F404239

General Info

Members Datasets Scaffolds Average Seq Length
317 166 634 186

Family's Representative Sequence

Representative Sequence 3300035116|Ga0373945_0058386|Ga0373945_0058386_18_674
Length 218
Sequence MGHPEICLLTSASPRRSLAAKFFYSGLVAKEAVMVPLAALWLPIVLSAVIVFVASSIMHMLLPYHRSDYQKLPDEDKVLAALRGVGLKRGLYVFPFCTHKDMKSPAAVEKYNQGPVGMMTILPSGPPVMPKFLGLWFGFCLIISFFVAYLAAHTVAQGAYYLVVFRVVGTAAFLAYGLANLSNSIWKGQTWSMTIKEVIDGLVFALLTAGTFGWLWPR

Samples

Sample ID Description Type Environment
1 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
65 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
90 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
93 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
94 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
95 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
96 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
97 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
98 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
99 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
100 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
101 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
102 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
103 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
104 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
105 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
106 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
107 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
108 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
109 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
110 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
112 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
113 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
116 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
117 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
118 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
119 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
120 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
121 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
122 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
123 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
124 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
125 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
126 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
127 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
128 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
129 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
130 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
131 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
132 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
133 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
134 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
135 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
136 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
137 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
138 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
139 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
140 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
141 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
142 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
143 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
144 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
145 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
146 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
