21656
52 Ga0070697_100001198 3300005536 Bacteria 19619
53 Ga0070697_100001959 3300005536 Bacteria 15763
54 Ga0070697_100002034 3300005536 Bacteria 15482
55 Ga0070672_100004833 3300005543 Bacteria 8855
56 Ga0070672_100015566 3300005543 Bacteria 5420
57 Ga0070686_100014494 3300005544 Bacteria 4546
58 Ga0070695_100001515 3300005545 Bacteria 12905
59 Ga0070695_100015430 3300005545 Bacteria 4613
60 Ga0070693_100000261 3300005547 Bacteria 24757
61 Ga0070693_100020563 3300005547 Unclassified 3483
62 Ga0070665_100000646 3300005548 Bacteria 47132
63 Ga0068855_100000440 3300005563 Bacteria 51346
64 Ga0068855_100000891 3300005563 Bacteria 37064
65 Ga0068855_100101011 3300005563 Bacteria 3321
66 Ga0068855_100113253 3300005563 Bacteria 3112
67 Ga0070664_100000079 3300005564 Bacteria 61393
68 Ga0068857_100000592 3300005577 Bacteria 26539
69 Ga0068857_100002037 3300005577 Bacteria 16381
70 Ga0068857_100004982 3300005577 Bacteria 11282
71 Ga0068857_100006936 3300005577 Bacteria 9748
72 Ga0068854_100003520 3300005578 Bacteria 9782
73 Ga0068856_100000314 3300005614 Bacteria 53174
74 Ga0068856_100000593 3300005614 Bacteria 39597
75 Ga0068856_100000732 3300005614 Bacteria 35599
76 Ga0068856_100003171 3300005614 Bacteria 16740
77 Ga0068859_100014101 3300005617 Bacteria 8015
78 Ga0068864_100004555 3300005618 Bacteria 11381
79 Ga0068864_100016737 3300005618 Bacteria 6109
80 Ga0068866_10002461 3300005718 Bacteria 7635
81 Ga0068866_10014134 3300005718 Unclassified 3518
82 Ga0068863_100000665 3300005841 Bacteria 34641
83 Ga0068863_100003714 3300005841 Bacteria 15098
84 Ga0068858_100005492 3300005842 Bacteria 12413
85 Ga0068858_100005591 3300005842 Bacteria 12294
86 Ga0068858_100006454 3300005842 Bacteria 11419
87 Ga0068860_100026723 3300005843 Bacteria 5562
88 Ga0068862_100017953 3300005844 Bacteria 5893
89 Ga0081455_10004067 3300005937 Bacteria 16566
90 Ga0081538_10011542 3300005981 Bacteria 7148
91 Ga0070717_10000893 3300006028 Bacteria 19773
92 Ga0070717_10001288 3300006028 Bacteria 17146
93 Ga0070717_10001482 3300006028 Bacteria 16234
94 Ga0070717_10001788 3300006028 Bacteria 14986
95 Ga0070717_10008019 3300006028 Bacteria 7870
96 Ga0070717_10029874 3300006028 Bacteria 4378
97 Ga0070716_100003476 3300006173 Bacteria 7424
98 Ga0070716_100006347 3300006173 Bacteria 5772
99 Ga0070712_100000122 3300006175 Bacteria 40912
100 Ga0070712_100000856 3300006175 Bacteria 18132
101 Ga0070712_100001183 3300006175 Bacteria 15749
102 Ga0097621_100002921 3300006237 Bacteria 11741
103 Ga0097621_100010854 3300006237 Bacteria 6685
104 Ga0068871_100000047 3300006358 Bacteria 66864
105 Ga0075428_100000428 3300006844 Bacteria 41804
106 Ga0075428_100011765 3300006844 Bacteria 9742
107 Ga0075428_100014101 3300006844 Bacteria 8892
108 Ga0075433_10002327 3300006852 Bacteria 14465
109 Ga0075434_100000037 3300006871 Bacteria 60689
110 Ga0075434_100007395 3300006871 Bacteria 10170
111 Ga0075434_100015140 3300006871 Bacteria 7388
