F403586
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 316 | 193 | 316 | 132 |
Family's Representative Sequence
| Representative Sequence | 3300005618|Ga0068864_100000178|Ga0068864_10000017815 |
| Length | 143 |
| Sequence | VTEDAAATAPVPSLAEATTWIGFGVDDVTGSRLGRVHGLFADAGGEPAWLTVALRRRFSLFGRRAATLVVLPLRDCAAAAGRVWTAHAGDVVRAAPTVDPTRPLLREHELTICAHYGISERVGRAAEVLGRPRGAVTAPPAGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 43 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 44 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 45 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 46 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 47 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 48 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 51 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 52 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 53 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 60 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 73 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 74 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 117 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 118 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 119 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 120 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 121 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 122 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 123 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 164 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 165 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 166 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 167 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 168 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 169 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 170 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 171 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 172 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 173 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 174 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 175 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 176 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 177 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 178 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 180 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 182 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 183 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 193 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.37 |
| Metatranscriptomes | 0.63 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.63 |
| Nodule | 0 |
| Rhizoplane | 9.49 |
| Rhizosphere | 88.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.95 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10111100 | 3300003320 | Bacteria | 1569 |
| 2 | Ga0070683_100000501 | 3300005329 | Bacteria | 27619 |
| 3 | Ga0070683_100003289 | 3300005329 | Bacteria | 13064 |
| 4 | Ga0070683_100250599 | 3300005329 | Bacteria | 1684 |
| 5 | Ga0070683_100494267 | 3300005329 | Bacteria | 1168 |
| 6 | Ga0070683_101139667 | 3300005329 | Unclassified | 749 |
| 7 | Ga0070690_100125247 | 3300005330 | Bacteria | 1729 |
| 8 | Ga0068869_101014645 | 3300005334 | Unclassified | 723 |
| 9 | Ga0070666_10043488 | 3300005335 | Bacteria | 3009 |
| 10 | Ga0070682_100000421 | 3300005337 | Bacteria | 27464 |
| 11 | Ga0070682_100108898 | 3300005337 | Bacteria | 1843 |
| 12 | Ga0068868_100004331 | 3300005338 | Bacteria | 9949 |
| 13 | Ga0068868_100004773 | 3300005338 | Bacteria | 9518 |
| 14 | Ga0070689_101860831 | 3300005340 | Bacteria | 549 |
| 15 | Ga0070691_10004831 | 3300005341 | Bacteria | 6134 |
| 16 | Ga0070661_100000599 | 3300005344 | Bacteria | 26985 |
| 17 | Ga0070661_100279133 | 3300005344 | Bacteria | 1295 |
| 18 | Ga0070692_10207136 | 3300005345 | Bacteria | 1152 |
| 19 | Ga0070668_101092727 | 3300005347 | Unclassified | 720 |
| 20 | Ga0070675_100000053 | 3300005354 | Bacteria | 70601 |
| 21 | Ga0070674_100040199 | 3300005356 | Bacteria | 3163 |
| 22 | Ga0070688_100000012 | 3300005365 | Bacteria | 79406 |
| 23 | Ga0070688_100000269 | 3300005365 | Bacteria | 26936 |
| 24 | Ga0070688_100432164 | 3300005365 | Bacteria | 981 |
| 25 | Ga0070659_100059978 | 3300005366 | Bacteria | 3005 |
| 26 | Ga0070667_100089153 | 3300005367 | Bacteria | 2649 |
| 27 | Ga0070667_100097835 | 3300005367 | Bacteria | 2532 |
| 28 | Ga0070667_100896334 | 3300005367 | Bacteria | 825 |
| 29 | Ga0070703_10061409 | 3300005406 | Bacteria | 1231 |
| 30 | Ga0070714_100114839 | 3300005435 | Bacteria | 2389 |
| 31 | Ga0070714_100497073 | 3300005435 | Bacteria | 1163 |
| 32 | Ga0070714_101152782 | 3300005435 | Unclassified | 756 |
| 33 | Ga0070713_100000009 | 3300005436 | Bacteria | 153056 |
| 34 | Ga0070710_10396653 | 3300005437 | Bacteria | 924 |
| 35 | Ga0070711_100032239 | 3300005439 | Bacteria | 3483 |
| 36 | Ga0070711_101217331 | 3300005439 | Unclassified | 652 |
| 37 | Ga0070700_100143604 | 3300005441 | Bacteria | 1625 |
| 38 | Ga0070708_101161318 | 3300005445 | Bacteria | 723 |
| 39 | Ga0070663_100080494 | 3300005455 | Bacteria | 2392 |
| 40 | Ga0070663_100990936 | 3300005455 | Unclassified | 730 |
| 41 | Ga0070678_100013493 | 3300005456 | Bacteria | 5126 |
| 42 | Ga0070678_100154478 | 3300005456 | Bacteria | 1852 |
| 43 | Ga0070662_100000007 | 3300005457 | Bacteria | 168761 |
| 44 | Ga0068867_100006976 | 3300005459 | Bacteria | 7985 |
| 45 | Ga0070685_10000018 | 3300005466 | Bacteria | 110132 |
| 46 | Ga0070685_10000142 | 3300005466 | Bacteria | 46324 |
| 47 | Ga0070684_100021244 | 3300005535 | Bacteria | 5397 |
| 48 | Ga0070684_100094433 | 3300005535 | Bacteria | 2664 |
| 49 | Ga0070684_100349078 | 3300005535 | Bacteria | 1361 |
| 50 | Ga0070684_101884181 | 3300005535 | Bacteria | 564 |
