F403586

General Info

Members Datasets Scaffolds Average Seq Length
316 193 316 132

Family's Representative Sequence

Representative Sequence 3300005618|Ga0068864_100000178|Ga0068864_10000017815
Length 143
Sequence VTEDAAATAPVPSLAEATTWIGFGVDDVTGSRLGRVHGLFADAGGEPAWLTVALRRRFSLFGRRAATLVVLPLRDCAAAAGRVWTAHAGDVVRAAPTVDPTRPLLREHELTICAHYGISERVGRAAEVLGRPRGAVTAPPAGR

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
119 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
120 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
121 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
124 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
125 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
126 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
127 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
128 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
129 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
130 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
131 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
132 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
133 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
134 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
135 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
136 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
137 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
138 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
139 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
140 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
141 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
142 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
143 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
144 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
145 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
146 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
147 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
148 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
149 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
150 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
151 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
152 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
153 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
154 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
155 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
156 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
157 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
158 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
159 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
160 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
161 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
162 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
178 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
182 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
183 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
184 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
185 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
186 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
187 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
188 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
189 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
190 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
191 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
192 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
193 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.37
Metatranscriptomes 0.63
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.63
Nodule 0
Rhizoplane 9.49
Rhizosphere 88.92
Stem 0
Stem Tuber 0
Unclassified 0.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10111100 3300003320 Bacteria 1569
2 Ga0070683_100000501 3300005329 Bacteria 27619
3 Ga0070683_100003289 3300005329 Bacteria 13064
4 Ga0070683_100250599 3300005329 Bacteria 1684
5 Ga0070683_100494267 3300005329 Bacteria 1168
6 Ga0070683_101139667 3300005329 Unclassified 749
7 Ga0070690_100125247 3300005330 Bacteria 1729
8 Ga0068869_101014645 3300005334 Unclassified 723
9 Ga0070666_10043488 3300005335 Bacteria 3009
10 Ga0070682_100000421 3300005337 Bacteria 27464
11 Ga0070682_100108898 3300005337 Bacteria 1843
12 Ga0068868_100004331 3300005338 Bacteria 9949
13 Ga0068868_100004773 3300005338 Bacteria 9518
14 Ga0070689_101860831 3300005340 Bacteria 549
15 Ga0070691_10004831 3300005341 Bacteria 6134
16 Ga0070661_100000599 3300005344 Bacteria 26985
17 Ga0070661_100279133 3300005344 Bacteria 1295
18 Ga0070692_10207136 3300005345 Bacteria 1152
19 Ga0070668_101092727 3300005347 Unclassified 720
20 Ga0070675_100000053 3300005354 Bacteria 70601
21 Ga0070674_100040199 3300005356 Bacteria 3163
22 Ga0070688_100000012 3300005365 Bacteria 79406
23 Ga0070688_100000269 3300005365 Bacteria 26936
24 Ga0070688_100432164 3300005365 Bacteria 981
25 Ga0070659_100059978 3300005366 Bacteria 3005