112 Ga0075434_100047157 3300006871 Bacteria 4277
113 Ga0075434_100084405 3300006871 Bacteria 3175
114 Ga0075436_100002076 3300006914 Bacteria 13824
115 Ga0075436_100007672 3300006914 Bacteria 7371
116 Ga0097620_100014102 3300006931 Bacteria 8015
117 Ga0075435_100004393 3300007076 Bacteria 9675
118 Ga0075435_100011608 3300007076 Bacteria 6492
119 Ga0075435_100014349 3300007076 Bacteria 5918
120 Ga0075435_100021742 3300007076 Bacteria 4940
121 Ga0075435_100037737 3300007076 Unclassified 3849
122 Ga0075435_100050947 3300007076 Bacteria 3333
123 Ga0099794_10001807 3300007265 Bacteria 7638
124 Ga0099794_10002748 3300007265 Bacteria 6571
125 Ga0105240_10021951 3300009093 Bacteria 8478
126 Ga0105240_10063278 3300009093 Bacteria 4602
127 Ga0111539_10027987 3300009094 Bacteria 6884
128 Ga0111539_10122835 3300009094 Unclassified 3043
129 Ga0105245_10029299 3300009098 Bacteria 4862
130 Ga0114129_10003151 3300009147 Bacteria 23148
131 Ga0114129_10012812 3300009147 Bacteria 11934
132 Ga0105241_10027660 3300009174 Bacteria 4224
133 Ga0105242_10006889 3300009176 Bacteria 8765
134 Ga0105248_10001398 3300009177 Bacteria 26947
135 Ga0105237_10054054 3300009545 Bacteria 4024
136 Ga0105238_10004167 3300009551 Bacteria 14348
137 Ga0105249_10015832 3300009553 Bacteria 6682
138 Ga0105239_10017399 3300010375 Bacteria 7950
139 Ga0105246_10009316 3300011119 Bacteria 6047
140 Ga0157369_10000196 3300013105 Bacteria 84536
141 Ga0157369_10001009 3300013105 Bacteria 35450
142 Ga0157369_10014606 3300013105 Bacteria 8859
143 Ga0157369_10015709 3300013105 Bacteria 8531
144 Ga0157369_10030370 3300013105 Bacteria 5960
145 Ga0157374_10000226 3300013296 Bacteria 52324
146 Ga0157374_10000312 3300013296 Bacteria 45142
147 Ga0157374_10001497 3300013296 Bacteria 19716
148 Ga0157374_10018164 3300013296 Bacteria 6203
149 Ga0157378_10000057 3300013297 Bacteria 96589
150 Ga0157378_10000058 3300013297 Bacteria 96172
151 Ga0157378_10001559 3300013297 Bacteria 20702
152 Ga0163162_10017094 3300013306 Bacteria 7097
153 Ga0157372_10000200 3300013307 Bacteria 66086
154 Ga0157372_10000379 3300013307 Bacteria 49273
155 Ga0157372_10000476 3300013307 Bacteria 44270
156 Ga0157372_10000714 3300013307 Bacteria 36499
157 Ga0157372_10007008 3300013307 Bacteria 12007
158 Ga0157372_10041241 3300013307 Bacteria 5102
159 Ga0157372_10050372 3300013307 Bacteria 4632
160 Ga0163163_10004600 3300014325 Bacteria 11777
161 Ga0163163_10090035 3300014325 Bacteria 3081
162 Ga0157379_10007139 3300014968 Bacteria 9660
163 Ga0157376_10000032 3300014969 Bacteria 167294
164 Ga0157376_10003544 3300014969 Bacteria 10757
165 Ga0157376_10004689 3300014969 Bacteria 9530
166 Ga0163161_10004642 3300017792 Bacteria 9558
167 Ga0213875_10000056 3300021388 Bacteria 136543
168 Ga0207656_10002471 3300025321 Bacteria 6237
169 Ga0207692_10009463 3300025898 Bacteria 4072
170 Ga0207647_10006170 3300025904 Bacteria 8732
171 Ga0207699_10001034 3300025906 Bacteria 13119