147 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
148 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
149 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
150 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
154 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
155 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
156 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
159 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
160 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
161 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
162 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
163 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
164 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
165 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
166 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.05
Metatranscriptomes 0.95
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.79
Rhizosphere 95.58
Stem 0
Stem Tuber 0
Unclassified 21.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373945_0058386 3300035116 Bacteria 1435
2 rootL2_10105497 3300003322 Bacteria 3935
3 Ga0065712_10373799 3300005290 Bacteria 760
4 Ga0070658_10325076 3300005327 Bacteria 1314
5 Ga0070683_100269353 3300005329 Bacteria 1620
6 Ga0070690_100464832 3300005330 Unclassified 940
7 Ga0070666_10290124 3300005335 Bacteria 1164
8 Ga0070680_100165747 3300005336 Bacteria 1858
9 Ga0070680_101280360 3300005336 Bacteria 634
10 Ga0070682_100178052 3300005337 Bacteria 1483
11 Ga0070660_100283985 3300005339 Bacteria 1355
12 Ga0070671_100204822 3300005355 Bacteria 1673
13 Ga0070709_10001875 3300005434 Bacteria 11404
14 Ga0070709_10299087 3300005434 Bacteria 1175
15 Ga0070709_10459819 3300005434 Bacteria 960
16 Ga0070714_100006010 3300005435 Bacteria 9321
17 Ga0070714_100058806 3300005435 Bacteria 3295
18 Ga0070713_100000109 3300005436 Bacteria 53750
19 Ga0070713_100000110 3300005436 Bacteria 53669
20 Ga0070713_100037083 3300005436 Bacteria 3939
21 Ga0070713_100062813 3300005436 Bacteria 3112
22 Ga0070713_100087837 3300005436 Bacteria 2667
23 Ga0070713_100235173 3300005436 Bacteria 1667
24 Ga0070713_100395390 3300005436 Bacteria 1290
25 Ga0070713_100429270 3300005436 Unclassified 1238
26 Ga0070710_10014866 3300005437 Bacteria 3925
27 Ga0070710_10076913 3300005437 Bacteria 1938
28 Ga0070710_10167702 3300005437 Bacteria 1366
29 Ga0070710_10228563 3300005437 Bacteria 1187
30 Ga0070710_10933980 3300005437 Unclassified 628
31 Ga0070710_11074932 3300005437 Unclassified 590
32 Ga0070711_100007051 3300005439 Bacteria 6817
33 Ga0070711_100098779 3300005439 Bacteria 2120
34 Ga0070711_100182663 3300005439 Unclassified 1606
35 Ga0070711_100311326 3300005439 Bacteria 1255
36 Ga0070711_100933596 3300005439 Unclassified 742
37 Ga0070694_100011763 3300005444 Bacteria 5425
38 Ga0070708_100002913 3300005445 Bacteria 13302
39 Ga0070708_100062294 3300005445 Bacteria 3336
40 Ga0070708_100073162 3300005445 Unclassified 3089
41 Ga0070708_100448865 3300005445 Bacteria 1217
42 Ga0070708_100597966 3300005445 Unclassified 1040
43 Ga0070663_100325244 3300005455 Bacteria 1238
44 Ga0070662_100122358 3300005457 Bacteria 1996
45 Ga0070681_10075372 3300005458 Unclassified 3334
46 Ga0070681_10211819 3300005458 Bacteria 1854
47 Ga0070706_100016888 3300005467 Bacteria 6742
48 Ga0070706_100107474 3300005467 Bacteria 2596
49 Ga0070707_100153862 3300005468 Unclassified 2240
50 Ga0070707_100301841 3300005468 Bacteria 1556
51 Ga0070707_100706819 3300005468 Unclassified 971
52 Ga0070707_100996930 3300005468 Unclassified 803
53 Ga0070698_100787595 3300005471 Unclassified 894