26 Ga0070667_100089153 3300005367 Bacteria 2649
27 Ga0070667_100097835 3300005367 Bacteria 2532
28 Ga0070667_100896334 3300005367 Bacteria 825
29 Ga0070703_10061409 3300005406 Bacteria 1231
30 Ga0070714_100114839 3300005435 Bacteria 2389
31 Ga0070714_100497073 3300005435 Bacteria 1163
32 Ga0070714_101152782 3300005435 Unclassified 756
33 Ga0070713_100000009 3300005436 Bacteria 153056
34 Ga0070710_10396653 3300005437 Bacteria 924
35 Ga0070711_100032239 3300005439 Bacteria 3483
36 Ga0070711_101217331 3300005439 Unclassified 652
37 Ga0070700_100143604 3300005441 Bacteria 1625
38 Ga0070708_101161318 3300005445 Bacteria 723
39 Ga0070663_100080494 3300005455 Bacteria 2392
40 Ga0070663_100990936 3300005455 Unclassified 730
41 Ga0070678_100013493 3300005456 Bacteria 5126
42 Ga0070678_100154478 3300005456 Bacteria 1852
43 Ga0070662_100000007 3300005457 Bacteria 168761
44 Ga0068867_100006976 3300005459 Bacteria 7985
45 Ga0070685_10000018 3300005466 Bacteria 110132
46 Ga0070685_10000142 3300005466 Bacteria 46324
47 Ga0070684_100021244 3300005535 Bacteria 5397
48 Ga0070684_100094433 3300005535 Bacteria 2664
49 Ga0070684_100349078 3300005535 Bacteria 1361
50 Ga0070684_101884181 3300005535 Bacteria 564
51 Ga0068853_100479025 3300005539 Bacteria 1173
52 Ga0068853_100577507 3300005539 Bacteria 1066
53 Ga0070672_100000030 3300005543 Bacteria 62612
54 Ga0070695_100341647 3300005545 Bacteria 1119
55 Ga0070693_100003779 3300005547 Bacteria 7085
56 Ga0070665_100001190 3300005548 Bacteria 31771
57 Ga0070665_100074455 3300005548 Bacteria 3402
58 Ga0068855_100279893 3300005563 Bacteria 1853
59 Ga0070664_100027503 3300005564 Bacteria 4727
60 Ga0070664_100042879 3300005564 Bacteria 3818
61 Ga0068854_100000031 3300005578 Bacteria 107298
62 Ga0068856_100002986 3300005614 Bacteria 17301
63 Ga0068856_100015030 3300005614 Bacteria 7475
64 Ga0068852_100000012 3300005616 Bacteria 140734
65 Ga0068864_100000178 3300005618 Bacteria 58416
66 Ga0068866_10000001 3300005718 Bacteria 519680
67 Ga0068866_10094719 3300005718 Bacteria 1634
68 Ga0068861_100174641 3300005719 Bacteria 1783
69 Ga0068861_100373323 3300005719 Bacteria 1258
70 Ga0068851_10001764 3300005834 Bacteria 9453
71 Ga0068851_10153145 3300005834 Bacteria 1262
72 Ga0068870_10119676 3300005840 Bacteria 1515
73 Ga0081540_1000006 3300005983 Bacteria 208724
74 Ga0081539_10001003 3300005985 Bacteria 52435
75 Ga0070712_100001362 3300006175 Bacteria 14813
76 Ga0097621_100200576 3300006237 Bacteria 1732
77 Ga0068865_100007743 3300006881 Bacteria 6621
78 Ga0068865_101885431 3300006881 Unclassified 541
79 Ga0075436_100301226 3300006914 Bacteria 1149
80 Ga0075435_100235135 3300007076 Bacteria 1557
81 Ga0105245_10000180 3300009098 Bacteria 59695
82 Ga0105245_10014301 3300009098 Bacteria 6917
83 Ga0105247_10060828 3300009101 Bacteria 2341
84 Ga0105243_10010482 3300009148 Bacteria 7038
85 Ga0105242_10000132 3300009176 Bacteria 54347
86 Ga0105242_11034070 3300009176 Bacteria 831
87 Ga0105248_10000032 3300009177 Bacteria 201114
88 Ga0105248_11970455 3300009177 Unclassified 663
89 Ga0105239_10461868 3300010375 Unclassified 1441
90 Ga0105239_10564520 3300010375 Bacteria 1297
91 Ga0105239_11068644 3300010375 Bacteria 929
92 Ga0157338_1010387 3300012515 Bacteria 939
93 Ga0157371_10013940 3300013102 Bacteria 6088
94 Ga0157370_10022277 3300013104 Bacteria 6305
95 Ga0157370_10245822 3300013104 Bacteria 1655
96 Ga0157369_10000142 3300013105 Bacteria 101760
97 Ga0157374_10001471 3300013296 Bacteria 19884
98 Ga0157378_10002558 3300013297 Bacteria 16176
99 Ga0163162_11011880 3300013306 Unclassified 940
100 Ga0157372_10000308 3300013307 Bacteria 54161
101 Ga0157375_10005331 3300013308 Bacteria 11173
102 Ga0157375_10168413 3300013308 Bacteria 2337
103 Ga0157375_13531519 3300013308 Bacteria 520
104 Ga0163163_10273026 3300014325 Bacteria 1742
105 Ga0163163_12550092 3300014325 Bacteria 569
106 Ga0157380_10000059 3300014326 Bacteria 62280
107 Ga0157380_10000158 3300014326 Bacteria 39132
108 Ga0157379_10142539 3300014968 Bacteria 2160
109 Ga0163161_10010179 3300017792 Bacteria 6510
110 Ga0206354_10274000 3300020081 Unclassified 562
111 Ga0206353_11095854 3300020082 Bacteria 1249
112 Ga0207656_10000321 3300025321 Bacteria 16492
113 Ga0207656_10086999 3300025321 Bacteria 1413
114 Ga0207642_10000006 3300025899 Bacteria 230268
115 Ga0207642_10000007 3300025899 Bacteria 226017
116 Ga0207642_10020993 3300025899 Bacteria 2562
117 Ga0207710_10036674 3300025900 Bacteria 2162
118 Ga0207680_10010817 3300025903 Bacteria 4581
119 Ga0207685_10000011 3300025905 Bacteria 213430
120 Ga0207643_10027450 3300025908 Bacteria 3156
121 Ga0207693_10007556 3300025915 Bacteria 8932
122 Ga0207663_10000683 3300025916 Bacteria 15043
123 Ga0207663_10047452 3300025916 Bacteria 2652
124 Ga0207649_10000076 3300025920 Bacteria 83824
125 Ga0207650_10199880 3300025925 Bacteria 1601
126 Ga0207659_10000010 3300025926 Bacteria 286639
127 Ga0207687_10000007 3300025927 Bacteria 604185
128 Ga0207687_10005996 3300025927 Bacteria 8042
129 Ga0207687_10876489 3300025927 Unclassified 767