172 Ga0207699_10009155 3300025906 Bacteria 4918
173 Ga0207645_10000019 3300025907 Bacteria 110182
174 Ga0207645_10007930 3300025907 Bacteria 7459
175 Ga0207684_10000948 3300025910 Bacteria 32649
176 Ga0207684_10001389 3300025910 Bacteria 26320
177 Ga0207654_10008104 3300025911 Bacteria 5298
178 Ga0207695_10070448 3300025913 Bacteria 3574
179 Ga0207693_10000055 3300025915 Bacteria 96481
180 Ga0207693_10000291 3300025915 Bacteria 46501
181 Ga0207663_10000255 3300025916 Bacteria 23196
182 Ga0207663_10013866 3300025916 Bacteria 4395
183 Ga0207663_10016443 3300025916 Bacteria 4103
184 Ga0207662_10005309 3300025918 Bacteria 6850
185 Ga0207657_10005230 3300025919 Bacteria 13594
186 Ga0207657_10015324 3300025919 Bacteria 7430
187 Ga0207649_10000188 3300025920 Bacteria 50655
188 Ga0207652_10010254 3300025921 Bacteria 7540
189 Ga0207652_10020058 3300025921 Bacteria 5505
190 Ga0207646_10000037 3300025922 Bacteria 196362
191 Ga0207646_10000842 3300025922 Bacteria 39742
192 Ga0207646_10001060 3300025922 Bacteria 34983
193 Ga0207646_10002093 3300025922 Bacteria 23946
194 Ga0207646_10052704 3300025922 Bacteria 3641
195 Ga0207650_10000024 3300025925 Bacteria 299184
196 Ga0207700_10000090 3300025928 Bacteria 55960
197 Ga0207700_10000101 3300025928 Bacteria 52726
198 Ga0207700_10018760 3300025928 Bacteria 4657
199 Ga0207664_10000033 3300025929 Bacteria 176549
200 Ga0207664_10002693 3300025929 Bacteria 11784
201 Ga0207664_10057570 3300025929 Unclassified 3090
202 Ga0207706_10005572 3300025933 Bacteria 11735
203 Ga0207686_10009113 3300025934 Bacteria 5378
204 Ga0207670_10001990 3300025936 Bacteria 10718
205 Ga0207691_10000156 3300025940 Bacteria 63522
206 Ga0207691_10016103 3300025940 Bacteria 7104
207 Ga0207691_10044322 3300025940 Bacteria 4095
208 Ga0207689_10006742 3300025942 Bacteria 10124
209 Ga0207689_10016823 3300025942 Bacteria 6191
210 Ga0207661_10000067 3300025944 Bacteria 72201
211 Ga0207661_10027875 3300025944 Bacteria 4320
212 Ga0207679_10000055 3300025945 Bacteria 108728
213 Ga0207679_10002728 3300025945 Bacteria 10919
214 Ga0207667_10000710 3300025949 Bacteria 43178
215 Ga0207667_10007977 3300025949 Bacteria 12628
216 Ga0207651_10033943 3300025960 Bacteria 3297
217 Ga0207640_10004489 3300025981 Bacteria 7570
218 Ga0207640_10006841 3300025981 Bacteria 6268
219 Ga0207703_10002182 3300026035 Bacteria 17179
220 Ga0207703_10002858 3300026035 Bacteria 14720
221 Ga0207703_10013633 3300026035 Bacteria 6335
222 Ga0207678_10013193 3300026067 Bacteria 7250
223 Ga0207708_10000796 3300026075 Bacteria 23805
224 Ga0207702_10000863 3300026078 Bacteria 31617
225 Ga0207702_10000888 3300026078 Bacteria 31007
226 Ga0207702_10001662 3300026078 Bacteria 21972
227 Ga0207702_10021215 3300026078 Bacteria 5376
228 Ga0207641_10000030 3300026088 Bacteria 224468
229 Ga0207641_10001205 3300026088 Bacteria 25890
230 Ga0207641_10002906 3300026088 Bacteria 15499
231 Ga0207648_10000031 3300026089 Bacteria 129124