54 Ga0070699_100041859 3300005518 Bacteria 3963
55 Ga0070699_100261495 3300005518 Bacteria 1548
56 Ga0070679_100652913 3300005530 Bacteria 995
57 Ga0070697_100013611 3300005536 Bacteria 6381
58 Ga0070697_100025707 3300005536 Bacteria 4697
59 Ga0070697_100058916 3300005536 Bacteria 3125
60 Ga0070697_100173929 3300005536 Bacteria 1823
61 Ga0070697_100303366 3300005536 Unclassified 1373
62 Ga0070697_100850302 3300005536 Bacteria 808
63 Ga0070697_101007489 3300005536 Unclassified 740
64 Ga0068853_100872716 3300005539 Bacteria 863
65 Ga0070695_100015061 3300005545 Bacteria 4667
66 Ga0070695_101056130 3300005545 Bacteria 663
67 Ga0070696_100000442 3300005546 Bacteria 25915
68 Ga0070693_100000117 3300005547 Bacteria 35823
69 Ga0070693_100157694 3300005547 Bacteria 1443
70 Ga0070664_100192894 3300005564 Bacteria 1815
71 Ga0068856_100424424 3300005614 Bacteria 1350
72 Ga0068851_10018466 3300005834 Bacteria 3359
73 Ga0068863_100321169 3300005841 Bacteria 1504
74 Ga0068858_100244770 3300005842 Unclassified 1702
75 Ga0070717_10001402 3300006028 Bacteria 16614
76 Ga0070717_10003449 3300006028 Bacteria 11316
77 Ga0070717_10016270 3300006028 Bacteria 5764
78 Ga0070717_10034943 3300006028 Bacteria 4065
79 Ga0070717_10134328 3300006028 Bacteria 2129
80 Ga0070715_10003600 3300006163 Unclassified 4965
81 Ga0070715_10008708 3300006163 Bacteria 3547
82 Ga0070716_100001327 3300006173 Bacteria 10947
83 Ga0070716_100001901 3300006173 Bacteria 9475
84 Ga0070716_100056461 3300006173 Bacteria 2251
85 Ga0070716_100071795 3300006173 Bacteria 2036
86 Ga0070716_100755284 3300006173 Bacteria 749
87 Ga0070712_100000360 3300006175 Bacteria 25802
88 Ga0070712_100000945 3300006175 Bacteria 17484
89 Ga0070712_100005160 3300006175 Bacteria 8079
90 Ga0070712_100078941 3300006175 Bacteria 2377
91 Ga0070712_100104823 3300006175 Bacteria 2099
92 Ga0070712_100120850 3300006175 Unclassified 1970
93 Ga0070712_100400258 3300006175 Unclassified 1134
94 Ga0070712_101117741 3300006175 Unclassified 684
95 Ga0097621_100001899 3300006237 Bacteria 14271
96 Ga0097621_100703782 3300006237 Bacteria 930
97 Ga0068871_100064149 3300006358 Bacteria 3007
98 Ga0068871_100433154 3300006358 Bacteria 1176
99 Ga0075433_10175458 3300006852 Bacteria 1907
100 Ga0075434_100001829 3300006871 Bacteria 18360
101 Ga0075436_100171422 3300006914 Bacteria 1532
102 Ga0075435_100135294 3300007076 Bacteria 2064
103 Ga0099794_10002501 3300007265 Bacteria 6792
104 Ga0099794_10015027 3300007265 Bacteria 3407
105 Ga0099794_10095553 3300007265 Bacteria 1479
106 Ga0099794_10203474 3300007265 Bacteria 1014
107 Ga0105245_10004187 3300009098 Bacteria 12816
108 Ga0105242_10211342 3300009176 Unclassified 1729
109 Ga0105248_10037727 3300009177 Bacteria 5407
110 Ga0105248_10137283 3300009177 Bacteria 2758
111 Ga0105248_11086642 3300009177 Unclassified 904
112 Ga0105237_10102244 3300009545 Bacteria 2857
113 Ga0105249_10292828 3300009553 Bacteria 1630
114 Ga0105239_10482300 3300010375 Bacteria 1409
115 Ga0157373_10064604 3300013100 Bacteria 2591
116 Ga0157370_10657319 3300013104 Bacteria 958
117 Ga0157374_10069880 3300013296 Unclassified 3307
118 Ga0157378_10000075 3300013297 Bacteria 90485
119 Ga0157378_10109844 3300013297 Bacteria 2526
120 Ga0163162_10002954 3300013306 Bacteria 16227
121 Ga0163162_10375601 3300013306 Bacteria 1555
122 Ga0163162_10401106 3300013306 Bacteria 1504
123 Ga0157372_11335883 3300013307 Bacteria 827
124 Ga0157375_11546575 3300013308 Bacteria 783
125 Ga0163163_10017513 3300014325 Bacteria 6683
126 Ga0163163_10267316 3300014325 Bacteria 1761
127 Ga0182008_10006705 3300014497 Bacteria 6411