130 Ga0207700_10000025 3300025928 Bacteria 147429
131 Ga0207664_10077345 3300025929 Bacteria 2696
132 Ga0207664_10425760 3300025929 Bacteria 1183
133 Ga0207664_10799033 3300025929 Unclassified 849
134 Ga0207690_10068934 3300025932 Bacteria 2432
135 Ga0207706_10000018 3300025933 Bacteria 168729
136 Ga0207686_10000289 3300025934 Bacteria 37190
137 Ga0207686_10089760 3300025934 Bacteria 2026
138 Ga0207709_10025347 3300025935 Bacteria 3394
139 Ga0207669_10000009 3300025937 Bacteria 168012
140 Ga0207704_10000720 3300025938 Bacteria 14555
141 Ga0207704_10851061 3300025938 Unclassified 764
142 Ga0207691_10000190 3300025940 Bacteria 58438
143 Ga0207711_10000020 3300025941 Bacteria 363325
144 Ga0207689_11258278 3300025942 Unclassified 622
145 Ga0207661_10000403 3300025944 Bacteria 27999
146 Ga0207661_10001894 3300025944 Bacteria 14344
147 Ga0207661_10282670 3300025944 Bacteria 1483
148 Ga0207661_10496946 3300025944 Bacteria 1114
149 Ga0207661_10702281 3300025944 Bacteria 930
150 Ga0207679_10036209 3300025945 Bacteria 3498
151 Ga0207679_10054264 3300025945 Bacteria 2950
152 Ga0207667_10298194 3300025949 Bacteria 1647
153 Ga0207668_10186562 3300025972 Bacteria 1640
154 Ga0207640_10000015 3300025981 Bacteria 215411
155 Ga0207658_10062245 3300025986 Bacteria 2792
156 Ga0207658_10869027 3300025986 Bacteria 820
157 Ga0207677_10000392 3300026023 Bacteria 30151
158 Ga0207677_10000821 3300026023 Bacteria 17760
159 Ga0207639_10404291 3300026041 Bacteria 1231
160 Ga0207678_10177570 3300026067 Bacteria 1818
161 Ga0207708_10334965 3300026075 Bacteria 1238
162 Ga0207702_10000016 3300026078 Bacteria 226633
163 Ga0207702_10012239 3300026078 Bacteria 7139
164 Ga0207641_11345756 3300026088 Unclassified 715
165 Ga0207648_10007579 3300026089 Bacteria 10644
166 Ga0207676_10000016 3300026095 Bacteria 311561
167 Ga0207675_100095790 3300026118 Bacteria 2793
168 Ga0207683_10066521 3300026121 Bacteria 3178
169 Ga0207683_10444049 3300026121 Bacteria 1195
170 Ga0207698_10000012 3300026142 Bacteria 260061
171 Ga0268266_10001355 3300028379 Bacteria 29570
172 Ga0268266_10012151 3300028379 Bacteria 7452
173 Ga0268266_10034345 3300028379 Bacteria 4313
174 Ga0268264_10002386 3300028381 Bacteria 16562
175 Ga0265326_10120468 3300028558 Bacteria 746
176 Ga0307416_101436103 3300032002 Unclassified 796
177 Ga0307415_100007188 3300032126 Bacteria 6073
178 Ga0451843_0517082 3300041509 Bacteria 849
179 Ga0466963_0035111 3300044694 Bacteria 3265
180 Ga0466957_0027966 3300044842 Bacteria 3354
181 Ga0466957_0066244 3300044842 Bacteria 2226
182 Ga0466967_0000033 3300045976 Bacteria 54859
183 Ga0466967_0136531 3300045976 Bacteria 2281
184 Ga0466967_0655118 3300045976 Bacteria 1038
185 Ga0495592_0162156 3300046454 Bacteria 1537
186 Ga0495592_0222843 3300046454 Bacteria 1260
187 Ga0495603_0007993 3300046455 Bacteria 6385
188 Ga0495629_0006408 3300046459 Bacteria 8724
189 Ga0495629_0007203 3300046459 Bacteria 8190
190 Ga0495629_0056991 3300046459 Bacteria 2732
191 Ga0495638_0026258 3300046460 Bacteria 3776
192 Ga0495641_0037466 3300046461 Bacteria 2272
193 Ga0495641_0122959 3300046461 Bacteria 1158
194 Ga0495641_0175704 3300046461 Bacteria 958
195 Ga0495651_0181567 3300046462 Bacteria 1489
196 Ga0495651_0432591 3300046462 Bacteria 853
197 Ga0495582_0000027 3300046473 Bacteria 79970
198 Ga0495662_0000749 3300046476 Bacteria 15587
199 Ga0495662_0007928 3300046476 Bacteria 5227
200 Ga0495662_0023135 3300046476 Bacteria 3001
201 Ga0495664_0914104 3300046477 Unclassified 513
202 Ga0495594_0000003 3300046499 Bacteria 199267
203 Ga0495606_0000221 3300046507 Bacteria 101157
204 Ga0495608_0000031 3300046511 Bacteria 145255
205 Ga0495608_0193946 3300046511 Bacteria 1282
206 Ga0495608_0318022 3300046511 Bacteria 962
207 Ga0495608_0526128 3300046511 Bacteria 714
208 Ga0495628_0000595 3300046516 Bacteria 33337
209 Ga0495628_0292610 3300046516 Bacteria 1207
210 Ga0495630_0000018 3300046517 Bacteria 186064
211 Ga0495630_0000494 3300046517 Bacteria 29152
212 Ga0495630_0713555 3300046517 Unclassified 767
213 Ga0495652_0000019 3300046529 Bacteria 190248
214 Ga0495587_0001523 3300046536 Bacteria 15407
215 Ga0495587_0058518 3300046536 Bacteria 2264
216 Ga0495587_0067632 3300046536 Bacteria 2082
217 Ga0495587_0087602 3300046536 Bacteria 1802
218 Ga0495598_0000203 3300046537 Bacteria 10475
219 Ga0495621_0001660 3300046539 Bacteria 5832
220 Ga0495645_0112558 3300046543 Bacteria 1924
221 Ga0495622_0000014 3300046557 Bacteria 182142
222 Ga0495634_0000050 3300046642 Bacteria 94546
223 Ga0495634_0001942 3300046642 Bacteria 17687
224 Ga0495634_0010085 3300046642 Bacteria 6934
225 Ga0495634_0110868 3300046642 Bacteria 1764
226 Ga0495625_0000122 3300046660 Bacteria 121146
227 Ga0495635_0069512 3300046663 Bacteria 2414
228 Ga0495635_0411560 3300046663 Bacteria 897
229 Ga0495588_0000376 3300046674 Bacteria 26068
230 Ga0495657_0000024 3300046675 Bacteria 145255
231 Ga0495599_0891789 3300046678 Unclassified 504
232 Ga0495647_0000228 3300046681 Bacteria 15271
233 Ga0495658_0000025 3300046683 Bacteria 79910
234 Ga0495658_0800006 3300046683 Bacteria 604