232 Ga0207648_10025246 3300026089 Bacteria 5294
233 Ga0207676_10000915 3300026095 Bacteria 22842
234 Ga0207676_10005444 3300026095 Bacteria 9009
235 Ga0207676_10026732 3300026095 Bacteria 4292
236 Ga0207674_10000618 3300026116 Bacteria 46623
237 Ga0207674_10003082 3300026116 Bacteria 20621
238 Ga0207674_10006248 3300026116 Bacteria 14037
239 Ga0207683_10004439 3300026121 Bacteria 12118
240 Ga0209588_1000710 3300027671 Bacteria 8431
241 Ga0207428_10002253 3300027907 Bacteria 19371
242 Ga0268266_10000349 3300028379 Bacteria 71878
243 Ga0268266_10008045 3300028379 Bacteria 9423
244 Ga0268264_10016132 3300028381 Bacteria 6120
245 Ga0268264_10018263 3300028381 Bacteria 5736
246 Ga0265338_10012304 3300028800 Bacteria 9765
247 Ga0265760_10001140 3300031090 Bacteria 7727
248 Ga0265339_10006943 3300031249 Bacteria 7367
249 Ga0316577_10003495 3300031733 Bacteria 7943
250 Ga0373954_0000911 3300035118 Bacteria 11508
251 Ga0373943_0000235 3300035170 Bacteria 22708
252 Ga0373924_0011037 3300035410 Bacteria 3347
253 Ga0373935_0000363 3300035692 Bacteria 23142
254 Ga0373935_0018385 3300035692 Bacteria 4251
255 Ga0373927_0000635 3300035695 Bacteria 26605
256 Ga0373927_0010233 3300035695 Bacteria 6265
257 Ga0373947_0001002 3300035725 Bacteria 17225
258 Ga0373937_0000724 3300036401 Bacteria 28691
259 Ga0373937_0037696 3300036401 Bacteria 4406
260 Ga0373937_0062720 3300036401 Bacteria 3417
261 Ga0373925_0000661 3300037068 Bacteria 32361
262 Ga0373925_0000819 3300037068 Bacteria 28676
263 Ga0373925_0004968 3300037068 Bacteria 9987
264 Ga0395905_0003275 3300037471 Bacteria 17393
265 Ga0436364_0654010 3300037853 Bacteria 80215
266 Ga0436363_0563416 3300039450 Bacteria 5237
267 Ga0451577_0039887 3300042876 Bacteria 4218
268 Ga0453683_0011190 3300044673 Bacteria 5929
269 Ga0466967_0048688 3300045976 Unclassified 3703
270 Ga0495580_0000505 3300046472 Bacteria 32817
271 Ga0495580_0001138 3300046472 Bacteria 23427
272 Ga0495580_0001147 3300046472 Bacteria 23331
273 Ga0495580_0002743 3300046472 Bacteria 15174
274 Ga0495582_0003281 3300046473 Bacteria 9087
275 Ga0495582_0008287 3300046473 Bacteria 5738
276 Ga0495587_0000342 3300046536 Bacteria 33220
277 Ga0495667_0008423 3300046559 Bacteria 6997
278 Ga0495657_0001157 3300046675 Bacteria 23099
279 Ga0495623_0013879 3300046679 Bacteria 5223
280 Ga0495613_0005127 3300046689 Bacteria 9831
281 Ga0495613_0019987 3300046689 Bacteria 4991
282 Ga0495604_0001271 3300047317 Bacteria 20651
283 Ga0495674_0043363 3300047319 Unclassified 4004
284 Ga0495680_0044483 3300047322 Unclassified 3511
285 Ga0495684_0014336 3300047471 Bacteria 6100
286 Ga0495602_0005821 3300048088 Bacteria 12936
287 Ga0495602_0027295 3300048088 Bacteria 5489
288 Ga0496108_0002333 3300048911 Bacteria 15200
289 Ga0496109_0002662 3300048912 Bacteria 14987
290 Ga0496110_0003744 3300048913 Bacteria 11714
291 Ga0496110_0027431 3300048913 Bacteria 4883
292 Ga0496111_0003898 3300048914 Bacteria 9342
293 Ga0496112_0000077 3300048915 Bacteria 64994