| 51 | Ga0068853_100479025 | 3300005539 | Bacteria | 1173 |
| 52 | Ga0068853_100577507 | 3300005539 | Bacteria | 1066 |
| 53 | Ga0070672_100000030 | 3300005543 | Bacteria | 62612 |
| 54 | Ga0070695_100341647 | 3300005545 | Bacteria | 1119 |
| 55 | Ga0070693_100003779 | 3300005547 | Bacteria | 7085 |
| 56 | Ga0070665_100001190 | 3300005548 | Bacteria | 31771 |
| 57 | Ga0070665_100074455 | 3300005548 | Bacteria | 3402 |
| 58 | Ga0068855_100279893 | 3300005563 | Bacteria | 1853 |
| 59 | Ga0070664_100027503 | 3300005564 | Bacteria | 4727 |
| 60 | Ga0070664_100042879 | 3300005564 | Bacteria | 3818 |
| 61 | Ga0068854_100000031 | 3300005578 | Bacteria | 107298 |
| 62 | Ga0068856_100002986 | 3300005614 | Bacteria | 17301 |
| 63 | Ga0068856_100015030 | 3300005614 | Bacteria | 7475 |
| 64 | Ga0068852_100000012 | 3300005616 | Bacteria | 140734 |
| 65 | Ga0068864_100000178 | 3300005618 | Bacteria | 58416 |
| 66 | Ga0068866_10000001 | 3300005718 | Bacteria | 519680 |
| 67 | Ga0068866_10094719 | 3300005718 | Bacteria | 1634 |
| 68 | Ga0068861_100174641 | 3300005719 | Bacteria | 1783 |
| 69 | Ga0068861_100373323 | 3300005719 | Bacteria | 1258 |
| 70 | Ga0068851_10001764 | 3300005834 | Bacteria | 9453 |
| 71 | Ga0068851_10153145 | 3300005834 | Bacteria | 1262 |
| 72 | Ga0068870_10119676 | 3300005840 | Bacteria | 1515 |
| 73 | Ga0081540_1000006 | 3300005983 | Bacteria | 208724 |
| 74 | Ga0081539_10001003 | 3300005985 | Bacteria | 52435 |
| 75 | Ga0070712_100001362 | 3300006175 | Bacteria | 14813 |
| 76 | Ga0097621_100200576 | 3300006237 | Bacteria | 1732 |
| 77 | Ga0068865_100007743 | 3300006881 | Bacteria | 6621 |
| 78 | Ga0068865_101885431 | 3300006881 | Unclassified | 541 |
| 79 | Ga0075436_100301226 | 3300006914 | Bacteria | 1149 |
| 80 | Ga0075435_100235135 | 3300007076 | Bacteria | 1557 |
| 81 | Ga0105245_10000180 | 3300009098 | Bacteria | 59695 |
| 82 | Ga0105245_10014301 | 3300009098 | Bacteria | 6917 |
| 83 | Ga0105247_10060828 | 3300009101 | Bacteria | 2341 |
| 84 | Ga0105243_10010482 | 3300009148 | Bacteria | 7038 |
| 85 | Ga0105242_10000132 | 3300009176 | Bacteria | 54347 |
| 86 | Ga0105242_11034070 | 3300009176 | Bacteria | 831 |
| 87 | Ga0105248_10000032 | 3300009177 | Bacteria | 201114 |
| 88 | Ga0105248_11970455 | 3300009177 | Unclassified | 663 |
| 89 | Ga0105239_10461868 | 3300010375 | Unclassified | 1441 |
| 90 | Ga0105239_10564520 | 3300010375 | Bacteria | 1297 |
| 91 | Ga0105239_11068644 | 3300010375 | Bacteria | 929 |
| 92 | Ga0157338_1010387 | 3300012515 | Bacteria | 939 |
| 93 | Ga0157371_10013940 | 3300013102 | Bacteria | 6088 |
| 94 | Ga0157370_10022277 | 3300013104 | Bacteria | 6305 |
| 95 | Ga0157370_10245822 | 3300013104 | Bacteria | 1655 |
| 96 | Ga0157369_10000142 | 3300013105 | Bacteria | 101760 |
| 97 | Ga0157374_10001471 | 3300013296 | Bacteria | 19884 |
| 98 | Ga0157378_10002558 | 3300013297 | Bacteria | 16176 |
| 99 | Ga0163162_11011880 | 3300013306 | Unclassified | 940 |
| 100 | Ga0157372_10000308 | 3300013307 | Bacteria | 54161 |
| 101 | Ga0157375_10005331 | 3300013308 | Bacteria | 11173 |
| 102 | Ga0157375_10168413 | 3300013308 | Bacteria | 2337 |
| 103 | Ga0157375_13531519 | 3300013308 | Bacteria | 520 |
| 104 | Ga0163163_10273026 | 3300014325 | Bacteria | 1742 |
| 105 | Ga0163163_12550092 | 3300014325 | Bacteria | 569 |
| 106 | Ga0157380_10000059 | 3300014326 | Bacteria | 62280 |
| 107 | Ga0157380_10000158 | 3300014326 | Bacteria | 39132 |
| 108 | Ga0157379_10142539 | 3300014968 | Bacteria | 2160 |
| 109 | Ga0163161_10010179 | 3300017792 | Bacteria | 6510 |
| 110 | Ga0206354_10274000 | 3300020081 | Unclassified | 562 |
| 111 | Ga0206353_11095854 | 3300020082 | Bacteria | 1249 |
| 112 | Ga0207656_10000321 | 3300025321 | Bacteria | 16492 |
| 113 | Ga0207656_10086999 | 3300025321 | Bacteria | 1413 |
| 114 | Ga0207642_10000006 | 3300025899 | Bacteria | 230268 |
| 115 | Ga0207642_10000007 | 3300025899 | Bacteria | 226017 |
| 116 | Ga0207642_10020993 | 3300025899 | Bacteria | 2562 |
| 117 | Ga0207710_10036674 | 3300025900 | Bacteria | 2162 |
| 118 | Ga0207680_10010817 | 3300025903 | Bacteria | 4581 |
| 119 | Ga0207685_10000011 | 3300025905 | Bacteria | 213430 |
| 120 | Ga0207643_10027450 | 3300025908 | Bacteria | 3156 |
| 121 | Ga0207693_10007556 | 3300025915 | Bacteria | 8932 |
| 122 | Ga0207663_10000683 | 3300025916 | Bacteria | 15043 |
| 123 | Ga0207663_10047452 | 3300025916 | Bacteria | 2652 |
| 124 | Ga0207649_10000076 | 3300025920 | Bacteria | 83824 |
| 125 | Ga0207650_10199880 | 3300025925 | Bacteria | 1601 |
| 126 | Ga0207659_10000010 | 3300025926 | Bacteria | 286639 |
| 127 | Ga0207687_10000007 | 3300025927 | Bacteria | 604185 |
| 128 | Ga0207687_10005996 | 3300025927 | Bacteria | 8042 |
| 129 | Ga0207687_10876489 | 3300025927 | Unclassified | 767 |
| 130 | Ga0207700_10000025 | 3300025928 | Bacteria | 147429 |
| 131 | Ga0207664_10077345 | 3300025929 | Bacteria | 2696 |
| 132 | Ga0207664_10425760 | 3300025929 | Bacteria | 1183 |
| 133 | Ga0207664_10799033 | 3300025929 | Unclassified | 849 |
| 134 | Ga0207690_10068934 | 3300025932 | Bacteria | 2432 |
| 135 | Ga0207706_10000018 | 3300025933 | Bacteria | 168729 |
| 136 | Ga0207686_10000289 | 3300025934 | Bacteria | 37190 |
| 137 | Ga0207686_10089760 | 3300025934 | Bacteria | 2026 |
| 138 | Ga0207709_10025347 | 3300025935 | Bacteria | 3394 |
| 139 | Ga0207669_10000009 | 3300025937 | Bacteria | 168012 |
| 140 | Ga0207704_10000720 | 3300025938 | Bacteria | 14555 |
| 141 | Ga0207704_10851061 | 3300025938 | Unclassified | 764 |
| 142 | Ga0207691_10000190 | 3300025940 | Bacteria | 58438 |
| 143 | Ga0207711_10000020 | 3300025941 | Bacteria | 363325 |
| 144 | Ga0207689_11258278 | 3300025942 | Unclassified | 622 |
| 145 | Ga0207661_10000403 | 3300025944 | Bacteria | 27999 |
| 146 | Ga0207661_10001894 | 3300025944 | Bacteria | 14344 |
| 147 | Ga0207661_10282670 | 3300025944 | Bacteria | 1483 |