128 Ga0157379_10561982 3300014968 Unclassified 1062
129 Ga0157379_11377031 3300014968 Unclassified 683
130 Ga0228598_1000239 3300024227 Bacteria 10526
131 Ga0207653_10016761 3300025885 Bacteria 2302
132 Ga0207692_10084383 3300025898 Bacteria 1706
133 Ga0207685_10013730 3300025905 Unclassified 2514
134 Ga0207685_10089253 3300025905 Bacteria 1294
135 Ga0207685_10193649 3300025905 Bacteria 950
136 Ga0207699_10004252 3300025906 Bacteria 6853
137 Ga0207699_10005961 3300025906 Bacteria 5866
138 Ga0207699_10280483 3300025906 Bacteria 1158
139 Ga0207699_10386062 3300025906 Bacteria 995
140 Ga0207699_10433318 3300025906 Bacteria 941
141 Ga0207684_10030862 3300025910 Bacteria 4561
142 Ga0207684_10114180 3300025910 Bacteria 2313
143 Ga0207684_10314310 3300025910 Bacteria 1350
144 Ga0207707_10302813 3300025912 Bacteria 1382
145 Ga0207707_10424865 3300025912 Unclassified 1139
146 Ga0207693_10000022 3300025915 Bacteria 127887
147 Ga0207693_10000086 3300025915 Bacteria 83565
148 Ga0207693_10001907 3300025915 Bacteria 18247
149 Ga0207693_10006307 3300025915 Bacteria 9836
150 Ga0207693_10061373 3300025915 Bacteria 2944
151 Ga0207693_10083008 3300025915 Bacteria 2509
152 Ga0207693_10125202 3300025915 Bacteria 2019
153 Ga0207693_10820784 3300025915 Unclassified 716
154 Ga0207663_10022181 3300025916 Bacteria 3626
155 Ga0207663_10030747 3300025916 Bacteria 3170
156 Ga0207663_10711120 3300025916 Bacteria 796
157 Ga0207663_10802347 3300025916 Unclassified 750
158 Ga0207657_10001110 3300025919 Bacteria 28585
159 Ga0207652_10008857 3300025921 Bacteria 8106
160 Ga0207652_10198281 3300025921 Bacteria 1806
161 Ga0207646_10166142 3300025922 Unclassified 1992
162 Ga0207646_10171274 3300025922 Bacteria 1960
163 Ga0207646_10180683 3300025922 Bacteria 1905
164 Ga0207646_10747355 3300025922 Unclassified 873
165 Ga0207687_10158603 3300025927 Unclassified 1734
166 Ga0207700_10002128 3300025928 Bacteria 11327
167 Ga0207700_10035567 3300025928 Bacteria 3589
168 Ga0207700_10036508 3300025928 Bacteria 3550
169 Ga0207700_10057217 3300025928 Bacteria 2939
170 Ga0207700_10069932 3300025928 Bacteria 2696
171 Ga0207664_10000201 3300025929 Bacteria 44962
172 Ga0207664_10002500 3300025929 Bacteria 12177
173 Ga0207664_10381681 3300025929 Bacteria 1251
174 Ga0207664_11089941 3300025929 Unclassified 714
175 Ga0207644_10175560 3300025931 Bacteria 1676
176 Ga0207706_10198171 3300025933 Bacteria 1761
177 Ga0207686_10067895 3300025934 Unclassified 2282
178 Ga0207665_10000047 3300025939 Bacteria 76975
179 Ga0207665_10003282 3300025939 Bacteria 10837
180 Ga0207665_10168617 3300025939 Bacteria 1579
181 Ga0207665_10566748 3300025939 Unclassified 884
182 Ga0207711_10339121 3300025941 Bacteria 1391
183 Ga0207679_10288671 3300025945 Bacteria 1409
184 Ga0207679_10869036 3300025945 Bacteria 824
185 Ga0207703_10022605 3300026035 Bacteria 4935
186 Ga0207639_10570158 3300026041 Bacteria 1041
187 Ga0207678_10369561 3300026067 Bacteria 1239
188 Ga0209588_1000388 3300027671 Bacteria 11430
189 Ga0209588_1064287 3300027671 Bacteria 1186
190 Ga0209588_1107276 3300027671 Unclassified 898
191 Ga0265338_10000716 3300028800 Bacteria 56718
192 Ga0265338_10058315 3300028800 Bacteria 3409
193 Ga0265338_10179886 3300028800 Bacteria 1613
194 Ga0265338_10236433 3300028800 Bacteria 1356
195 Ga0265762_1045855 3300030760 Bacteria 866
196 Ga0265760_10026124 3300031090 Unclassified 1707
197 Ga0265760_10028802 3300031090 Bacteria 1631
198 Ga0265328_10022622 3300031239 Unclassified 2390
199 Ga0265328_10182926 3300031239 Bacteria 793
200 Ga0265325_10000946 3300031241 Bacteria 20993
201 Ga0265325_10062349 3300031241 Bacteria 1889