235 Ga0495669_0142386 3300046684 Unclassified 1132
236 Ga0495669_0264597 3300046684 Bacteria 826
237 Ga0495613_0000073 3300046689 Bacteria 98688
238 Ga0495624_0000037 3300046690 Bacteria 83796
239 Ga0495670_0009984 3300046691 Bacteria 4668
240 Ga0495604_0000073 3300047317 Bacteria 86844
241 Ga0495604_0005183 3300047317 Bacteria 10324
242 Ga0495672_0171153 3300047320 Unclassified 1108
243 Ga0495672_0299410 3300047320 Unclassified 762
244 Ga0495676_0311913 3300047321 Bacteria 1058
245 Ga0495675_0000090 3300047444 Bacteria 63705
246 Ga0495684_0150103 3300047471 Bacteria 1743
247 Ga0495686_0136097 3300047472 Bacteria 1453
248 Ga0495593_0040235 3300047673 Bacteria 2517
249 Ga0495593_0156650 3300047673 Bacteria 1151
250 Ga0495602_0000021 3300048088 Bacteria 168585
251 Ga0495602_0001155 3300048088 Bacteria 25844
252 Ga0495602_0497742 3300048088 Bacteria 852
253 Ga0496102_0000146 3300048905 Bacteria 96361
254 Ga0496102_1481645 3300048905 Unclassified 597
255 Ga0496103_0000043 3300048906 Bacteria 167983
256 Ga0496104_0010527 3300048907 Bacteria 8262
257 Ga0496104_0021284 3300048907 Bacteria 5951
258 Ga0496105_0016463 3300048908 Bacteria 5904
259 Ga0496105_1073460 3300048908 Bacteria 599
260 Ga0496106_0000138 3300048909 Bacteria 54275
261 Ga0496107_0926391 3300048910 Unclassified 634
262 Ga0496108_0000150 3300048911 Bacteria 67068
263 Ga0496108_0018497 3300048911 Bacteria 5706
264 Ga0496108_0263253 3300048911 Bacteria 1501
265 Ga0496109_0000007 3300048912 Bacteria 247554
266 Ga0496109_0000028 3300048912 Bacteria 168138
267 Ga0496109_0838405 3300048912 Bacteria 857
268 Ga0496110_0000105 3300048913 Bacteria 45468
269 Ga0496110_0044429 3300048913 Bacteria 3880
270 Ga0496110_0145864 3300048913 Bacteria 2141
271 Ga0496111_0000261 3300048914 Bacteria 25723
272 Ga0496111_0627652 3300048914 Bacteria 785
273 Ga0496112_0000003 3300048915 Bacteria 660147
274 Ga0496112_0000938 3300048915 Bacteria 21148
275 Ga0496112_0228859 3300048915 Bacteria 1814
276 Ga0496113_0000007 3300048916 Bacteria 95884
277 Ga0496113_0011498 3300048916 Bacteria 5909
278 Ga0496113_0980167 3300048916 Bacteria 666
279 Ga0496114_0000014 3300048917 Bacteria 297902
280 Ga0496114_0353207 3300048917 Bacteria 1300
281 Ga0496115_0000003 3300048918 Bacteria 354994
282 Ga0496115_0000316 3300048918 Bacteria 41025
283 Ga0496124_0292610 3300048927 Bacteria 1181
284 Ga0501040_0670183 3300049576 Bacteria 750
285 Ga0501042_0104753 3300049578 Bacteria 2035
286 Ga0501042_0294378 3300049578 Bacteria 1172
287 Ga0501042_0924041 3300049578 Bacteria 635
288 Ga0501047_0894902 3300049581 Bacteria 701
289 Ga0501075_0001131 3300049591 Bacteria 17202
290 Ga0501075_0928926 3300049591 Bacteria 661
291 Ga0501076_0346088 3300049592 Bacteria 1220
292 Ga0501077_0208141 3300049593 Bacteria 1243
293 Ga0501081_0617525 3300049743 Bacteria 812
294 Ga0501081_0735356 3300049743 Bacteria 741
295 Ga0501035_1048055 3300049822 Bacteria 639
296 nmdc:mga08x19_122218_c1 3300050514 Bacteria 1746
297 Ga0495601_0000039 3300053077 Bacteria 79594
298 Ga0495601_0032904 3300053077 Bacteria 3229
299 Ga0495601_0159680 3300053077 Bacteria 1473
300 Ga0495601_0356680 3300053077 Bacteria 950
301 Ga0495601_0474031 3300053077 Unclassified 809
302 Ga0495612_0003451 3300053078 Bacteria 6551
303 Ga0495612_0007882 3300053078 Bacteria 4342
304 Ga0495655_0000001 3300053083 Bacteria 419518
305 Ga0495655_0010629 3300053083 Bacteria 1822
306 Ga0495595_0000014 3300053084 Bacteria 145255
307 Ga0495619_0000114 3300053085 Bacteria 59624
308 Ga0495619_0000135 3300053085 Bacteria 54848
309 Ga0495619_0000243 3300053085 Bacteria 39638
310 Ga0495619_0000416 3300053085 Bacteria 28900
311 Ga0495619_0002645 3300053085 Bacteria 11706
312 Ga0495619_0005724 3300053085 Bacteria 7881
313 Ga0495619_0253564 3300053085 Bacteria 1219
314 Ga0495619_0291692 3300053085 Bacteria 1130
315 Ga0500566_0195665 3300053094 Bacteria 1025
316 Ga0500628_000017 3300053129 Bacteria 90481

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300010375 Ga0105239_10564520 Ga0105239_105645202 112
2 3300014325 Ga0163163_10273026 Ga0163163_102730262 112
3 3300048918 Ga0496115_0000003 Ga0496115_0000003_342886_343287 112
4 3300048913 Ga0496110_0145864 Ga0496110_0145864_567_911 114
5 3300046476 Ga0495662_0000749 Ga0495662_0000749_1872_2273 116
6 3300053083 Ga0495655_0000001 Ga0495655_0000001_33619_34023 118
7 3300053129 Ga0500628_000017 Ga0500628_000017_63244_63648 118
8 3300010375 Ga0105239_11068644 Ga0105239_110686442 119
9 3300046642 Ga0495634_0000050 Ga0495634_0000050_79193_79558 119
10 3300005329 Ga0070683_100250599 Ga0070683_1002505992 120
11 3300005356 Ga0070674_100040199 Ga0070674_1000401994 120
12 3300005435 Ga0070714_100114839 Ga0070714_1001148392 120
13 3300005535 Ga0070684_100094433 Ga0070684_1000944332 120
14 3300005564 Ga0070664_100027503 Ga0070664_1000275032 120
15 3300006237 Ga0097621_100200576 Ga0097621_1002005762 120
16 3300014325 Ga0163163_12550092 Ga0163163_125500921 120
17 3300025929 Ga0207664_10077345 Ga0207664_100773452 120
18 3300025944 Ga0207661_10282670 Ga0207661_102826702 120