| 148 | Ga0207661_10496946 | 3300025944 | Bacteria | 1114 |
| 149 | Ga0207661_10702281 | 3300025944 | Bacteria | 930 |
| 150 | Ga0207679_10036209 | 3300025945 | Bacteria | 3498 |
| 151 | Ga0207679_10054264 | 3300025945 | Bacteria | 2950 |
| 152 | Ga0207667_10298194 | 3300025949 | Bacteria | 1647 |
| 153 | Ga0207668_10186562 | 3300025972 | Bacteria | 1640 |
| 154 | Ga0207640_10000015 | 3300025981 | Bacteria | 215411 |
| 155 | Ga0207658_10062245 | 3300025986 | Bacteria | 2792 |
| 156 | Ga0207658_10869027 | 3300025986 | Bacteria | 820 |
| 157 | Ga0207677_10000392 | 3300026023 | Bacteria | 30151 |
| 158 | Ga0207677_10000821 | 3300026023 | Bacteria | 17760 |
| 159 | Ga0207639_10404291 | 3300026041 | Bacteria | 1231 |
| 160 | Ga0207678_10177570 | 3300026067 | Bacteria | 1818 |
| 161 | Ga0207708_10334965 | 3300026075 | Bacteria | 1238 |
| 162 | Ga0207702_10000016 | 3300026078 | Bacteria | 226633 |
| 163 | Ga0207702_10012239 | 3300026078 | Bacteria | 7139 |
| 164 | Ga0207641_11345756 | 3300026088 | Unclassified | 715 |
| 165 | Ga0207648_10007579 | 3300026089 | Bacteria | 10644 |
| 166 | Ga0207676_10000016 | 3300026095 | Bacteria | 311561 |
| 167 | Ga0207675_100095790 | 3300026118 | Bacteria | 2793 |
| 168 | Ga0207683_10066521 | 3300026121 | Bacteria | 3178 |
| 169 | Ga0207683_10444049 | 3300026121 | Bacteria | 1195 |
| 170 | Ga0207698_10000012 | 3300026142 | Bacteria | 260061 |
| 171 | Ga0268266_10001355 | 3300028379 | Bacteria | 29570 |
| 172 | Ga0268266_10012151 | 3300028379 | Bacteria | 7452 |
| 173 | Ga0268266_10034345 | 3300028379 | Bacteria | 4313 |
| 174 | Ga0268264_10002386 | 3300028381 | Bacteria | 16562 |
| 175 | Ga0265326_10120468 | 3300028558 | Bacteria | 746 |
| 176 | Ga0307416_101436103 | 3300032002 | Unclassified | 796 |
| 177 | Ga0307415_100007188 | 3300032126 | Bacteria | 6073 |
| 178 | Ga0451843_0517082 | 3300041509 | Bacteria | 849 |
| 179 | Ga0466963_0035111 | 3300044694 | Bacteria | 3265 |
| 180 | Ga0466957_0027966 | 3300044842 | Bacteria | 3354 |
| 181 | Ga0466957_0066244 | 3300044842 | Bacteria | 2226 |
| 182 | Ga0466967_0000033 | 3300045976 | Bacteria | 54859 |
| 183 | Ga0466967_0136531 | 3300045976 | Bacteria | 2281 |
| 184 | Ga0466967_0655118 | 3300045976 | Bacteria | 1038 |
| 185 | Ga0495592_0162156 | 3300046454 | Bacteria | 1537 |
| 186 | Ga0495592_0222843 | 3300046454 | Bacteria | 1260 |
| 187 | Ga0495603_0007993 | 3300046455 | Bacteria | 6385 |
| 188 | Ga0495629_0006408 | 3300046459 | Bacteria | 8724 |
| 189 | Ga0495629_0007203 | 3300046459 | Bacteria | 8190 |
| 190 | Ga0495629_0056991 | 3300046459 | Bacteria | 2732 |
| 191 | Ga0495638_0026258 | 3300046460 | Bacteria | 3776 |
| 192 | Ga0495641_0037466 | 3300046461 | Bacteria | 2272 |
| 193 | Ga0495641_0122959 | 3300046461 | Bacteria | 1158 |
| 194 | Ga0495641_0175704 | 3300046461 | Bacteria | 958 |
| 195 | Ga0495651_0181567 | 3300046462 | Bacteria | 1489 |
| 196 | Ga0495651_0432591 | 3300046462 | Bacteria | 853 |
| 197 | Ga0495582_0000027 | 3300046473 | Bacteria | 79970 |
| 198 | Ga0495662_0000749 | 3300046476 | Bacteria | 15587 |
| 199 | Ga0495662_0007928 | 3300046476 | Bacteria | 5227 |
| 200 | Ga0495662_0023135 | 3300046476 | Bacteria | 3001 |
| 201 | Ga0495664_0914104 | 3300046477 | Unclassified | 513 |
| 202 | Ga0495594_0000003 | 3300046499 | Bacteria | 199267 |
| 203 | Ga0495606_0000221 | 3300046507 | Bacteria | 101157 |
| 204 | Ga0495608_0000031 | 3300046511 | Bacteria | 145255 |
| 205 | Ga0495608_0193946 | 3300046511 | Bacteria | 1282 |
| 206 | Ga0495608_0318022 | 3300046511 | Bacteria | 962 |
| 207 | Ga0495608_0526128 | 3300046511 | Bacteria | 714 |
| 208 | Ga0495628_0000595 | 3300046516 | Bacteria | 33337 |
| 209 | Ga0495628_0292610 | 3300046516 | Bacteria | 1207 |
| 210 | Ga0495630_0000018 | 3300046517 | Bacteria | 186064 |
| 211 | Ga0495630_0000494 | 3300046517 | Bacteria | 29152 |
| 212 | Ga0495630_0713555 | 3300046517 | Unclassified | 767 |
| 213 | Ga0495652_0000019 | 3300046529 | Bacteria | 190248 |
| 214 | Ga0495587_0001523 | 3300046536 | Bacteria | 15407 |
| 215 | Ga0495587_0058518 | 3300046536 | Bacteria | 2264 |
| 216 | Ga0495587_0067632 | 3300046536 | Bacteria | 2082 |
| 217 | Ga0495587_0087602 | 3300046536 | Bacteria | 1802 |
| 218 | Ga0495598_0000203 | 3300046537 | Bacteria | 10475 |
| 219 | Ga0495621_0001660 | 3300046539 | Bacteria | 5832 |
| 220 | Ga0495645_0112558 | 3300046543 | Bacteria | 1924 |
| 221 | Ga0495622_0000014 | 3300046557 | Bacteria | 182142 |
| 222 | Ga0495634_0000050 | 3300046642 | Bacteria | 94546 |
| 223 | Ga0495634_0001942 | 3300046642 | Bacteria | 17687 |
| 224 | Ga0495634_0010085 | 3300046642 | Bacteria | 6934 |
| 225 | Ga0495634_0110868 | 3300046642 | Bacteria | 1764 |
| 226 | Ga0495625_0000122 | 3300046660 | Bacteria | 121146 |
| 227 | Ga0495635_0069512 | 3300046663 | Bacteria | 2414 |
| 228 | Ga0495635_0411560 | 3300046663 | Bacteria | 897 |
| 229 | Ga0495588_0000376 | 3300046674 | Bacteria | 26068 |
| 230 | Ga0495657_0000024 | 3300046675 | Bacteria | 145255 |
| 231 | Ga0495599_0891789 | 3300046678 | Unclassified | 504 |
| 232 | Ga0495647_0000228 | 3300046681 | Bacteria | 15271 |
| 233 | Ga0495658_0000025 | 3300046683 | Bacteria | 79910 |
| 234 | Ga0495658_0800006 | 3300046683 | Bacteria | 604 |
| 235 | Ga0495669_0142386 | 3300046684 | Unclassified | 1132 |
| 236 | Ga0495669_0264597 | 3300046684 | Bacteria | 826 |
| 237 | Ga0495613_0000073 | 3300046689 | Bacteria | 98688 |
| 238 | Ga0495624_0000037 | 3300046690 | Bacteria | 83796 |
| 239 | Ga0495670_0009984 | 3300046691 | Bacteria | 4668 |
| 240 | Ga0495604_0000073 | 3300047317 | Bacteria | 86844 |
| 241 | Ga0495604_0005183 | 3300047317 | Bacteria | 10324 |
| 242 | Ga0495672_0171153 | 3300047320 | Unclassified | 1108 |
| 243 | Ga0495672_0299410 | 3300047320 | Unclassified | 762 |
| 244 | Ga0495676_0311913 | 3300047321 | Bacteria | 1058 |
| 245 | Ga0495675_0000090 | 3300047444 | Bacteria | 63705 |