202 Ga0265329_10107187 3300031242 Unclassified 892
203 Ga0265340_10007840 3300031247 Bacteria 5792
204 Ga0265339_10015978 3300031249 Unclassified 4486
205 Ga0265339_10260531 3300031249 Bacteria 836
206 Ga0265339_10270194 3300031249 Bacteria 818
207 Ga0265331_10005407 3300031250 Bacteria 7719
208 Ga0265316_10022717 3300031344 Bacteria 5281
209 Ga0265316_10057647 3300031344 Bacteria 3028
210 Ga0265316_10293559 3300031344 Bacteria 1185
211 Ga0265316_10356113 3300031344 Unclassified 1059
212 Ga0265313_10069219 3300031595 Unclassified 1628
213 Ga0265314_10061749 3300031711 Bacteria 2550
214 Ga0373934_0038483 3300035086 Bacteria 1884
215 Ga0373944_0025462 3300035089 Bacteria 1742
216 Ga0373923_0016774 3300035111 Unclassified 2790
217 Ga0373923_0142678 3300035111 Bacteria 1083
218 Ga0373923_0274848 3300035111 Bacteria 793
219 Ga0373936_0001489 3300035113 Bacteria 8494
220 Ga0373936_0030351 3300035113 Unclassified 2131
221 Ga0373945_0018022 3300035116 Unclassified 2399
222 Ga0373954_0012006 3300035118 Unclassified 3848
223 Ga0373954_0031142 3300035118 Bacteria 2461
224 Ga0373956_0084029 3300035119 Bacteria 1463
225 Ga0373956_0150053 3300035119 Bacteria 1097
226 Ga0373943_0000011 3300035170 Bacteria 64439
227 Ga0373946_0002331 3300035171 Bacteria 6710
228 Ga0373946_0046819 3300035171 Bacteria 1794
229 Ga0373955_0006845 3300035172 Bacteria 5211
230 Ga0373955_0062919 3300035172 Unclassified 2053
231 Ga0373955_0116116 3300035172 Bacteria 1551
232 Ga0373955_0351488 3300035172 Unclassified 893
233 Ga0373935_0001208 3300035692 Bacteria 14238
234 Ga0373935_0010834 3300035692 Bacteria 5477
235 Ga0373935_0658550 3300035692 Unclassified 768
236 Ga0373935_0977632 3300035692 Unclassified 628
237 Ga0373927_0001948 3300035695 Bacteria 15254
238 Ga0373927_0113131 3300035695 Bacteria 1769
239 Ga0373933_0000398 3300035724 Bacteria 27554
240 Ga0373933_0399433 3300035724 Unclassified 896
241 Ga0373947_0000852 3300035725 Bacteria 18414
242 Ga0373947_0021324 3300035725 Bacteria 3749
243 Ga0373947_0033293 3300035725 Bacteria 3041
244 Ga0373947_0397680 3300035725 Bacteria 929
245 Ga0373937_0000768 3300036401 Bacteria 27730
246 Ga0373937_0147009 3300036401 Bacteria 2207
247 Ga0373925_0000204 3300037068 Bacteria 64701
248 Ga0373925_0022133 3300037068 Bacteria 4634
249 Ga0373925_0042264 3300037068 Bacteria 3381
250 Ga0373925_0167565 3300037068 Bacteria 1733
251 Ga0373925_0458639 3300037068 Unclassified 1044
252 Ga0436360_0944585 3300039438 Unclassified 713
253 Ga0436363_1558357 3300039450 Bacteria 2939
254 Ga0451577_0090159 3300042876 Bacteria 2736
255 Ga0453683_0032990 3300044673 Bacteria 3265
256 Ga0466964_0102125 3300044706 Bacteria 1266
257 Ga0466957_0508308 3300044842 Unclassified 836
258 Ga0495592_0356683 3300046454 Unclassified 936
259 Ga0495629_0043178 3300046459 Bacteria 3167
260 Ga0495629_0440563 3300046459 Unclassified 883
261 Ga0495651_0018817 3300046462 Bacteria 5350
262 Ga0495653_0036432 3300046463 Unclassified 3875
263 Ga0495653_0307421 3300046463 Bacteria 1032
264 Ga0495580_0000418 3300046472 Bacteria 35302
265 Ga0495580_0000877 3300046472 Bacteria 26059
266 Ga0495580_0012870 3300046472 Bacteria 6410
267 Ga0495580_0065341 3300046472 Bacteria 2548
268 Ga0495580_0187314 3300046472 Bacteria 1428
269 Ga0495580_0200187 3300046472 Unclassified 1376
270 Ga0495580_0476009 3300046472 Unclassified 836
271 Ga0495582_0000908 3300046473 Bacteria 16483
272 Ga0495639_0064119 3300046475 Unclassified 1688
273 Ga0495664_0066914 3300046477 Unclassified 2143
274 Ga0495630_0165303 3300046517 Bacteria 1685
275 Ga0495666_0111923 3300046526 Bacteria 1282
276 Ga0495652_0332953 3300046529 Bacteria 1093