294 Ga0496112_0003937 3300048915 Bacteria 12434
295 Ga0496112_0042564 3300048915 Bacteria 4443
296 Ga0496112_0044040 3300048915 Unclassified 4371
297 Ga0496112_0044619 3300048915 Unclassified 4345
298 Ga0496113_0000236 3300048916 Bacteria 26009
299 Ga0496115_0002840 3300048918 Bacteria 12460
300 Ga0501076_0030560 3300049592 Bacteria 4196
301 nmdc:mga05p37_116387_c1 3300050507 Bacteria 3285
302 nmdc:mga05p37_48875_c1 3300050507 Bacteria 5202
303 nmdc:mga05p37_6241_c1 3300050507 Bacteria 14033
304 nmdc:mga05p37_9618_c1 3300050507 Bacteria 11451
305 nmdc:mga08y16_1576_c1 3300050511 Bacteria 23022
306 nmdc:mga08y16_34639_c1 3300050511 Bacteria 5304
307 nmdc:mga0n895_116_c1 3300050512 Bacteria 47089
308 nmdc:mga0n895_15268_c1 3300050512 Bacteria 6998
309 nmdc:mga0n895_17620_c1 3300050512 Bacteria 6588
310 nmdc:mga0rr50_1633_c1 3300050513 Bacteria 12334
311 nmdc:mga0rr50_19079_c1 3300050513 Unclassified 4620
312 nmdc:mga0rr50_3562_c1 3300050513 Bacteria 8995
313 nmdc:mga0rr50_38723_c1 3300050513 Bacteria 3453
314 nmdc:mga08x19_2881_c1 3300050514 Bacteria 10361
315 nmdc:mga08x19_5899_c1 3300050514 Bacteria 7247
316 nmdc:mga08x19_7_c1 3300050514 Bacteria 437351
317 nmdc:mga0a205_35665_c1 3300050515 Bacteria 4776
318 nmdc:mga0a205_5707_c1 3300050515 Bacteria 11214
319 Ga0500616_0000132 3300053153 Bacteria 130902
320 Ga0070708_100020656
321 JGI24751J29686_10001523
322 Ga0065712_10001602
323 Ga0065715_10003840
324 Ga0070683_100000991
325 Ga0070683_100012145
326 Ga0070670_100002251
327 Ga0070670_100003579
328 Ga0070670_100015561
329 Ga0068869_100003202
330 Ga0070689_100003702
331 Ga0070661_100003343
332 Ga0070661_100004271
333 Ga0070671_100042528
334 Ga0070673_100006664
335 Ga0070673_100011730
336 Ga0070709_10001394
337 Ga0070709_10006466
338 Ga0070709_10007481
339 Ga0070714_100000669
340 Ga0070714_100000774
341 Ga0070713_100000078
342 Ga0070713_100000701
343 Ga0070713_100004392
344 Ga0070711_100000754
345 Ga0070711_100044225
346 Ga0070708_100000165
347 Ga0070708_100001224
348 Ga0070708_100053821
349 Ga0070681_10000112
350 Ga0068867_100012354
351 Ga0070685_10004826
352 Ga0070685_10015075
353 Ga0070706_100000915
354 Ga0070707_100000221
355 Ga0070707_100003322
356 Ga0070707_100004253
357 Ga0070707_100004396
358 Ga0070698_100000918
359 Ga0070698_100001730
360 Ga0070698_100017740
361 Ga0070698_100051405
362 Ga0070699_100001358
363 Ga0070699_100009270
364 Ga0070699_100012511
365 Ga0070679_100001393
366 Ga0070679_100004322
367 Ga0070684_100013065
368 Ga0070697_100000077
369 Ga0070697_100000219
370 Ga0070697_100000970
371 Ga0070697_100001198
372 Ga0070697_100001959
373 Ga0070697_100002034
374 Ga0070672_100004833
375 Ga0070672_100015566
376 Ga0070686_100014494
377 Ga0070695_100001515
378 Ga0070695_100015430
379 Ga0070693_100000261
380 Ga0070693_100020563
381 Ga0070665_100000646
382 Ga0068855_100000440
383 Ga0068855_100000891
384 Ga0068855_100101011
385 Ga0068855_100113253