| 246 | Ga0495684_0150103 | 3300047471 | Bacteria | 1743 |
| 247 | Ga0495686_0136097 | 3300047472 | Bacteria | 1453 |
| 248 | Ga0495593_0040235 | 3300047673 | Bacteria | 2517 |
| 249 | Ga0495593_0156650 | 3300047673 | Bacteria | 1151 |
| 250 | Ga0495602_0000021 | 3300048088 | Bacteria | 168585 |
| 251 | Ga0495602_0001155 | 3300048088 | Bacteria | 25844 |
| 252 | Ga0495602_0497742 | 3300048088 | Bacteria | 852 |
| 253 | Ga0496102_0000146 | 3300048905 | Bacteria | 96361 |
| 254 | Ga0496102_1481645 | 3300048905 | Unclassified | 597 |
| 255 | Ga0496103_0000043 | 3300048906 | Bacteria | 167983 |
| 256 | Ga0496104_0010527 | 3300048907 | Bacteria | 8262 |
| 257 | Ga0496104_0021284 | 3300048907 | Bacteria | 5951 |
| 258 | Ga0496105_0016463 | 3300048908 | Bacteria | 5904 |
| 259 | Ga0496105_1073460 | 3300048908 | Bacteria | 599 |
| 260 | Ga0496106_0000138 | 3300048909 | Bacteria | 54275 |
| 261 | Ga0496107_0926391 | 3300048910 | Unclassified | 634 |
| 262 | Ga0496108_0000150 | 3300048911 | Bacteria | 67068 |
| 263 | Ga0496108_0018497 | 3300048911 | Bacteria | 5706 |
| 264 | Ga0496108_0263253 | 3300048911 | Bacteria | 1501 |
| 265 | Ga0496109_0000007 | 3300048912 | Bacteria | 247554 |
| 266 | Ga0496109_0000028 | 3300048912 | Bacteria | 168138 |
| 267 | Ga0496109_0838405 | 3300048912 | Bacteria | 857 |
| 268 | Ga0496110_0000105 | 3300048913 | Bacteria | 45468 |
| 269 | Ga0496110_0044429 | 3300048913 | Bacteria | 3880 |
| 270 | Ga0496110_0145864 | 3300048913 | Bacteria | 2141 |
| 271 | Ga0496111_0000261 | 3300048914 | Bacteria | 25723 |
| 272 | Ga0496111_0627652 | 3300048914 | Bacteria | 785 |
| 273 | Ga0496112_0000003 | 3300048915 | Bacteria | 660147 |
| 274 | Ga0496112_0000938 | 3300048915 | Bacteria | 21148 |
| 275 | Ga0496112_0228859 | 3300048915 | Bacteria | 1814 |
| 276 | Ga0496113_0000007 | 3300048916 | Bacteria | 95884 |
| 277 | Ga0496113_0011498 | 3300048916 | Bacteria | 5909 |
| 278 | Ga0496113_0980167 | 3300048916 | Bacteria | 666 |
| 279 | Ga0496114_0000014 | 3300048917 | Bacteria | 297902 |
| 280 | Ga0496114_0353207 | 3300048917 | Bacteria | 1300 |
| 281 | Ga0496115_0000003 | 3300048918 | Bacteria | 354994 |
| 282 | Ga0496115_0000316 | 3300048918 | Bacteria | 41025 |
| 283 | Ga0496124_0292610 | 3300048927 | Bacteria | 1181 |
| 284 | Ga0501040_0670183 | 3300049576 | Bacteria | 750 |
| 285 | Ga0501042_0104753 | 3300049578 | Bacteria | 2035 |
| 286 | Ga0501042_0294378 | 3300049578 | Bacteria | 1172 |
| 287 | Ga0501042_0924041 | 3300049578 | Bacteria | 635 |
| 288 | Ga0501047_0894902 | 3300049581 | Bacteria | 701 |
| 289 | Ga0501075_0001131 | 3300049591 | Bacteria | 17202 |
| 290 | Ga0501075_0928926 | 3300049591 | Bacteria | 661 |
| 291 | Ga0501076_0346088 | 3300049592 | Bacteria | 1220 |
| 292 | Ga0501077_0208141 | 3300049593 | Bacteria | 1243 |
| 293 | Ga0501081_0617525 | 3300049743 | Bacteria | 812 |
| 294 | Ga0501081_0735356 | 3300049743 | Bacteria | 741 |
| 295 | Ga0501035_1048055 | 3300049822 | Bacteria | 639 |
| 296 | nmdc:mga08x19_122218_c1 | 3300050514 | Bacteria | 1746 |
| 297 | Ga0495601_0000039 | 3300053077 | Bacteria | 79594 |
| 298 | Ga0495601_0032904 | 3300053077 | Bacteria | 3229 |
| 299 | Ga0495601_0159680 | 3300053077 | Bacteria | 1473 |
| 300 | Ga0495601_0356680 | 3300053077 | Bacteria | 950 |
| 301 | Ga0495601_0474031 | 3300053077 | Unclassified | 809 |
| 302 | Ga0495612_0003451 | 3300053078 | Bacteria | 6551 |
| 303 | Ga0495612_0007882 | 3300053078 | Bacteria | 4342 |
| 304 | Ga0495655_0000001 | 3300053083 | Bacteria | 419518 |
| 305 | Ga0495655_0010629 | 3300053083 | Bacteria | 1822 |
| 306 | Ga0495595_0000014 | 3300053084 | Bacteria | 145255 |
| 307 | Ga0495619_0000114 | 3300053085 | Bacteria | 59624 |
| 308 | Ga0495619_0000135 | 3300053085 | Bacteria | 54848 |
| 309 | Ga0495619_0000243 | 3300053085 | Bacteria | 39638 |
| 310 | Ga0495619_0000416 | 3300053085 | Bacteria | 28900 |
| 311 | Ga0495619_0002645 | 3300053085 | Bacteria | 11706 |
| 312 | Ga0495619_0005724 | 3300053085 | Bacteria | 7881 |
| 313 | Ga0495619_0253564 | 3300053085 | Bacteria | 1219 |
| 314 | Ga0495619_0291692 | 3300053085 | Bacteria | 1130 |
| 315 | Ga0500566_0195665 | 3300053094 | Bacteria | 1025 |
| 316 | Ga0500628_000017 | 3300053129 | Bacteria | 90481 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300010375 | Ga0105239_10564520 | Ga0105239_105645202 | 112 |
| 2 | 3300014325 | Ga0163163_10273026 | Ga0163163_102730262 | 112 |
| 3 | 3300048918 | Ga0496115_0000003 | Ga0496115_0000003_342886_343287 | 112 |
| 4 | 3300048913 | Ga0496110_0145864 | Ga0496110_0145864_567_911 | 114 |
| 5 | 3300046476 | Ga0495662_0000749 | Ga0495662_0000749_1872_2273 | 116 |
| 6 | 3300053083 | Ga0495655_0000001 | Ga0495655_0000001_33619_34023 | 118 |
| 7 | 3300053129 | Ga0500628_000017 | Ga0500628_000017_63244_63648 | 118 |
| 8 | 3300010375 | Ga0105239_11068644 | Ga0105239_110686442 | 119 |
| 9 | 3300046642 | Ga0495634_0000050 | Ga0495634_0000050_79193_79558 | 119 |
| 10 | 3300005329 | Ga0070683_100250599 | Ga0070683_1002505992 | 120 |
| 11 | 3300005356 | Ga0070674_100040199 | Ga0070674_1000401994 | 120 |
| 12 | 3300005435 | Ga0070714_100114839 | Ga0070714_1001148392 | 120 |
| 13 | 3300005535 | Ga0070684_100094433 | Ga0070684_1000944332 | 120 |
| 14 | 3300005564 | Ga0070664_100027503 | Ga0070664_1000275032 | 120 |
| 15 | 3300006237 | Ga0097621_100200576 | Ga0097621_1002005762 | 120 |
| 16 | 3300014325 | Ga0163163_12550092 | Ga0163163_125500921 | 120 |
| 17 | 3300025929 | Ga0207664_10077345 | Ga0207664_100773452 | 120 |
| 18 | 3300025944 | Ga0207661_10282670 | Ga0207661_102826702 | 120 |
| 19 | 3300025945 | Ga0207679_10036209 | Ga0207679_100362093 | 120 |
| 20 | 3300045976 | Ga0466967_0655118 | Ga0466967_0655118_273_638 | 120 |
| 21 | 3300046476 | Ga0495662_0023135 | Ga0495662_0023135_2004_2366 | 120 |
| 22 | 3300046543 | Ga0495645_0112558 | Ga0495645_0112558_815_1177 | 120 |