277 Ga0495665_0209882 3300046531 Unclassified 1008
278 Ga0495640_0079144 3300046533 Bacteria 2189
279 Ga0495586_0063801 3300046535 Bacteria 2007
280 Ga0495587_0000757 3300046536 Bacteria 21550
281 Ga0495645_0123950 3300046543 Bacteria 1817
282 Ga0495645_0314294 3300046543 Unclassified 1019
283 Ga0495667_0296289 3300046559 Bacteria 1025
284 Ga0495635_0024090 3300046663 Unclassified 4243
285 Ga0495659_0147308 3300046664 Bacteria 943
286 Ga0495657_0657324 3300046675 Unclassified 604
287 Ga0495599_0108261 3300046678 Bacteria 1732
288 Ga0495624_0126108 3300046690 Bacteria 1571
289 Ga0495581_0011359 3300047315 Bacteria 5153
290 Ga0495604_0000644 3300047317 Bacteria 29869
291 Ga0495674_0013256 3300047319 Bacteria 7751
292 Ga0495674_0018678 3300047319 Bacteria 6452
293 Ga0495674_0333340 3300047319 Bacteria 1234
294 Ga0495674_1052719 3300047319 Unclassified 621
295 Ga0495684_0041515 3300047471 Bacteria 3526
296 Ga0495602_0030727 3300048088 Bacteria 5090
297 Ga0495602_0346902 3300048088 Bacteria 1072
298 Ga0496100_0165824 3300048903 Bacteria 1587
299 Ga0496101_0975655 3300048904 Bacteria 667
300 Ga0496104_0042606 3300048907 Bacteria 4261
301 Ga0496106_0030411 3300048909 Bacteria 4028
302 Ga0496107_0112714 3300048910 Bacteria 2000
303 Ga0496108_0312628 3300048911 Bacteria 1369
304 Ga0496110_0015936 3300048913 Bacteria 6269
305 Ga0496111_0092768 3300048914 Bacteria 2213
306 Ga0496112_0233725 3300048915 Bacteria 1792
307 Ga0496112_0591780 3300048915 Bacteria 1041
308 Ga0496115_0003550 3300048918 Bacteria 11223
309 Ga0496115_0179641 3300048918 Bacteria 1750
310 Ga0501081_0289911 3300049743 Bacteria 1199
311 nmdc:mga0n895_27319_c1 3300050512 Bacteria 5420
312 nmdc:mga0rr50_193546_c1 3300050513 Bacteria 1668
313 nmdc:mga08x19_171269_c1 3300050514 Bacteria 1479
314 nmdc:mga0a205_191350_c1 3300050515 Bacteria 1938
315 Ga0495601_0063989 3300053077 Bacteria 2338
316 Ga0495612_0178402 3300053078 Unclassified 932
317 Ga0495619_0057824 3300053085 Bacteria 2573
318 Ga0373945_0058386
319 rootL2_10105497
320 Ga0065712_10373799
321 Ga0070658_10325076
322 Ga0070683_100269353
323 Ga0070690_100464832
324 Ga0070666_10290124
325 Ga0070680_100165747
326 Ga0070680_101280360
327 Ga0070682_100178052
328 Ga0070660_100283985
329 Ga0070671_100204822
330 Ga0070709_10001875
331 Ga0070709_10299087
332 Ga0070709_10459819
333 Ga0070714_100006010
334 Ga0070714_100058806
335 Ga0070713_100000109
336 Ga0070713_100000110
337 Ga0070713_100037083
338 Ga0070713_100062813
339 Ga0070713_100087837
340 Ga0070713_100235173
341 Ga0070713_100395390
342 Ga0070713_100429270
343 Ga0070710_10014866
344 Ga0070710_10076913
345 Ga0070710_10167702
346 Ga0070710_10228563
347 Ga0070710_10933980
348 Ga0070710_11074932
349 Ga0070711_100007051
350 Ga0070711_100098779
351 Ga0070711_100182663
352 Ga0070711_100311326
353 Ga0070711_100933596
354 Ga0070694_100011763
355 Ga0070708_100002913
356 Ga0070708_100062294
357 Ga0070708_100073162
358 Ga0070708_100448865
359 Ga0070708_100597966
360 Ga0070663_100325244
361 Ga0070662_100122358
362 Ga0070681_10075372
363 Ga0070681_10211819
364 Ga0070706_100016888
365 Ga0070706_100107474
366 Ga0070707_100153862
367 Ga0070707_100301841
368 Ga0070707_100706819
369 Ga0070707_100996930
370 Ga0070698_100787595
371 Ga0070699_100041859
372 Ga0070699_100261495
373 Ga0070679_100652913
374 Ga0070697_100013611
375 Ga0070697_100025707
376 Ga0070697_100058916
377 Ga0070697_100173929
378 Ga0070697_100303366
379 Ga0070697_100850302
380 Ga0070697_101007489
381 Ga0068853_100872716
382 Ga0070695_100015061
383 Ga0070695_101056130
384 Ga0070696_100000442
385 Ga0070693_100000117