19 3300025945 Ga0207679_10036209 Ga0207679_100362093 120
20 3300045976 Ga0466967_0655118 Ga0466967_0655118_273_638 120
21 3300046476 Ga0495662_0023135 Ga0495662_0023135_2004_2366 120
22 3300046543 Ga0495645_0112558 Ga0495645_0112558_815_1177 120
23 3300046642 Ga0495634_0001942 Ga0495634_0001942_2498_2860 120
24 3300046642 Ga0495634_0010085 Ga0495634_0010085_2350_2712 120
25 3300046663 Ga0495635_0069512 Ga0495635_0069512_1301_1663 120
26 3300046684 Ga0495669_0142386 Ga0495669_0142386_23_385 120
27 3300047673 Ga0495593_0156650 Ga0495593_0156650_753_1115 120
28 3300048907 Ga0496104_0021284 Ga0496104_0021284_1941_2354 120
29 3300048908 Ga0496105_0016463 Ga0496105_0016463_1068_1481 120
30 3300048911 Ga0496108_0263253 Ga0496108_0263253_685_1047 120
31 3300048915 Ga0496112_0228859 Ga0496112_0228859_1330_1692 120
32 3300048916 Ga0496113_0011498 Ga0496113_0011498_147_509 120
33 3300053077 Ga0495601_0474031 Ga0495601_0474031_405_767 120
34 3300053078 Ga0495612_0007882 Ga0495612_0007882_2004_2366 120
35 3300053085 Ga0495619_0005724 Ga0495619_0005724_5665_6027 120
36 3300053085 Ga0495619_0253564 Ga0495619_0253564_576_938 120
37 3300053085 Ga0495619_0291692 Ga0495619_0291692_524_886 120
38 3300009098 Ga0105245_10000180 Ga0105245_1000018043 121
39 3300041509 Ga0451843_0517082 Ga0451843_0517082_467_832 121
40 3300045976 Ga0466967_0136531 Ga0466967_0136531_947_1312 121
41 3300046516 Ga0495628_0292610 Ga0495628_0292610_326_697 121
42 3300046517 Ga0495630_0000494 Ga0495630_0000494_3919_4290 121
43 3300046642 Ga0495634_0110868 Ga0495634_0110868_651_1022 121
44 3300046663 Ga0495635_0411560 Ga0495635_0411560_364_735 121
45 3300046678 Ga0495599_0891789 Ga0495599_0891789_67_438 121
46 3300047471 Ga0495684_0150103 Ga0495684_0150103_575_946 121
47 3300048908 Ga0496105_1073460 Ga0496105_1073460_204_569 121
48 3300053077 Ga0495601_0356680 Ga0495601_0356680_320_691 121
49 3300053085 Ga0495619_0000416 Ga0495619_0000416_27955_28326 121
50 3300046454 Ga0495592_0222843 Ga0495592_0222843_693_1070 122
51 3300046462 Ga0495651_0181567 Ga0495651_0181567_381_758 122
52 3300046511 Ga0495608_0193946 Ga0495608_0193946_259_636 124
53 3300053077 Ga0495601_0032904 Ga0495601_0032904_1388_1810 124
54 3300005456 Ga0070678_100013493 Ga0070678_1000134932 125
55 3300009176 Ga0105242_10000132 Ga0105242_1000013214 125
56 3300025927 Ga0207687_10876489 Ga0207687_108764892 125
57 3300025934 Ga0207686_10000289 Ga0207686_1000028932 125
58 3300026088 Ga0207641_11345756 Ga0207641_113457561 125
59 3300026121 Ga0207683_10066521 Ga0207683_100665213 125
60 3300046691 Ga0495670_0009984 Ga0495670_0009984_4278_4655 125
61 3300047320 Ga0495672_0299410 Ga0495672_0299410_218_595 125
62 3300046462 Ga0495651_0432591 Ga0495651_0432591_378_779 126
63 3300005344 Ga0070661_100000599 Ga0070661_1000005997 128
64 3300025920 Ga0207649_10000076 Ga0207649_1000007637 128
65 3300046536 Ga0495587_0067632 Ga0495587_0067632_831_1223 128
66 3300048909 Ga0496106_0000138 Ga0496106_0000138_52043_52432 128
67 3300048910 Ga0496107_0926391 Ga0496107_0926391_149_538 128
68 3300053085 Ga0495619_0002645 Ga0495619_0002645_4216_4611 129
69 3300007076 Ga0075435_100235135 Ga0075435_1002351352 130
70 3300009176 Ga0105242_11034070 Ga0105242_110340702 130
71 3300010375 Ga0105239_10461868 Ga0105239_104618681 130
72 3300013308 Ga0157375_13531519 Ga0157375_135315191 130
73 3300025934 Ga0207686_10089760 Ga0207686_100897603 130
74 3300046455 Ga0495603_0007993 Ga0495603_0007993_1889_2290 130
75 3300046459 Ga0495629_0056991 Ga0495629_0056991_1896_2297 130
76 3300046461 Ga0495641_0122959 Ga0495641_0122959_443_844 130
77 3300046536 Ga0495587_0087602 Ga0495587_0087602_456_860 130
78 3300048914 Ga0496111_0627652 Ga0496111_0627652_80_478 130
79 3300053078 Ga0495612_0003451 Ga0495612_0003451_3685_4083 130
80 3300005329 Ga0070683_101139667 Ga0070683_1011396671 131
81 3300005338 Ga0068868_100004773 Ga0068868_1000047737 131
82 3300005340 Ga0070689_101860831 Ga0070689_1018608311 131
83 3300005365 Ga0070688_100000012 Ga0070688_10000001249 131
84 3300005406 Ga0070703_10061409 Ga0070703_100614092 131
85 3300005445 Ga0070708_101161318 Ga0070708_1011613182 131
86 3300005455 Ga0070663_100080494 Ga0070663_1000804942 131
87 3300005456 Ga0070678_100154478 Ga0070678_1001544782 131
88 3300005457 Ga0070662_100000007 Ga0070662_100000007184 131
89 3300005459 Ga0068867_100006976 Ga0068867_1000069763 131
90 3300005466 Ga0070685_10000142 Ga0070685_1000014210 131
91 3300005563 Ga0068855_100279893 Ga0068855_1002798933 131
92 3300005718 Ga0068866_10000001 Ga0068866_10000001166 131
93 3300005840 Ga0068870_10119676 Ga0068870_101196762 131
94 3300009101 Ga0105247_10060828 Ga0105247_100608283 131
95 3300009177 Ga0105248_11970455 Ga0105248_119704551 131
96 3300013296 Ga0157374_10001471 Ga0157374_100014715 131
97 3300014326 Ga0157380_10000158 Ga0157380_100001588 131
98 3300014968 Ga0157379_10142539 Ga0157379_101425393 131
99 3300025899 Ga0207642_10000006 Ga0207642_10000006169 131
100 3300025899 Ga0207642_10000007 Ga0207642_1000000766 131
101 3300025900 Ga0207710_10036674 Ga0207710_100366743 131
102 3300025905 Ga0207685_10000011 Ga0207685_10000011138 131
103 3300025908 Ga0207643_10027450 Ga0207643_100274502 131
104 3300025916 Ga0207663_10000683 Ga0207663_100006839 131
105 3300025933 Ga0207706_10000018 Ga0207706_100000182 131
106 3300025937 Ga0207669_10000009 Ga0207669_10000009165 131
107 3300025944 Ga0207661_10496946 Ga0207661_104969462 131
108 3300025949 Ga0207667_10298194 Ga0207667_102981942 131
109 3300026023 Ga0207677_10000821 Ga0207677_100008217 131
110 3300026067 Ga0207678_10177570 Ga0207678_101775703 131
111 3300026089 Ga0207648_10007579 Ga0207648_100075799 131
112 3300026121 Ga0207683_10444049 Ga0207683_104440492 131
113 3300028381 Ga0268264_10002386 Ga0268264_1000238610 131
114 3300046473 Ga0495582_0000027 Ga0495582_0000027_66632_67042 131
115 3300046511 Ga0495608_0526128 Ga0495608_0526128_156_563 131
116 3300046537 Ga0495598_0000203 Ga0495598_0000203_6453_6854 131
117 3300046539 Ga0495621_0001660 Ga0495621_0001660_694_1098 131
118 3300046683 Ga0495658_0000025 Ga0495658_0000025_66632_67042 131
119 3300048088 Ga0495602_0497742 Ga0495602_0497742_40_441 131
120 3300048912 Ga0496109_0838405 Ga0496109_0838405_402_812 131
121 3300048915 Ga0496112_0000003 Ga0496112_0000003_191628_192032 131
122 3300048916 Ga0496113_0980167 Ga0496113_0980167_39_443 131
123 3300049576 Ga0501040_0670183 Ga0501040_0670183_235_636 131
124 3300049578 Ga0501042_0104753 Ga0501042_0104753_1195_1599 131
125 3300049591 Ga0501075_0001131 Ga0501075_0001131_16632_17036 131
126 3300049591 Ga0501075_0928926 Ga0501075_0928926_216_617 131
127 3300049743 Ga0501081_0617525 Ga0501081_0617525_387_788 131
128 3300049743 Ga0501081_0735356 Ga0501081_0735356_100_501 131
129 3300049822 Ga0501035_1048055 Ga0501035_1048055_75_476 131
130 3300005329 Ga0070683_100000501 Ga0070683_1000005012 132
131 3300005338 Ga0068868_100004331 Ga0068868_1000043312 132
132 3300005367 Ga0070667_100089153 Ga0070667_1000891532 132
133 3300005535 Ga0070684_100349078 Ga0070684_1003490782 132
134 3300005535 Ga0070684_101884181 Ga0070684_1018841811 132
135 3300005543 Ga0070672_100000030 Ga0070672_10000003032 132
136 3300005547 Ga0070693_100003779 Ga0070693_1000037792 132
137 3300005548 Ga0070665_100001190 Ga0070665_10000119033 132
138 3300005618 Ga0068864_100000178 Ga0068864_10000017815 132
139 3300005719 Ga0068861_100174641 Ga0068861_1001746412 132
140 3300005719 Ga0068861_100373323 Ga0068861_1003733232 132
141 3300005834 Ga0068851_10153145 Ga0068851_101531452 132
142 3300005983 Ga0081540_1000006 Ga0081540_1000006148 132
143 3300006175 Ga0070712_100001362 Ga0070712_10000136210 132
144 3300013308 Ga0157375_10168413 Ga0157375_101684133 132
145 3300014326 Ga0157380_10000059 Ga0157380_1000005963 132
146 3300025321 Ga0207656_10086999 Ga0207656_100869992 132
147 3300025915 Ga0207693_10007556 Ga0207693_100075563 132
148 3300025940 Ga0207691_10000190 Ga0207691_1000019013 132
149 3300025944 Ga0207661_10001894 Ga0207661_100018946 132
150 3300025986 Ga0207658_10062245 Ga0207658_100622452 132
151 3300026023 Ga0207677_10000392 Ga0207677_1000039210 132
152 3300026095 Ga0207676_10000016 Ga0207676_10000016176 132
153 3300026118 Ga0207675_100095790 Ga0207675_1000957903 132
154 3300028379 Ga0268266_10001355 Ga0268266_100013552 132
155 3300046459 Ga0495629_0007203 Ga0495629_0007203_2222_2626 132
156 3300046477 Ga0495664_0914104 Ga0495664_0914104_17_427 132
157 3300046499 Ga0495594_0000003 Ga0495594_0000003_15740_16150 132
158 3300046507 Ga0495606_0000221 Ga0495606_0000221_90467_90871 132
159 3300046557 Ga0495622_0000014 Ga0495622_0000014_56446_56856 132
160 3300047673 Ga0495593_0040235 Ga0495593_0040235_1532_1936 132
161 3300048913 Ga0496110_0044429 Ga0496110_0044429_279_683 132
162 3300048917 Ga0496114_0353207 Ga0496114_0353207_654_1052 132
163 3300048927 Ga0496124_0292610 Ga0496124_0292610_319_723 132
164 3300049592 Ga0501076_0346088 Ga0501076_0346088_66_464 132
165 3300053085 Ga0495619_0000243 Ga0495619_0000243_30641_31048 132
166 3300005329 Ga0070683_100003289 Ga0070683_10000328912 133
167 3300005329 Ga0070683_100494267 Ga0070683_1004942672 133
168 3300005330 Ga0070690_100125247 Ga0070690_1001252472 133
169 3300005334 Ga0068869_101014645 Ga0068869_1010146452 133
170 3300005335 Ga0070666_10043488 Ga0070666_100434883 133
171 3300005344 Ga0070661_100279133 Ga0070661_1002791332 133
172 3300005347 Ga0070668_101092727 Ga0070668_1010927271 133
173 3300005354 Ga0070675_100000053 Ga0070675_10000005310 133
174 3300005366 Ga0070659_100059978 Ga0070659_1000599783 133
175 3300005367 Ga0070667_100097835 Ga0070667_1000978352 133
176 3300005439 Ga0070711_100032239 Ga0070711_1000322394 133
177 3300005455 Ga0070663_100990936 Ga0070663_1009909361 133
178 3300005535 Ga0070684_100021244 Ga0070684_1000212445 133
179 3300005548 Ga0070665_100074455 Ga0070665_1000744552 133
180 3300005564 Ga0070664_100042879 Ga0070664_1000428795 133
181 3300005616 Ga0068852_100000012 Ga0068852_10000001253 133
182 3300005718 Ga0068866_10094719 Ga0068866_100947192 133
183 3300006881 Ga0068865_100007743 Ga0068865_1000077433 133