| 23 | 3300046642 | Ga0495634_0001942 | Ga0495634_0001942_2498_2860 | 120 |
| 24 | 3300046642 | Ga0495634_0010085 | Ga0495634_0010085_2350_2712 | 120 |
| 25 | 3300046663 | Ga0495635_0069512 | Ga0495635_0069512_1301_1663 | 120 |
| 26 | 3300046684 | Ga0495669_0142386 | Ga0495669_0142386_23_385 | 120 |
| 27 | 3300047673 | Ga0495593_0156650 | Ga0495593_0156650_753_1115 | 120 |
| 28 | 3300048907 | Ga0496104_0021284 | Ga0496104_0021284_1941_2354 | 120 |
| 29 | 3300048908 | Ga0496105_0016463 | Ga0496105_0016463_1068_1481 | 120 |
| 30 | 3300048911 | Ga0496108_0263253 | Ga0496108_0263253_685_1047 | 120 |
| 31 | 3300048915 | Ga0496112_0228859 | Ga0496112_0228859_1330_1692 | 120 |
| 32 | 3300048916 | Ga0496113_0011498 | Ga0496113_0011498_147_509 | 120 |
| 33 | 3300053077 | Ga0495601_0474031 | Ga0495601_0474031_405_767 | 120 |
| 34 | 3300053078 | Ga0495612_0007882 | Ga0495612_0007882_2004_2366 | 120 |
| 35 | 3300053085 | Ga0495619_0005724 | Ga0495619_0005724_5665_6027 | 120 |
| 36 | 3300053085 | Ga0495619_0253564 | Ga0495619_0253564_576_938 | 120 |
| 37 | 3300053085 | Ga0495619_0291692 | Ga0495619_0291692_524_886 | 120 |
| 38 | 3300009098 | Ga0105245_10000180 | Ga0105245_1000018043 | 121 |
| 39 | 3300041509 | Ga0451843_0517082 | Ga0451843_0517082_467_832 | 121 |
| 40 | 3300045976 | Ga0466967_0136531 | Ga0466967_0136531_947_1312 | 121 |
| 41 | 3300046516 | Ga0495628_0292610 | Ga0495628_0292610_326_697 | 121 |
| 42 | 3300046517 | Ga0495630_0000494 | Ga0495630_0000494_3919_4290 | 121 |
| 43 | 3300046642 | Ga0495634_0110868 | Ga0495634_0110868_651_1022 | 121 |
| 44 | 3300046663 | Ga0495635_0411560 | Ga0495635_0411560_364_735 | 121 |
| 45 | 3300046678 | Ga0495599_0891789 | Ga0495599_0891789_67_438 | 121 |
| 46 | 3300047471 | Ga0495684_0150103 | Ga0495684_0150103_575_946 | 121 |
| 47 | 3300048908 | Ga0496105_1073460 | Ga0496105_1073460_204_569 | 121 |
| 48 | 3300053077 | Ga0495601_0356680 | Ga0495601_0356680_320_691 | 121 |
| 49 | 3300053085 | Ga0495619_0000416 | Ga0495619_0000416_27955_28326 | 121 |
| 50 | 3300046454 | Ga0495592_0222843 | Ga0495592_0222843_693_1070 | 122 |
| 51 | 3300046462 | Ga0495651_0181567 | Ga0495651_0181567_381_758 | 122 |
| 52 | 3300046511 | Ga0495608_0193946 | Ga0495608_0193946_259_636 | 124 |
| 53 | 3300053077 | Ga0495601_0032904 | Ga0495601_0032904_1388_1810 | 124 |
| 54 | 3300005456 | Ga0070678_100013493 | Ga0070678_1000134932 | 125 |
| 55 | 3300009176 | Ga0105242_10000132 | Ga0105242_1000013214 | 125 |
| 56 | 3300025927 | Ga0207687_10876489 | Ga0207687_108764892 | 125 |
| 57 | 3300025934 | Ga0207686_10000289 | Ga0207686_1000028932 | 125 |
| 58 | 3300026088 | Ga0207641_11345756 | Ga0207641_113457561 | 125 |
| 59 | 3300026121 | Ga0207683_10066521 | Ga0207683_100665213 | 125 |
| 60 | 3300046691 | Ga0495670_0009984 | Ga0495670_0009984_4278_4655 | 125 |
| 61 | 3300047320 | Ga0495672_0299410 | Ga0495672_0299410_218_595 | 125 |
| 62 | 3300046462 | Ga0495651_0432591 | Ga0495651_0432591_378_779 | 126 |
| 63 | 3300005344 | Ga0070661_100000599 | Ga0070661_1000005997 | 128 |
| 64 | 3300025920 | Ga0207649_10000076 | Ga0207649_1000007637 | 128 |
| 65 | 3300046536 | Ga0495587_0067632 | Ga0495587_0067632_831_1223 | 128 |
| 66 | 3300048909 | Ga0496106_0000138 | Ga0496106_0000138_52043_52432 | 128 |
| 67 | 3300048910 | Ga0496107_0926391 | Ga0496107_0926391_149_538 | 128 |
| 68 | 3300053085 | Ga0495619_0002645 | Ga0495619_0002645_4216_4611 | 129 |
| 69 | 3300007076 | Ga0075435_100235135 | Ga0075435_1002351352 | 130 |
| 70 | 3300009176 | Ga0105242_11034070 | Ga0105242_110340702 | 130 |
| 71 | 3300010375 | Ga0105239_10461868 | Ga0105239_104618681 | 130 |
| 72 | 3300013308 | Ga0157375_13531519 | Ga0157375_135315191 | 130 |
| 73 | 3300025934 | Ga0207686_10089760 | Ga0207686_100897603 | 130 |
| 74 | 3300046455 | Ga0495603_0007993 | Ga0495603_0007993_1889_2290 | 130 |
| 75 | 3300046459 | Ga0495629_0056991 | Ga0495629_0056991_1896_2297 | 130 |
| 76 | 3300046461 | Ga0495641_0122959 | Ga0495641_0122959_443_844 | 130 |
| 77 | 3300046536 | Ga0495587_0087602 | Ga0495587_0087602_456_860 | 130 |
| 78 | 3300048914 | Ga0496111_0627652 | Ga0496111_0627652_80_478 | 130 |
| 79 | 3300053078 | Ga0495612_0003451 | Ga0495612_0003451_3685_4083 | 130 |
| 80 | 3300005329 | Ga0070683_101139667 | Ga0070683_1011396671 | 131 |
| 81 | 3300005338 | Ga0068868_100004773 | Ga0068868_1000047737 | 131 |
| 82 | 3300005340 | Ga0070689_101860831 | Ga0070689_1018608311 | 131 |
| 83 | 3300005365 | Ga0070688_100000012 | Ga0070688_10000001249 | 131 |
| 84 | 3300005406 | Ga0070703_10061409 | Ga0070703_100614092 | 131 |
| 85 | 3300005445 | Ga0070708_101161318 | Ga0070708_1011613182 | 131 |
| 86 | 3300005455 | Ga0070663_100080494 | Ga0070663_1000804942 | 131 |
| 87 | 3300005456 | Ga0070678_100154478 | Ga0070678_1001544782 | 131 |
| 88 | 3300005457 | Ga0070662_100000007 | Ga0070662_100000007184 | 131 |
| 89 | 3300005459 | Ga0068867_100006976 | Ga0068867_1000069763 | 131 |
| 90 | 3300005466 | Ga0070685_10000142 | Ga0070685_1000014210 | 131 |
| 91 | 3300005563 | Ga0068855_100279893 | Ga0068855_1002798933 | 131 |
| 92 | 3300005718 | Ga0068866_10000001 | Ga0068866_10000001166 | 131 |
| 93 | 3300005840 | Ga0068870_10119676 | Ga0068870_101196762 | 131 |
| 94 | 3300009101 | Ga0105247_10060828 | Ga0105247_100608283 | 131 |
| 95 | 3300009177 | Ga0105248_11970455 | Ga0105248_119704551 | 131 |
| 96 | 3300013296 | Ga0157374_10001471 | Ga0157374_100014715 | 131 |
| 97 | 3300014326 | Ga0157380_10000158 | Ga0157380_100001588 | 131 |
| 98 | 3300014968 | Ga0157379_10142539 | Ga0157379_101425393 | 131 |
| 99 | 3300025899 | Ga0207642_10000006 | Ga0207642_10000006169 | 131 |
| 100 | 3300025899 | Ga0207642_10000007 | Ga0207642_1000000766 | 131 |
| 101 | 3300025900 | Ga0207710_10036674 | Ga0207710_100366743 | 131 |
| 102 | 3300025905 | Ga0207685_10000011 | Ga0207685_10000011138 | 131 |
| 103 | 3300025908 | Ga0207643_10027450 | Ga0207643_100274502 | 131 |