386 Ga0070664_100000079
387 Ga0068857_100000592
388 Ga0068857_100002037
389 Ga0068857_100004982
390 Ga0068857_100006936
391 Ga0068854_100003520
392 Ga0068856_100000314
393 Ga0068856_100000593
394 Ga0068856_100000732
395 Ga0068856_100003171
396 Ga0068859_100014101
397 Ga0068864_100004555
398 Ga0068864_100016737
399 Ga0068866_10002461
400 Ga0068866_10014134
401 Ga0068863_100000665
402 Ga0068863_100003714
403 Ga0068858_100005492
404 Ga0068858_100005591
405 Ga0068858_100006454
406 Ga0068860_100026723
407 Ga0068862_100017953
408 Ga0081455_10004067
409 Ga0081538_10011542
410 Ga0070717_10000893
411 Ga0070717_10001288
412 Ga0070717_10001482
413 Ga0070717_10001788
414 Ga0070717_10008019
415 Ga0070717_10029874
416 Ga0070716_100003476
417 Ga0070716_100006347
418 Ga0070712_100000122
419 Ga0070712_100000856
420 Ga0070712_100001183
421 Ga0097621_100002921
422 Ga0097621_100010854
423 Ga0068871_100000047
424 Ga0075428_100000428
425 Ga0075428_100011765
426 Ga0075428_100014101
427 Ga0075433_10002327
428 Ga0075434_100000037
429 Ga0075434_100007395
430 Ga0075434_100015140
431 Ga0075434_100047157
432 Ga0075434_100084405
433 Ga0075436_100002076
434 Ga0075436_100007672
435 Ga0097620_100014102
436 Ga0075435_100004393
437 Ga0075435_100011608
438 Ga0075435_100014349
439 Ga0075435_100021742
440 Ga0075435_100037737
441 Ga0075435_100050947
442 Ga0099794_10001807
443 Ga0099794_10002748
444 Ga0105240_10021951
445 Ga0105240_10063278
446 Ga0111539_10027987
447 Ga0111539_10122835
448 Ga0105245_10029299
449 Ga0114129_10003151
450 Ga0114129_10012812
451 Ga0105241_10027660
452 Ga0105242_10006889
453 Ga0105248_10001398
454 Ga0105237_10054054
455 Ga0105238_10004167
456 Ga0105249_10015832
457 Ga0105239_10017399
458 Ga0105246_10009316
459 Ga0157369_10000196
460 Ga0157369_10001009
461 Ga0157369_10014606
462 Ga0157369_10015709
463 Ga0157369_10030370
464 Ga0157374_10000226
465 Ga0157374_10000312
466 Ga0157374_10001497
467 Ga0157374_10018164
468 Ga0157378_10000057
469 Ga0157378_10000058
470 Ga0157378_10001559
471 Ga0163162_10017094
472 Ga0157372_10000200
473 Ga0157372_10000379
474 Ga0157372_10000476
475 Ga0157372_10000714
476 Ga0157372_10007008
477 Ga0157372_10041241
478 Ga0157372_10050372
479 Ga0163163_10004600
480 Ga0163163_10090035
481 Ga0157379_10007139
482 Ga0157376_10000032
483 Ga0157376_10003544
484 Ga0157376_10004689
485 Ga0163161_10004642
486 Ga0213875_10000056
487 Ga0207656_10002471
488 Ga0207692_10009463
489 Ga0207647_10006170
490 Ga0207699_10001034
491 Ga0207699_10009155
492 Ga0207645_10000019
493 Ga0207645_10007930
494 Ga0207684_10000948
495 Ga0207684_10001389
496 Ga0207654_10008104
497 Ga0207695_10070448
498 Ga0207693_10000055
499 Ga0207693_10000291
500 Ga0207663_10000255
501 Ga0207663_10013866
502 Ga0207663_10016443
503 Ga0207662_10005309
504 Ga0207657_10005230
505 Ga0207657_10015324
506 Ga0207649_10000188
507 Ga0207652_10010254
508 Ga0207652_10020058
509 Ga0207646_10000037
510 Ga0207646_10000842
511 Ga0207646_10001060
512 Ga0207646_10002093
513 Ga0207646_10052704
514 Ga0207650_10000024
515 Ga0207700_10000090
516 Ga0207700_10000101
517 Ga0207700_10018760
518 Ga0207664_10000033
519 Ga0207664_10002693
520 Ga0207664_10057570
521 Ga0207706_10005572
522 Ga0207686_10009113
523 Ga0207670_10001990
524 Ga0207691_10000156
525 Ga0207691_10016103
526 Ga0207691_10044322
527 Ga0207689_10006742
528 Ga0207689_10016823
529 Ga0207661_10000067
530 Ga0207661_10027875
531 Ga0207679_10000055
532 Ga0207679_10002728
533 Ga0207667_10000710
534 Ga0207667_10007977
535 Ga0207651_10033943
536 Ga0207640_10004489
537 Ga0207640_10006841
538 Ga0207703_10002182
539 Ga0207703_10002858
540 Ga0207703_10013633
541 Ga0207678_10013193
542 Ga0207708_10000796
543 Ga0207702_10000863
544 Ga0207702_10000888
545 Ga0207702_10001662
546 Ga0207702_10021215
547 Ga0207641_10000030
548 Ga0207641_10001205
549 Ga0207641_10002906
550 Ga0207648_10000031
551 Ga0207648_10025246
552 Ga0207676_10000915
553 Ga0207676_10005444
554 Ga0207676_10026732
555 Ga0207674_10000618
556 Ga0207674_10003082
557 Ga0207674_10006248
558 Ga0207683_10004439
559 Ga0209588_1000710
560 Ga0207428_10002253
561 Ga0268266_10000349
562 Ga0268266_10008045
563 Ga0268264_10016132
564 Ga0268264_10018263
565 Ga0265338_10012304
566 Ga0265760_10001140
567 Ga0265339_10006943
568 Ga0316577_10003495
569 Ga0373954_0000911
570 Ga0373943_0000235
571 Ga0373924_0011037
572 Ga0373935_0000363
573 Ga0373935_0018385
574 Ga0373927_0000635
575 Ga0373927_0010233
576 Ga0373947_0001002
577 Ga0373937_0000724
578 Ga0373937_0037696
579 Ga0373937_0062720
580 Ga0373925_0000661
581 Ga0373925_0000819
582 Ga0373925_0004968
583 Ga0395905_0003275
584 Ga0436364_0654010
585 Ga0436363_0563416
586 Ga0451577_0039887
587 Ga0453683_0011190
588 Ga0466967_0048688
589 Ga0495580_0000505
590 Ga0495580_0001138
591 Ga0495580_0001147
592 Ga0495580_0002743
593 Ga0495582_0003281
594 Ga0495582_0008287
595 Ga0495587_0000342
596 Ga0495667_0008423
597 Ga0495657_0001157
598 Ga0495623_0013879
599 Ga0495613_0005127
600 Ga0495613_0019987
601 Ga0495604_0001271
602 Ga0495674_0043363
603 Ga0495680_0044483
604 Ga0495684_0014336
605 Ga0495602_0005821
606 Ga0495602_0027295
607 Ga0496108_0002333
608 Ga0496109_0002662
609 Ga0496110_0003744
610 Ga0496110_0027431
611 Ga0496111_0003898
612 Ga0496112_0000077
613 Ga0496112_0003937
614 Ga0496112_0042564
615 Ga0496112_0044040
616 Ga0496112_0044619
617 Ga0496113_0000236
618 Ga0496115_0002840
619 Ga0501076_0030560
620 nmdc:mga05p37_116387_c1
621 nmdc:mga05p37_48875_c1
622 nmdc:mga05p37_6241_c1
623 nmdc:mga05p37_9618_c1
624 nmdc:mga08y16_1576_c1
625 nmdc:mga08y16_34639_c1
626 nmdc:mga0n895_116_c1
627 nmdc:mga0n895_15268_c1
628 nmdc:mga0n895_17620_c1
629 nmdc:mga0rr50_1633_c1
630 nmdc:mga0rr50_19079_c1
631 nmdc:mga0rr50_3562_c1
632 nmdc:mga0rr50_38723_c1
633 nmdc:mga08x19_2881_c1
634 nmdc:mga08x19_5899_c1
635 nmdc:mga08x19_7_c1
636 nmdc:mga0a205_35665_c1
637 nmdc:mga0a205_5707_c1
638 Ga0500616_0000132