386 Ga0070693_100157694
387 Ga0070664_100192894
388 Ga0068856_100424424
389 Ga0068851_10018466
390 Ga0068863_100321169
391 Ga0068858_100244770
392 Ga0070717_10001402
393 Ga0070717_10003449
394 Ga0070717_10016270
395 Ga0070717_10034943
396 Ga0070717_10134328
397 Ga0070715_10003600
398 Ga0070715_10008708
399 Ga0070716_100001327
400 Ga0070716_100001901
401 Ga0070716_100056461
402 Ga0070716_100071795
403 Ga0070716_100755284
404 Ga0070712_100000360
405 Ga0070712_100000945
406 Ga0070712_100005160
407 Ga0070712_100078941
408 Ga0070712_100104823
409 Ga0070712_100120850
410 Ga0070712_100400258
411 Ga0070712_101117741
412 Ga0097621_100001899
413 Ga0097621_100703782
414 Ga0068871_100064149
415 Ga0068871_100433154
416 Ga0075433_10175458
417 Ga0075434_100001829
418 Ga0075436_100171422
419 Ga0075435_100135294
420 Ga0099794_10002501
421 Ga0099794_10015027
422 Ga0099794_10095553
423 Ga0099794_10203474
424 Ga0105245_10004187
425 Ga0105242_10211342
426 Ga0105248_10037727
427 Ga0105248_10137283
428 Ga0105248_11086642
429 Ga0105237_10102244
430 Ga0105249_10292828
431 Ga0105239_10482300
432 Ga0157373_10064604
433 Ga0157370_10657319
434 Ga0157374_10069880
435 Ga0157378_10000075
436 Ga0157378_10109844
437 Ga0163162_10002954
438 Ga0163162_10375601
439 Ga0163162_10401106
440 Ga0157372_11335883
441 Ga0157375_11546575
442 Ga0163163_10017513
443 Ga0163163_10267316
444 Ga0182008_10006705
445 Ga0157379_10561982
446 Ga0157379_11377031
447 Ga0228598_1000239
448 Ga0207653_10016761
449 Ga0207692_10084383
450 Ga0207685_10013730
451 Ga0207685_10089253
452 Ga0207685_10193649
453 Ga0207699_10004252
454 Ga0207699_10005961
455 Ga0207699_10280483
456 Ga0207699_10386062
457 Ga0207699_10433318
458 Ga0207684_10030862
459 Ga0207684_10114180
460 Ga0207684_10314310
461 Ga0207707_10302813
462 Ga0207707_10424865
463 Ga0207693_10000022
464 Ga0207693_10000086
465 Ga0207693_10001907
466 Ga0207693_10006307
467 Ga0207693_10061373
468 Ga0207693_10083008
469 Ga0207693_10125202
470 Ga0207693_10820784
471 Ga0207663_10022181
472 Ga0207663_10030747
473 Ga0207663_10711120
474 Ga0207663_10802347
475 Ga0207657_10001110
476 Ga0207652_10008857
477 Ga0207652_10198281
478 Ga0207646_10166142
479 Ga0207646_10171274
480 Ga0207646_10180683
481 Ga0207646_10747355
482 Ga0207687_10158603
483 Ga0207700_10002128
484 Ga0207700_10035567
485 Ga0207700_10036508
486 Ga0207700_10057217
487 Ga0207700_10069932
488 Ga0207664_10000201
489 Ga0207664_10002500
490 Ga0207664_10381681
491 Ga0207664_11089941
492 Ga0207644_10175560
493 Ga0207706_10198171
494 Ga0207686_10067895
495 Ga0207665_10000047
496 Ga0207665_10003282
497 Ga0207665_10168617
498 Ga0207665_10566748
499 Ga0207711_10339121
500 Ga0207679_10288671
501 Ga0207679_10869036
502 Ga0207703_10022605
503 Ga0207639_10570158
504 Ga0207678_10369561
505 Ga0209588_1000388
506 Ga0209588_1064287
507 Ga0209588_1107276
508 Ga0265338_10000716
509 Ga0265338_10058315
510 Ga0265338_10179886
511 Ga0265338_10236433
512 Ga0265762_1045855
513 Ga0265760_10026124
514 Ga0265760_10028802
515 Ga0265328_10022622
516 Ga0265328_10182926
517 Ga0265325_10000946
518 Ga0265325_10062349
519 Ga0265329_10107187
520 Ga0265340_10007840
521 Ga0265339_10015978
522 Ga0265339_10260531
523 Ga0265339_10270194
524 Ga0265331_10005407
525 Ga0265316_10022717
526 Ga0265316_10057647
527 Ga0265316_10293559
528 Ga0265316_10356113
529 Ga0265313_10069219
530 Ga0265314_10061749
531 Ga0373934_0038483
532 Ga0373944_0025462
533 Ga0373923_0016774
534 Ga0373923_0142678
535 Ga0373923_0274848
536 Ga0373936_0001489
537 Ga0373936_0030351
538 Ga0373945_0018022
539 Ga0373954_0012006
540 Ga0373954_0031142
541 Ga0373956_0084029
542 Ga0373956_0150053
543 Ga0373943_0000011
544 Ga0373946_0002331
545 Ga0373946_0046819
546 Ga0373955_0006845
547 Ga0373955_0062919
548 Ga0373955_0116116
549 Ga0373955_0351488
550 Ga0373935_0001208
551 Ga0373935_0010834
552 Ga0373935_0658550
553 Ga0373935_0977632
554 Ga0373927_0001948
555 Ga0373927_0113131
556 Ga0373933_0000398
557 Ga0373933_0399433
558 Ga0373947_0000852
559 Ga0373947_0021324
560 Ga0373947_0033293
561 Ga0373947_0397680
562 Ga0373937_0000768
563 Ga0373937_0147009
564 Ga0373925_0000204
565 Ga0373925_0022133
566 Ga0373925_0042264
567 Ga0373925_0167565
568 Ga0373925_0458639
569 Ga0436360_0944585
570 Ga0436363_1558357
571 Ga0451577_0090159
572 Ga0453683_0032990
573 Ga0466964_0102125
574 Ga0466957_0508308
575 Ga0495592_0356683
576 Ga0495629_0043178
577 Ga0495629_0440563
578 Ga0495651_0018817
579 Ga0495653_0036432
580 Ga0495653_0307421
581 Ga0495580_0000418
582 Ga0495580_0000877
583 Ga0495580_0012870
584 Ga0495580_0065341
585 Ga0495580_0187314
586 Ga0495580_0200187
587 Ga0495580_0476009
588 Ga0495582_0000908
589 Ga0495639_0064119
590 Ga0495664_0066914
591 Ga0495630_0165303
592 Ga0495666_0111923
593 Ga0495652_0332953
594 Ga0495665_0209882
595 Ga0495640_0079144
596 Ga0495586_0063801
597 Ga0495587_0000757
598 Ga0495645_0123950
599 Ga0495645_0314294
600 Ga0495667_0296289
601 Ga0495635_0024090
602 Ga0495659_0147308
603 Ga0495657_0657324
604 Ga0495599_0108261
605 Ga0495624_0126108
606 Ga0495581_0011359
607 Ga0495604_0000644
608 Ga0495674_0013256
609 Ga0495674_0018678
610 Ga0495674_0333340
611 Ga0495674_1052719
612 Ga0495684_0041515
613 Ga0495602_0030727
614 Ga0495602_0346902
615 Ga0496100_0165824
616 Ga0496101_0975655
617 Ga0496104_0042606
618 Ga0496106_0030411
619 Ga0496107_0112714
620 Ga0496108_0312628
621 Ga0496110_0015936
622 Ga0496111_0092768
623 Ga0496112_0233725
624 Ga0496112_0591780
625 Ga0496115_0003550
626 Ga0496115_0179641
627 Ga0501081_0289911
628 nmdc:mga0n895_27319_c1
629 nmdc:mga0rr50_193546_c1
630 nmdc:mga08x19_171269_c1
631 nmdc:mga0a205_191350_c1
632 Ga0495601_0063989
633 Ga0495612_0178402
634 Ga0495619_0057824

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ssf-assembly1.cif.gz_B-2 minimal protein-only/rna-free ribonuclease p from hydrogenobacter thermophilus 0.6789 123 182
5gpn-assembly1.cif.gz_Ag architecture of mammalian respirasome 0.3839 95 179
5gup-assembly1.cif.gz_V cryo-em structure of mammalian respiratory supercomplex i1iii2iv1 0.3839 95 179
7ard-assembly1.cif.gz_Y cryo-em structure of polytomella complex-i (complete composition) 0.3532 77 179
8gym-assembly1.cif.gz_an cryo-em structure of tetrahymena thermophila respiratory mega-complex mc iv2+(i+iii2+ii)2 0.3392 7 179
ID Description Score Start End Superfamily
af_Q9UTI9_1_148_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6125 13 187 1.20.120.550
af_Q9UTI9_1_148_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.5596 13 187 1.20.120.550
af_M0R3Q7_294_502_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.5 95 183 1.20.1640.10
af_P9WJV5_157_342_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.4997 94 184 1.20.1640.10
af_Q4CTM5_105_403_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.483 94 182 1.50.40.10
ID Description Score Start End GO Terms
AF-A0A2V9HW22-F1-model_v4 DUF1761 domain-containing protein 0.9853 4 187 GO:0016020
AF-A0A534A3M3-F1-model_v4 Uncharacterized protein 0.9809 99 187 GO:0016020
AF-A0A2V9WBD2-F1-model_v4 DUF1761 domain-containing protein 0.9802 3 187 GO:0016020
AF-A0A2V7PV38-F1-model_v4 Uncharacterized protein 0.9794 88 187 GO:0016020
AF-A0A3M2ALE6-F1-model_v4 DUF1761 domain-containing protein 0.9787 9 187 GO:0016020

Map