| 104 | 3300025916 | Ga0207663_10000683 | Ga0207663_100006839 | 131 |
| 105 | 3300025933 | Ga0207706_10000018 | Ga0207706_100000182 | 131 |
| 106 | 3300025937 | Ga0207669_10000009 | Ga0207669_10000009165 | 131 |
| 107 | 3300025944 | Ga0207661_10496946 | Ga0207661_104969462 | 131 |
| 108 | 3300025949 | Ga0207667_10298194 | Ga0207667_102981942 | 131 |
| 109 | 3300026023 | Ga0207677_10000821 | Ga0207677_100008217 | 131 |
| 110 | 3300026067 | Ga0207678_10177570 | Ga0207678_101775703 | 131 |
| 111 | 3300026089 | Ga0207648_10007579 | Ga0207648_100075799 | 131 |
| 112 | 3300026121 | Ga0207683_10444049 | Ga0207683_104440492 | 131 |
| 113 | 3300028381 | Ga0268264_10002386 | Ga0268264_1000238610 | 131 |
| 114 | 3300046473 | Ga0495582_0000027 | Ga0495582_0000027_66632_67042 | 131 |
| 115 | 3300046511 | Ga0495608_0526128 | Ga0495608_0526128_156_563 | 131 |
| 116 | 3300046537 | Ga0495598_0000203 | Ga0495598_0000203_6453_6854 | 131 |
| 117 | 3300046539 | Ga0495621_0001660 | Ga0495621_0001660_694_1098 | 131 |
| 118 | 3300046683 | Ga0495658_0000025 | Ga0495658_0000025_66632_67042 | 131 |
| 119 | 3300048088 | Ga0495602_0497742 | Ga0495602_0497742_40_441 | 131 |
| 120 | 3300048912 | Ga0496109_0838405 | Ga0496109_0838405_402_812 | 131 |
| 121 | 3300048915 | Ga0496112_0000003 | Ga0496112_0000003_191628_192032 | 131 |
| 122 | 3300048916 | Ga0496113_0980167 | Ga0496113_0980167_39_443 | 131 |
| 123 | 3300049576 | Ga0501040_0670183 | Ga0501040_0670183_235_636 | 131 |
| 124 | 3300049578 | Ga0501042_0104753 | Ga0501042_0104753_1195_1599 | 131 |
| 125 | 3300049591 | Ga0501075_0001131 | Ga0501075_0001131_16632_17036 | 131 |
| 126 | 3300049591 | Ga0501075_0928926 | Ga0501075_0928926_216_617 | 131 |
| 127 | 3300049743 | Ga0501081_0617525 | Ga0501081_0617525_387_788 | 131 |
| 128 | 3300049743 | Ga0501081_0735356 | Ga0501081_0735356_100_501 | 131 |
| 129 | 3300049822 | Ga0501035_1048055 | Ga0501035_1048055_75_476 | 131 |
| 130 | 3300005329 | Ga0070683_100000501 | Ga0070683_1000005012 | 132 |
| 131 | 3300005338 | Ga0068868_100004331 | Ga0068868_1000043312 | 132 |
| 132 | 3300005367 | Ga0070667_100089153 | Ga0070667_1000891532 | 132 |
| 133 | 3300005535 | Ga0070684_100349078 | Ga0070684_1003490782 | 132 |
| 134 | 3300005535 | Ga0070684_101884181 | Ga0070684_1018841811 | 132 |
| 135 | 3300005543 | Ga0070672_100000030 | Ga0070672_10000003032 | 132 |
| 136 | 3300005547 | Ga0070693_100003779 | Ga0070693_1000037792 | 132 |
| 137 | 3300005548 | Ga0070665_100001190 | Ga0070665_10000119033 | 132 |
| 138 | 3300005618 | Ga0068864_100000178 | Ga0068864_10000017815 | 132 |
| 139 | 3300005719 | Ga0068861_100174641 | Ga0068861_1001746412 | 132 |
| 140 | 3300005719 | Ga0068861_100373323 | Ga0068861_1003733232 | 132 |
| 141 | 3300005834 | Ga0068851_10153145 | Ga0068851_101531452 | 132 |
| 142 | 3300005983 | Ga0081540_1000006 | Ga0081540_1000006148 | 132 |
| 143 | 3300006175 | Ga0070712_100001362 | Ga0070712_10000136210 | 132 |
| 144 | 3300013308 | Ga0157375_10168413 | Ga0157375_101684133 | 132 |
| 145 | 3300014326 | Ga0157380_10000059 | Ga0157380_1000005963 | 132 |
| 146 | 3300025321 | Ga0207656_10086999 | Ga0207656_100869992 | 132 |
| 147 | 3300025915 | Ga0207693_10007556 | Ga0207693_100075563 | 132 |
| 148 | 3300025940 | Ga0207691_10000190 | Ga0207691_1000019013 | 132 |
| 149 | 3300025944 | Ga0207661_10001894 | Ga0207661_100018946 | 132 |
| 150 | 3300025986 | Ga0207658_10062245 | Ga0207658_100622452 | 132 |
| 151 | 3300026023 | Ga0207677_10000392 | Ga0207677_1000039210 | 132 |
| 152 | 3300026095 | Ga0207676_10000016 | Ga0207676_10000016176 | 132 |
| 153 | 3300026118 | Ga0207675_100095790 | Ga0207675_1000957903 | 132 |
| 154 | 3300028379 | Ga0268266_10001355 | Ga0268266_100013552 | 132 |
| 155 | 3300046459 | Ga0495629_0007203 | Ga0495629_0007203_2222_2626 | 132 |
| 156 | 3300046477 | Ga0495664_0914104 | Ga0495664_0914104_17_427 | 132 |
| 157 | 3300046499 | Ga0495594_0000003 | Ga0495594_0000003_15740_16150 | 132 |
| 158 | 3300046507 | Ga0495606_0000221 | Ga0495606_0000221_90467_90871 | 132 |
| 159 | 3300046557 | Ga0495622_0000014 | Ga0495622_0000014_56446_56856 | 132 |
| 160 | 3300047673 | Ga0495593_0040235 | Ga0495593_0040235_1532_1936 | 132 |
| 161 | 3300048913 | Ga0496110_0044429 | Ga0496110_0044429_279_683 | 132 |
| 162 | 3300048917 | Ga0496114_0353207 | Ga0496114_0353207_654_1052 | 132 |
| 163 | 3300048927 | Ga0496124_0292610 | Ga0496124_0292610_319_723 | 132 |
| 164 | 3300049592 | Ga0501076_0346088 | Ga0501076_0346088_66_464 | 132 |
| 165 | 3300053085 | Ga0495619_0000243 | Ga0495619_0000243_30641_31048 | 132 |
| 166 | 3300005329 | Ga0070683_100003289 | Ga0070683_10000328912 | 133 |
| 167 | 3300005329 | Ga0070683_100494267 | Ga0070683_1004942672 | 133 |
| 168 | 3300005330 | Ga0070690_100125247 | Ga0070690_1001252472 | 133 |
| 169 | 3300005334 | Ga0068869_101014645 | Ga0068869_1010146452 | 133 |
| 170 | 3300005335 | Ga0070666_10043488 | Ga0070666_100434883 | 133 |
| 171 | 3300005344 | Ga0070661_100279133 | Ga0070661_1002791332 | 133 |
| 172 | 3300005347 | Ga0070668_101092727 | Ga0070668_1010927271 | 133 |
| 173 | 3300005354 | Ga0070675_100000053 | Ga0070675_10000005310 | 133 |
| 174 | 3300005366 | Ga0070659_100059978 | Ga0070659_1000599783 | 133 |
| 175 | 3300005367 | Ga0070667_100097835 | Ga0070667_1000978352 | 133 |
| 176 | 3300005439 | Ga0070711_100032239 | Ga0070711_1000322394 | 133 |
| 177 | 3300005455 | Ga0070663_100990936 | Ga0070663_1009909361 | 133 |
| 178 | 3300005535 | Ga0070684_100021244 | Ga0070684_1000212445 | 133 |
| 179 | 3300005548 | Ga0070665_100074455 | Ga0070665_1000744552 | 133 |
| 180 | 3300005564 | Ga0070664_100042879 | Ga0070664_1000428795 | 133 |
| 181 | 3300005616 | Ga0068852_100000012 | Ga0068852_10000001253 | 133 |
| 182 | 3300005718 | Ga0068866_10094719 | Ga0068866_100947192 | 133 |
| 183 | 3300006881 | Ga0068865_100007743 | Ga0068865_1000077433 | 133 |
| 184 | 3300006881 | Ga0068865_101885431 | Ga0068865_1018854311 | 133 |