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13181

TPR_8

Tetratricopeptide repeat

759

792

0.95

PF13432

TPR_16

Tetratricopeptide repeat

732

793

0.95

PF13432

TPR_16

Tetratricopeptide repeat

800

860

0.95

PF14559

TPR_19

Tetratricopeptide repeat

803

853

0.95

PF23914

723

863

0.94

PF13174

TPR_6

Tetratricopeptide repeat

795

826

0.87

PF13435

Cytochrome_C554

Cytochrome c554 and c-prime

200

284

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
2avp-assembly1.cif.gz_A crystal structure of an 8 repeat consensus tpr superhelix 0.975 781 842
2avp-assembly1.cif.gz_A crystal structure of an 8 repeat consensus tpr superhelix 0.8786 781 842
4cgq-assembly1.cif.gz_A full length tah1 bound to hsp90 peptide srmeevd 0.7493 778 861
6i7k-assembly1.cif.gz_A crystal structure of monomeric ficd mutant l258d complexed with mgatp 0.7294 779 861
3ma5-assembly1.cif.gz_A crystal structure of the tetratricopeptide repeat domain protein q2s6c5_salrd from salinibacter ruber. northeast structural genomics consortium target srr115c. 0.7202 778 862
ID Description Score Start End Superfamily
af_I1K2A6_492_569_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9749 777 840 1.25.40.10
af_Q58741_243_314_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9723 776 843 1.25.40.10
af_A4I5Y0_716_784_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9717 782 844 1.25.40.10
af_A4I5Y0_574_646_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9682 776 842 1.25.40.10
af_Q58741_243_314_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9072 776 843 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A2V9VGY4-F1-model_v4 Cytochrome c-552/4 domain-containing protein 0.9048 149 361
AF-A0A2V9VGY4-F1-model_v4 Cytochrome c-552/4 domain-containing protein 0.9008 149 361
AF-A0A7Y5LHV1-F1-model_v4 Tetratricopeptide repeat protein 0.8631 487 877 GO:0016020
AF-A0A2E8E1T1-F1-model_v4 Cytochrome c-552/4 domain-containing protein 0.862 143 884
AF-A0A831WY66-F1-model_v4 Tetratricopeptide repeat protein 0.8592 222 892

Map