184 3300006881 Ga0068865_101885431 Ga0068865_1018854311 133
185 3300009148 Ga0105243_10010482 Ga0105243_100104827 133
186 3300009177 Ga0105248_10000032 Ga0105248_10000032198 133
187 3300013105 Ga0157369_10000142 Ga0157369_1000014255 133
188 3300013297 Ga0157378_10002558 Ga0157378_100025585 133
189 3300013306 Ga0163162_11011880 Ga0163162_110118802 133
190 3300025899 Ga0207642_10020993 Ga0207642_100209933 133
191 3300025903 Ga0207680_10010817 Ga0207680_100108175 133
192 3300025916 Ga0207663_10047452 Ga0207663_100474523 133
193 3300025926 Ga0207659_10000010 Ga0207659_10000010289 133
194 3300025927 Ga0207687_10000007 Ga0207687_10000007198 133
195 3300025932 Ga0207690_10068934 Ga0207690_100689342 133
196 3300025935 Ga0207709_10025347 Ga0207709_100253473 133
197 3300025938 Ga0207704_10000720 Ga0207704_100007206 133
198 3300025938 Ga0207704_10851061 Ga0207704_108510612 133
199 3300025941 Ga0207711_10000020 Ga0207711_10000020176 133
200 3300025942 Ga0207689_11258278 Ga0207689_112582781 133
201 3300025944 Ga0207661_10000403 Ga0207661_100004039 133
202 3300025945 Ga0207679_10054264 Ga0207679_100542643 133
203 3300025972 Ga0207668_10186562 Ga0207668_101865623 133
204 3300026142 Ga0207698_10000012 Ga0207698_10000012173 133
205 3300028379 Ga0268266_10034345 Ga0268266_100343453 133
206 3300046460 Ga0495638_0026258 Ga0495638_0026258_130_531 133
207 3300046461 Ga0495641_0037466 Ga0495641_0037466_1428_1838 133
208 3300046476 Ga0495662_0007928 Ga0495662_0007928_486_887 133
209 3300046511 Ga0495608_0000031 Ga0495608_0000031_77217_77624 133
210 3300046517 Ga0495630_0000018 Ga0495630_0000018_83031_83441 133
211 3300046529 Ga0495652_0000019 Ga0495652_0000019_158547_158960 133
212 3300046536 Ga0495587_0058518 Ga0495587_0058518_408_821 133
213 3300046674 Ga0495588_0000376 Ga0495588_0000376_6853_7257 133
214 3300046675 Ga0495657_0000024 Ga0495657_0000024_77217_77624 133
215 3300046681 Ga0495647_0000228 Ga0495647_0000228_3582_3992 133
216 3300046689 Ga0495613_0000073 Ga0495613_0000073_70394_70795 133
217 3300046690 Ga0495624_0000037 Ga0495624_0000037_17075_17476 133
218 3300047317 Ga0495604_0000073 Ga0495604_0000073_72596_72997 133
219 3300047317 Ga0495604_0005183 Ga0495604_0005183_6027_6428 133
220 3300047320 Ga0495672_0171153 Ga0495672_0171153_311_712 133
221 3300047321 Ga0495676_0311913 Ga0495676_0311913_200_610 133
222 3300047444 Ga0495675_0000090 Ga0495675_0000090_28734_29141 133
223 3300047472 Ga0495686_0136097 Ga0495686_0136097_317_718 133
224 3300048088 Ga0495602_0000021 Ga0495602_0000021_55354_55755 133
225 3300048907 Ga0496104_0010527 Ga0496104_0010527_5232_5633 133
226 3300048911 Ga0496108_0018497 Ga0496108_0018497_1687_2091 133
227 3300048912 Ga0496109_0000028 Ga0496109_0000028_84213_84617 133
228 3300048913 Ga0496110_0000105 Ga0496110_0000105_23135_23542 133
229 3300048914 Ga0496111_0000261 Ga0496111_0000261_18666_19073 133
230 3300049578 Ga0501042_0924041 Ga0501042_0924041_154_555 133
231 3300049593 Ga0501077_0208141 Ga0501077_0208141_208_609 133
232 3300053077 Ga0495601_0000039 Ga0495601_0000039_57815_58216 133
233 3300053077 Ga0495601_0159680 Ga0495601_0159680_371_778 133
234 3300053083 Ga0495655_0010629 Ga0495655_0010629_874_1275 133
235 3300053084 Ga0495595_0000014 Ga0495595_0000014_67632_68039 133
236 3300053085 Ga0495619_0000114 Ga0495619_0000114_43502_43909 133
237 3300053085 Ga0495619_0000135 Ga0495619_0000135_22218_22625 133
238 3300003320 rootH2_10111100 rootH2_101111002 134
239 3300005337 Ga0070682_100000421 Ga0070682_10000042114 134
240 3300005337 Ga0070682_100108898 Ga0070682_1001088982 134
241 3300005341 Ga0070691_10004831 Ga0070691_100048317 134
242 3300005345 Ga0070692_10207136 Ga0070692_102071362 134
243 3300005365 Ga0070688_100000269 Ga0070688_10000026911 134
244 3300005365 Ga0070688_100432164 Ga0070688_1004321642 134
245 3300005367 Ga0070667_100896334 Ga0070667_1008963342 134
246 3300005435 Ga0070714_100497073 Ga0070714_1004970732 134
247 3300005435 Ga0070714_101152782 Ga0070714_1011527821 134
248 3300005436 Ga0070713_100000009 Ga0070713_10000000918 134
249 3300005437 Ga0070710_10396653 Ga0070710_103966532 134
250 3300005439 Ga0070711_101217331 Ga0070711_1012173312 134
251 3300005441 Ga0070700_100143604 Ga0070700_1001436041 134
252 3300005466 Ga0070685_10000018 Ga0070685_1000001849 134
253 3300005539 Ga0068853_100479025 Ga0068853_1004790251 134
254 3300005539 Ga0068853_100577507 Ga0068853_1005775071 134
255 3300005545 Ga0070695_100341647 Ga0070695_1003416471 134
256 3300005578 Ga0068854_100000031 Ga0068854_10000003125 134
257 3300005614 Ga0068856_100002986 Ga0068856_10000298610 134
258 3300005614 Ga0068856_100015030 Ga0068856_1000150304 134
259 3300005834 Ga0068851_10001764 Ga0068851_100017648 134
260 3300005985 Ga0081539_10001003 Ga0081539_1000100347 134
261 3300006914 Ga0075436_100301226 Ga0075436_1003012262 134
262 3300009098 Ga0105245_10014301 Ga0105245_100143015 134
263 3300012515 Ga0157338_1010387 Ga0157338_10103871 134
264 3300013102 Ga0157371_10013940 Ga0157371_100139403 134
265 3300013104 Ga0157370_10022277 Ga0157370_100222777 134
266 3300013104 Ga0157370_10245822 Ga0157370_102458222 134
267 3300013307 Ga0157372_10000308 Ga0157372_1000030832 134
268 3300013308 Ga0157375_10005331 Ga0157375_1000533111 134
269 3300017792 Ga0163161_10010179 Ga0163161_100101799 134
270 3300020081 Ga0206354_10274000 Ga0206354_102740002 134
271 3300020082 Ga0206353_11095854 Ga0206353_110958541 134
272 3300025321 Ga0207656_10000321 Ga0207656_100003213 134
273 3300025925 Ga0207650_10199880 Ga0207650_101998802 134
274 3300025927 Ga0207687_10005996 Ga0207687_100059964 134
275 3300025928 Ga0207700_10000025 Ga0207700_1000002518 134
276 3300025929 Ga0207664_10425760 Ga0207664_104257602 134
277 3300025929 Ga0207664_10799033 Ga0207664_107990332 134
278 3300025944 Ga0207661_10702281 Ga0207661_107022811 134
279 3300025981 Ga0207640_10000015 Ga0207640_10000015190 134
280 3300025986 Ga0207658_10869027 Ga0207658_108690272 134
281 3300026041 Ga0207639_10404291 Ga0207639_104042912 134
282 3300026075 Ga0207708_10334965 Ga0207708_103349652 134
283 3300026078 Ga0207702_10000016 Ga0207702_10000016168 134
284 3300026078 Ga0207702_10012239 Ga0207702_100122394 134
285 3300028379 Ga0268266_10012151 Ga0268266_100121512 134
286 3300028558 Ga0265326_10120468 Ga0265326_101204682 134
287 3300032002 Ga0307416_101436103 Ga0307416_1014361032 134
288 3300032126 Ga0307415_100007188 Ga0307415_1000071882 134
289 3300044694 Ga0466963_0035111 Ga0466963_0035111_2660_3064 134
290 3300044842 Ga0466957_0027966 Ga0466957_0027966_1099_1503 134
291 3300044842 Ga0466957_0066244 Ga0466957_0066244_162_566 134
292 3300045976 Ga0466967_0000033 Ga0466967_0000033_39029_39433 134
293 3300046454 Ga0495592_0162156 Ga0495592_0162156_19_423 134
294 3300046459 Ga0495629_0006408 Ga0495629_0006408_2921_3325 134
295 3300046461 Ga0495641_0175704 Ga0495641_0175704_433_837 134
296 3300046511 Ga0495608_0318022 Ga0495608_0318022_437_841 134
297 3300046516 Ga0495628_0000595 Ga0495628_0000595_27373_27777 134
298 3300046517 Ga0495630_0713555 Ga0495630_0713555_136_540 134
299 3300046536 Ga0495587_0001523 Ga0495587_0001523_4646_5050 134
300 3300046660 Ga0495625_0000122 Ga0495625_0000122_61447_61857 134
301 3300046683 Ga0495658_0800006 Ga0495658_0800006_151_555 134
302 3300046684 Ga0495669_0264597 Ga0495669_0264597_122_526 134
303 3300048088 Ga0495602_0001155 Ga0495602_0001155_11261_11665 134
304 3300048905 Ga0496102_0000146 Ga0496102_0000146_59229_59633 134
305 3300048905 Ga0496102_1481645 Ga0496102_1481645_33_437 134
306 3300048906 Ga0496103_0000043 Ga0496103_0000043_38225_38629 134
307 3300048911 Ga0496108_0000150 Ga0496108_0000150_18084_18488 134
308 3300048912 Ga0496109_0000007 Ga0496109_0000007_198761_199165 134
309 3300048915 Ga0496112_0000938 Ga0496112_0000938_12183_12587 134
310 3300048916 Ga0496113_0000007 Ga0496113_0000007_23965_24369 134
311 3300048917 Ga0496114_0000014 Ga0496114_0000014_93367_93771 134
312 3300048918 Ga0496115_0000316 Ga0496115_0000316_7678_8082 134
313 3300049578 Ga0501042_0294378 Ga0501042_0294378_79_489 134
314 3300049581 Ga0501047_0894902 Ga0501047_0894902_175_579 134
315 3300050514 nmdc:mga08x19_122218_c1 nmdc:mga08x19_122218_c1_255_662 134
316 3300053094 Ga0500566_0195665 Ga0500566_0195665_520_924 134

Structural Annotation

Top 5 Hits

ID Description Score Start End
1rvj-assembly1.cif.gz_H photosynthetic reaction center double mutant from rhodobacter sphaeroides with asp l213 replaced with asn and arg h177 replaced with his 0.8659 16 106
7yml-assembly1.cif.gz_H structure of photosynthetic lh1-rc super-complex of rhodobacter capsulatus 0.8418 9 106
7xxf-assembly1.cif.gz_H structure of photosynthetic lh1-rc super-complex of rhodopila globiformis 0.8366 17 107
1pm3-assembly1.cif.gz_A mth1859 0.8356 16 76
7ddq-assembly1.cif.gz_H structure of rc-lh1-pufx from rhodobacter veldkampii 0.8217 9 107
ID Description Score Start End Superfamily
1pm3A00 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.8356 16 76 2.30.30.240
af_Q58518_6_77_2.30.30.240 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.8325 16 79 2.30.30.240
2rcrH02 Alpha Beta;Alpha-Beta Complex;Photosynthetic Reaction Center; Chain H, domain 2;Photosynthetic Reaction Center, subunit H, domain 2 0.7785 18 108 3.90.50.10
1pm3B00 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.7748 12 76 2.30.30.240
af_Q10LU9_128_201_2.30.30.240 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.7733 15 79 2.30.30.240
ID Description Score Start End GO Terms
AF-A0A537YNN0-F1-model_v4 PRC-barrel domain-containing protein 0.9839 1 134 GO:0019684
GO:0030077
GO:0045156
AF-A0A537YNN0-F1-model_v4 PRC-barrel domain-containing protein 0.9766 1 134 GO:0019684
GO:0030077
GO:0045156
AF-A0A7V9GTT4-F1-model_v4 PRC-barrel domain-containing protein 0.9403 12 131 GO:0019684
GO:0030077
GO:0045156
AF-A0A7V9HT28-F1-model_v4 PRC-barrel domain-containing protein 0.9351 10 134 GO:0019684
GO:0030077
GO:0045156
AF-A0A1Q3NF52-F1-model_v4 deleted 0.9131 2 131

Feature Viewer

pLDDT pTM Quality
91.02 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map