| 185 | 3300009148 | Ga0105243_10010482 | Ga0105243_100104827 | 133 |
| 186 | 3300009177 | Ga0105248_10000032 | Ga0105248_10000032198 | 133 |
| 187 | 3300013105 | Ga0157369_10000142 | Ga0157369_1000014255 | 133 |
| 188 | 3300013297 | Ga0157378_10002558 | Ga0157378_100025585 | 133 |
| 189 | 3300013306 | Ga0163162_11011880 | Ga0163162_110118802 | 133 |
| 190 | 3300025899 | Ga0207642_10020993 | Ga0207642_100209933 | 133 |
| 191 | 3300025903 | Ga0207680_10010817 | Ga0207680_100108175 | 133 |
| 192 | 3300025916 | Ga0207663_10047452 | Ga0207663_100474523 | 133 |
| 193 | 3300025926 | Ga0207659_10000010 | Ga0207659_10000010289 | 133 |
| 194 | 3300025927 | Ga0207687_10000007 | Ga0207687_10000007198 | 133 |
| 195 | 3300025932 | Ga0207690_10068934 | Ga0207690_100689342 | 133 |
| 196 | 3300025935 | Ga0207709_10025347 | Ga0207709_100253473 | 133 |
| 197 | 3300025938 | Ga0207704_10000720 | Ga0207704_100007206 | 133 |
| 198 | 3300025938 | Ga0207704_10851061 | Ga0207704_108510612 | 133 |
| 199 | 3300025941 | Ga0207711_10000020 | Ga0207711_10000020176 | 133 |
| 200 | 3300025942 | Ga0207689_11258278 | Ga0207689_112582781 | 133 |
| 201 | 3300025944 | Ga0207661_10000403 | Ga0207661_100004039 | 133 |
| 202 | 3300025945 | Ga0207679_10054264 | Ga0207679_100542643 | 133 |
| 203 | 3300025972 | Ga0207668_10186562 | Ga0207668_101865623 | 133 |
| 204 | 3300026142 | Ga0207698_10000012 | Ga0207698_10000012173 | 133 |
| 205 | 3300028379 | Ga0268266_10034345 | Ga0268266_100343453 | 133 |
| 206 | 3300046460 | Ga0495638_0026258 | Ga0495638_0026258_130_531 | 133 |
| 207 | 3300046461 | Ga0495641_0037466 | Ga0495641_0037466_1428_1838 | 133 |
| 208 | 3300046476 | Ga0495662_0007928 | Ga0495662_0007928_486_887 | 133 |
| 209 | 3300046511 | Ga0495608_0000031 | Ga0495608_0000031_77217_77624 | 133 |
| 210 | 3300046517 | Ga0495630_0000018 | Ga0495630_0000018_83031_83441 | 133 |
| 211 | 3300046529 | Ga0495652_0000019 | Ga0495652_0000019_158547_158960 | 133 |
| 212 | 3300046536 | Ga0495587_0058518 | Ga0495587_0058518_408_821 | 133 |
| 213 | 3300046674 | Ga0495588_0000376 | Ga0495588_0000376_6853_7257 | 133 |
| 214 | 3300046675 | Ga0495657_0000024 | Ga0495657_0000024_77217_77624 | 133 |
| 215 | 3300046681 | Ga0495647_0000228 | Ga0495647_0000228_3582_3992 | 133 |
| 216 | 3300046689 | Ga0495613_0000073 | Ga0495613_0000073_70394_70795 | 133 |
| 217 | 3300046690 | Ga0495624_0000037 | Ga0495624_0000037_17075_17476 | 133 |
| 218 | 3300047317 | Ga0495604_0000073 | Ga0495604_0000073_72596_72997 | 133 |
| 219 | 3300047317 | Ga0495604_0005183 | Ga0495604_0005183_6027_6428 | 133 |
| 220 | 3300047320 | Ga0495672_0171153 | Ga0495672_0171153_311_712 | 133 |
| 221 | 3300047321 | Ga0495676_0311913 | Ga0495676_0311913_200_610 | 133 |
| 222 | 3300047444 | Ga0495675_0000090 | Ga0495675_0000090_28734_29141 | 133 |
| 223 | 3300047472 | Ga0495686_0136097 | Ga0495686_0136097_317_718 | 133 |
| 224 | 3300048088 | Ga0495602_0000021 | Ga0495602_0000021_55354_55755 | 133 |
| 225 | 3300048907 | Ga0496104_0010527 | Ga0496104_0010527_5232_5633 | 133 |
| 226 | 3300048911 | Ga0496108_0018497 | Ga0496108_0018497_1687_2091 | 133 |
| 227 | 3300048912 | Ga0496109_0000028 | Ga0496109_0000028_84213_84617 | 133 |
| 228 | 3300048913 | Ga0496110_0000105 | Ga0496110_0000105_23135_23542 | 133 |
| 229 | 3300048914 | Ga0496111_0000261 | Ga0496111_0000261_18666_19073 | 133 |
| 230 | 3300049578 | Ga0501042_0924041 | Ga0501042_0924041_154_555 | 133 |
| 231 | 3300049593 | Ga0501077_0208141 | Ga0501077_0208141_208_609 | 133 |
| 232 | 3300053077 | Ga0495601_0000039 | Ga0495601_0000039_57815_58216 | 133 |
| 233 | 3300053077 | Ga0495601_0159680 | Ga0495601_0159680_371_778 | 133 |
| 234 | 3300053083 | Ga0495655_0010629 | Ga0495655_0010629_874_1275 | 133 |
| 235 | 3300053084 | Ga0495595_0000014 | Ga0495595_0000014_67632_68039 | 133 |
| 236 | 3300053085 | Ga0495619_0000114 | Ga0495619_0000114_43502_43909 | 133 |
| 237 | 3300053085 | Ga0495619_0000135 | Ga0495619_0000135_22218_22625 | 133 |
| 238 | 3300003320 | rootH2_10111100 | rootH2_101111002 | 134 |
| 239 | 3300005337 | Ga0070682_100000421 | Ga0070682_10000042114 | 134 |
| 240 | 3300005337 | Ga0070682_100108898 | Ga0070682_1001088982 | 134 |
| 241 | 3300005341 | Ga0070691_10004831 | Ga0070691_100048317 | 134 |
| 242 | 3300005345 | Ga0070692_10207136 | Ga0070692_102071362 | 134 |
| 243 | 3300005365 | Ga0070688_100000269 | Ga0070688_10000026911 | 134 |
| 244 | 3300005365 | Ga0070688_100432164 | Ga0070688_1004321642 | 134 |
| 245 | 3300005367 | Ga0070667_100896334 | Ga0070667_1008963342 | 134 |
| 246 | 3300005435 | Ga0070714_100497073 | Ga0070714_1004970732 | 134 |
| 247 | 3300005435 | Ga0070714_101152782 | Ga0070714_1011527821 | 134 |
| 248 | 3300005436 | Ga0070713_100000009 | Ga0070713_10000000918 | 134 |
| 249 | 3300005437 | Ga0070710_10396653 | Ga0070710_103966532 | 134 |
| 250 | 3300005439 | Ga0070711_101217331 | Ga0070711_1012173312 | 134 |
| 251 | 3300005441 | Ga0070700_100143604 | Ga0070700_1001436041 | 134 |
| 252 | 3300005466 | Ga0070685_10000018 | Ga0070685_1000001849 | 134 |
| 253 | 3300005539 | Ga0068853_100479025 | Ga0068853_1004790251 | 134 |
| 254 | 3300005539 | Ga0068853_100577507 | Ga0068853_1005775071 | 134 |
| 255 | 3300005545 | Ga0070695_100341647 | Ga0070695_1003416471 | 134 |
| 256 | 3300005578 | Ga0068854_100000031 | Ga0068854_10000003125 | 134 |
| 257 | 3300005614 | Ga0068856_100002986 | Ga0068856_10000298610 | 134 |
| 258 | 3300005614 | Ga0068856_100015030 | Ga0068856_1000150304 | 134 |
| 259 | 3300005834 | Ga0068851_10001764 | Ga0068851_100017648 | 134 |
| 260 | 3300005985 | Ga0081539_10001003 | Ga0081539_1000100347 | 134 |
| 261 | 3300006914 | Ga0075436_100301226 | Ga0075436_1003012262 | 134 |
| 262 | 3300009098 | Ga0105245_10014301 | Ga0105245_100143015 | 134 |
| 263 | 3300012515 | Ga0157338_1010387 | Ga0157338_10103871 | 134 |
| 264 | 3300013102 | Ga0157371_10013940 | Ga0157371_100139403 | 134 |
| 265 | 3300013104 | Ga0157370_10022277 | Ga0157370_100222777 | 134 |
| 266 | 3300013104 | Ga0157370_10245822 | Ga0157370_102458222 | 134 |
| 267 | 3300013307 | Ga0157372_10000308 | Ga0157372_1000030832 | 134 |
| 268 | 3300013308 | Ga0157375_10005331 | Ga0157375_1000533111 | 134 |
| 269 | 3300017792 | Ga0163161_10010179 | Ga0163161_100101799 | 134 |
| 270 | 3300020081 | Ga0206354_10274000 | Ga0206354_102740002 | 134 |
| 271 | 3300020082 | Ga0206353_11095854 | Ga0206353_110958541 | 134 |
| 272 | 3300025321 | Ga0207656_10000321 | Ga0207656_100003213 | 134 |
| 273 | 3300025925 | Ga0207650_10199880 | Ga0207650_101998802 | 134 |
| 274 | 3300025927 | Ga0207687_10005996 | Ga0207687_100059964 | 134 |
| 275 | 3300025928 | Ga0207700_10000025 | Ga0207700_1000002518 | 134 |
| 276 | 3300025929 | Ga0207664_10425760 | Ga0207664_104257602 | 134 |
| 277 | 3300025929 | Ga0207664_10799033 | Ga0207664_107990332 | 134 |
| 278 | 3300025944 | Ga0207661_10702281 | Ga0207661_107022811 | 134 |
| 279 | 3300025981 | Ga0207640_10000015 | Ga0207640_10000015190 | 134 |
| 280 | 3300025986 | Ga0207658_10869027 | Ga0207658_108690272 | 134 |
| 281 | 3300026041 | Ga0207639_10404291 | Ga0207639_104042912 | 134 |
| 282 | 3300026075 | Ga0207708_10334965 | Ga0207708_103349652 | 134 |
| 283 | 3300026078 | Ga0207702_10000016 | Ga0207702_10000016168 | 134 |
| 284 | 3300026078 | Ga0207702_10012239 | Ga0207702_100122394 | 134 |
| 285 | 3300028379 | Ga0268266_10012151 | Ga0268266_100121512 | 134 |
| 286 | 3300028558 | Ga0265326_10120468 | Ga0265326_101204682 | 134 |
| 287 | 3300032002 | Ga0307416_101436103 | Ga0307416_1014361032 | 134 |
| 288 | 3300032126 | Ga0307415_100007188 | Ga0307415_1000071882 | 134 |
| 289 | 3300044694 | Ga0466963_0035111 | Ga0466963_0035111_2660_3064 | 134 |
| 290 | 3300044842 | Ga0466957_0027966 | Ga0466957_0027966_1099_1503 | 134 |
| 291 | 3300044842 | Ga0466957_0066244 | Ga0466957_0066244_162_566 | 134 |
| 292 | 3300045976 | Ga0466967_0000033 | Ga0466967_0000033_39029_39433 | 134 |
| 293 | 3300046454 | Ga0495592_0162156 | Ga0495592_0162156_19_423 | 134 |
| 294 | 3300046459 | Ga0495629_0006408 | Ga0495629_0006408_2921_3325 | 134 |
| 295 | 3300046461 | Ga0495641_0175704 | Ga0495641_0175704_433_837 | 134 |
| 296 | 3300046511 | Ga0495608_0318022 | Ga0495608_0318022_437_841 | 134 |
| 297 | 3300046516 | Ga0495628_0000595 | Ga0495628_0000595_27373_27777 | 134 |
| 298 | 3300046517 | Ga0495630_0713555 | Ga0495630_0713555_136_540 | 134 |
| 299 | 3300046536 | Ga0495587_0001523 | Ga0495587_0001523_4646_5050 | 134 |
| 300 | 3300046660 | Ga0495625_0000122 | Ga0495625_0000122_61447_61857 | 134 |
| 301 | 3300046683 | Ga0495658_0800006 | Ga0495658_0800006_151_555 | 134 |
| 302 | 3300046684 | Ga0495669_0264597 | Ga0495669_0264597_122_526 | 134 |
| 303 | 3300048088 | Ga0495602_0001155 | Ga0495602_0001155_11261_11665 | 134 |
| 304 | 3300048905 | Ga0496102_0000146 | Ga0496102_0000146_59229_59633 | 134 |
| 305 | 3300048905 | Ga0496102_1481645 | Ga0496102_1481645_33_437 | 134 |
| 306 | 3300048906 | Ga0496103_0000043 | Ga0496103_0000043_38225_38629 | 134 |
| 307 | 3300048911 | Ga0496108_0000150 | Ga0496108_0000150_18084_18488 | 134 |
| 308 | 3300048912 | Ga0496109_0000007 | Ga0496109_0000007_198761_199165 | 134 |
| 309 | 3300048915 | Ga0496112_0000938 | Ga0496112_0000938_12183_12587 | 134 |
| 310 | 3300048916 | Ga0496113_0000007 | Ga0496113_0000007_23965_24369 | 134 |
| 311 | 3300048917 | Ga0496114_0000014 | Ga0496114_0000014_93367_93771 | 134 |
| 312 | 3300048918 | Ga0496115_0000316 | Ga0496115_0000316_7678_8082 | 134 |
| 313 | 3300049578 | Ga0501042_0294378 | Ga0501042_0294378_79_489 | 134 |
| 314 | 3300049581 | Ga0501047_0894902 | Ga0501047_0894902_175_579 | 134 |
| 315 | 3300050514 | nmdc:mga08x19_122218_c1 | nmdc:mga08x19_122218_c1_255_662 | 134 |
| 316 | 3300053094 | Ga0500566_0195665 | Ga0500566_0195665_520_924 | 134 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1rvj-assembly1.cif.gz_H | photosynthetic reaction center double mutant from rhodobacter sphaeroides with asp l213 replaced with asn and arg h177 replaced with his | 0.8659 | 16 | 106 |
| 7yml-assembly1.cif.gz_H | structure of photosynthetic lh1-rc super-complex of rhodobacter capsulatus | 0.8418 | 9 | 106 |
| 7xxf-assembly1.cif.gz_H | structure of photosynthetic lh1-rc super-complex of rhodopila globiformis | 0.8366 | 17 | 107 |
| 1pm3-assembly1.cif.gz_A | mth1859 | 0.8356 | 16 | 76 |
| 7ddq-assembly1.cif.gz_H | structure of rc-lh1-pufx from rhodobacter veldkampii | 0.8217 | 9 | 107 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1pm3A00 | Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain | 0.8356 | 16 | 76 | 2.30.30.240 |
| af_Q58518_6_77_2.30.30.240 | Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain | 0.8325 | 16 | 79 | 2.30.30.240 |
| 2rcrH02 | Alpha Beta;Alpha-Beta Complex;Photosynthetic Reaction Center; Chain H, domain 2;Photosynthetic Reaction Center, subunit H, domain 2 | 0.7785 | 18 | 108 | 3.90.50.10 |
| 1pm3B00 | Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain | 0.7748 | 12 | 76 | 2.30.30.240 |
| af_Q10LU9_128_201_2.30.30.240 | Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain | 0.7733 | 15 | 79 | 2.30.30.240 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537YNN0-F1-model_v4 | PRC-barrel domain-containing protein | 0.9839 | 1 | 134 |
GO:0019684
GO:0030077 GO:0045156 |
| AF-A0A537YNN0-F1-model_v4 | PRC-barrel domain-containing protein | 0.9766 | 1 | 134 |
GO:0019684
GO:0030077 GO:0045156 |
| AF-A0A7V9GTT4-F1-model_v4 | PRC-barrel domain-containing protein | 0.9403 | 12 | 131 |
GO:0019684
GO:0030077 GO:0045156 |
| AF-A0A7V9HT28-F1-model_v4 | PRC-barrel domain-containing protein | 0.9351 | 10 | 134 |
GO:0019684
GO:0030077 GO:0045156 |
| AF-A0A1Q3NF52-F1-model_v4 | deleted | 0.9131 | 2 | 131 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar