F402729

General Info

Members Datasets Scaffolds Average Seq Length
314 125 616 279

Family's Representative Sequence

Representative Sequence 3300025949|Ga0207667_10177695|Ga0207667_101776953
Length 307
Sequence MPIILATSTPRWRVPEQPCIPCYSEAVSCSYMRLSTLFGMLSLGLVVWGGILVAQRPFKEWPAIEYDNFPLPPDYTQKTEWTRARLRYPDVFGYPNPALRYADGREFPGFWTMDYPRSDRHLLAGVRRLTRIDARSVEQVVEFDGTDDVYNWPVMYGVEVGHWLLTDEQAKQMREYLLRGGFFMCDDFHGDEEWEVFTNSMKRVFPDRPIVEIPSSDPIFHTVFDLDQRFQVPGAQYFETGRTYEHGGIEPHWRGIYDDKGRLMVAICFNMDLGDAWEHSDEARYLEKWASLAYRLATNYFIYDLTH

Samples

Sample ID Description Type Environment
1 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
97 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
98 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
99 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
100 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
101 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
102 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
103 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
104 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
105 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
106 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
107 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
108 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
109 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
110 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
117 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
118 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
119 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
120 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
121 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
122 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
123 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
124 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
125 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.32
Nodule 0
Rhizoplane 0.32
Rhizosphere 98.41
Stem 0
Stem Tuber 0
Unclassified 23.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207667_10177695 3300025949 Unclassified 2187
2 Ga0070658_10006094 3300005327 Bacteria 9779
3 Ga0070658_10383197 3300005327 Unclassified 1206
4 Ga0070683_100000003 3300005329 Bacteria 375084
5 Ga0070683_100000013 3300005329 Bacteria 241235
6 Ga0070683_100137662 3300005329 Bacteria 2313
7 Ga0070683_100147351 3300005329 Bacteria 2231
8 Ga0070683_100275230 3300005329 Unclassified 1601
9 Ga0070690_100012199 3300005330 Bacteria 5051
10 Ga0070670_100232040 3300005331 Bacteria 1606
11 Ga0070670_100318905 3300005331 Unclassified 1361
12 Ga0068869_100033140 3300005334 Viruses 3646
13 Ga0070666_10001216 3300005335 Bacteria 15542
14 Ga0070666_10236787 3300005335 Unclassified 1290
15 Ga0070680_100000873 3300005336 Bacteria 21393
16 Ga0070680_100214853 3300005336 Bacteria 1623
17 Ga0068868_100009388 3300005338 Bacteria 7035
18 Ga0068868_100111492 3300005338 Unclassified 2223
19 Ga0068868_100397323 3300005338 Unclassified 1189
20 Ga0070660_100218150 3300005339 Unclassified 1550
21 Ga0070660_100237660 3300005339 Unclassified 1483
22 Ga0070692_10146383 3300005345 Unclassified 1342
23 Ga0070673_100016854 3300005364 Bacteria 5180
24 Ga0070667_100119398 3300005367 Unclassified 2293
25 Ga0070667_100140552 3300005367 Unclassified 2114
26 Ga0070714_100008375 3300005435 Bacteria 8068
27 Ga0070714_100010197 3300005435 Bacteria 7418
28 Ga0070714_100123869 3300005435 Bacteria 2302
29 Ga0070714_100138751 3300005435 Unclassified 2180
30 Ga0070713_100003973 3300005436 Bacteria 9836
31 Ga0070713_100053322 3300005436 Bacteria 3351
32 Ga0070713_100172263 3300005436 Bacteria 1940
33 Ga0070713_100175054 3300005436 Bacteria 1925
34 Ga0070701_10280544 3300005438 Bacteria 1017
35 Ga0070711_100211639 3300005439 Bacteria 1502
36 Ga0070708_100169094 3300005445 Unclassified 2040
37 Ga0070681_10080708 3300005458 Unclassified 3209
38 Ga0070681_10094699 3300005458 Unclassified 2934
39 Ga0070707_100274533 3300005468 Bacteria 1639
40 Ga0070679_100059592 3300005530 Bacteria 3804
41 Ga0070679_100087611 3300005530 Bacteria 3100
42 Ga0070684_100000014 3300005535 Bacteria 158815
43 Ga0070684_100000115 3300005535 Bacteria 51829
44 Ga0070684_100046458 3300005535 Bacteria 3762
45 Ga0068853_100034376 3300005539 Unclassified 4302
46 Ga0068853_100076428 3300005539 Unclassified 2924
47 Ga0070693_100097266 3300005547 Bacteria 1786
48 Ga0070665_100032064 3300005548 Bacteria 5289
49 Ga0070665_100206770 3300005548 Unclassified 1964
50 Ga0070704_100179702 3300005549 Unclassified 1691
51 Ga0068855_100007115 3300005563 Bacteria 13572
52 Ga0068855_100010093 3300005563 Bacteria 11383
53 Ga0068855_100012858 3300005563 Bacteria 10099
54 Ga0068855_100038464 3300005563 Bacteria 5684
55 Ga0068855_100057204 3300005563 Bacteria 4571
56 Ga0068855_100120654 3300005563 Bacteria 3001
57 Ga0068855_100184629 3300005563 Unclassified 2356
58 Ga0068855_100208699 3300005563 Unclassified 2196
59 Ga0068855_100247001 3300005563 Bacteria 1992
60 Ga0068855_100314012 3300005563 Unclassified 1733
61 Ga0070664_100073127 3300005564 Bacteria 2940
62 Ga0068857_100006280 3300005577 Bacteria 10163
63 Ga0068857_100028846 3300005577 Bacteria 4897
64 Ga0068856_100005125 3300005614 Bacteria 12939
65 Ga0068856_100092494 3300005614 Bacteria 3009
66 Ga0068856_100150992 3300005614 Bacteria 2332
67 Ga0068852_100564284 3300005616 Bacteria 1140
68 Ga0068859_100140701 3300005617 Bacteria 2487
69 Ga0068864_100153077 3300005618 Bacteria 2091
70 Ga0068861_100717851 3300005719 Unclassified 930
71 Ga0068863_100038407 3300005841 Bacteria 4555
72 Ga0068863_100246237 3300005841 Bacteria 1726
73 Ga0068858_100028624 3300005842 Bacteria 5175
74 Ga0068858_100053838 3300005842 Bacteria 3721
75 Ga0068858_100358752 3300005842 Unclassified 1397
76 Ga0068860_100163080 3300005843 Unclassified 2150
77 Ga0068860_100209882 3300005843 Bacteria 1889
78 Ga0068860_100646153 3300005843 Unclassified 1065
79 Ga0070717_10107995 3300006028 Bacteria 2371
80 Ga0070716_100173030 3300006173 Bacteria 1411
81 Ga0097621_100047331 3300006237 Unclassified 3485
82 Ga0097621_100293950 3300006237 Bacteria 1433
83 Ga0097621_100375978 3300006237 Bacteria 1268
84 Ga0068871_100028088 3300006358 Unclassified 4407
85 Ga0068871_100058853 3300006358 Unclassified 3129
86 Ga0068871_100276800 3300006358 Unclassified 1467
87 Ga0068865_100028853 3300006881 Bacteria 3676
88 Ga0097620_100140696 3300006931 Bacteria 2487
89 Ga0105240_10005063 3300009093 Bacteria 19760
90 Ga0105240_10027859 3300009093 Bacteria 7392
91 Ga0105240_10035495 3300009093 Bacteria 6425
92 Ga0105240_10052047 3300009093 Archaea 5148
93 Ga0105240_10117154 3300009093 Bacteria 3212
94 Ga0105240_10292508 3300009093 Unclassified 1866
95 Ga0111539_10658158 3300009094 Unclassified 1220
96 Ga0105245_10000396 3300009098 Bacteria 40404
97 Ga0105245_10014488 3300009098 Bacteria 6866
98 Ga0105245_10033408 3300009098 Bacteria 4560
99 Ga0105245_10156046 3300009098 Viruses 2162
100 Ga0105245_10272452 3300009098 Unclassified 1651
101 Ga0105245_10512244 3300009098 Unclassified 1217
102 Ga0105245_10786253 3300009098 Unclassified 989
103 Ga0105243_10053913 3300009148 Unclassified 3190
104 Ga0105241_10023546 3300009174 Unclassified 4567
105 Ga0105241_10042319 3300009174 Plasmid 3445
106 Ga0105241_10251671 3300009174 Bacteria 1498
107 Ga0105242_10030869 3300009176 Bacteria 4280
108 Ga0105242_10085866 3300009176 Plasmid 2640
109 Ga0105242_10338226 3300009176 Bacteria 1386
110 Ga0105248_10037260 3300009177 Bacteria 5441
111 Ga0105248_10065874 3300009177 Bacteria 4068
112 Ga0105248_10253893 3300009177 Bacteria 1979
113 Ga0105248_10274129 3300009177 Unclassified 1900
114 Ga0105248_10511844 3300009177 Bacteria 1353
115 Ga0105248_10632355 3300009177 Bacteria 1207
116 Ga0105248_10644183 3300009177 Bacteria 1196
117 Ga0105248_10755247 3300009177 Bacteria 1097
118 Ga0105237_10032833 3300009545 Bacteria 5255
119 Ga0105237_10055185 3300009545 Bacteria 3979
120 Ga0105237_10070751 3300009545 Bacteria 3484
121 Ga0105237_10361871 3300009545 Unclassified 1455
122 Ga0105238_10005217 3300009551 Bacteria 12836
123 Ga0105238_10011285 3300009551 Bacteria 8990
124 Ga0105238_10012251 3300009551 Bacteria 8647
125 Ga0105238_10013699 3300009551 Bacteria 8190
126 Ga0105238_10026692 3300009551 Bacteria 5887
127 Ga0105238_10044963 3300009551 Bacteria 4462
128 Ga0105238_10148328 3300009551 Unclassified 2322
129 Ga0105238_10188108 3300009551 Unclassified 2041
130 Ga0105238_10307115 3300009551 Bacteria 1571
131 Ga0105238_10334868 3300009551 Bacteria 1501
132 Ga0105238_10367940 3300009551 Bacteria 1428
133 Ga0105238_10433882 3300009551 Bacteria 1310
134 Ga0105249_10023006 3300009553 Bacteria 5587
135 Ga0105249_10193418 3300009553 Bacteria 1987
136 Ga0105249_10242517 3300009553 Bacteria 1782
137 Ga0105239_10010057 3300010375 Bacteria 10605
138 Ga0105239_10068642 3300010375 Bacteria 3896
139 Ga0105239_10092028 3300010375 Plasmid 3347
140 Ga0105239_10242063 3300010375 Bacteria 2025
141 Ga0105239_10415470 3300010375 Bacteria 1523
142 Ga0105239_10458512 3300010375 Bacteria 1447
143 Ga0105239_10696846 3300010375 Bacteria 1161
144 Ga0105246_10009300 3300011119 Bacteria 6051
145 Ga0105246_10107147 3300011119 Bacteria 2046
146 Ga0157370_10001165 3300013104 Bacteria 32739
147 Ga0157370_10001444 3300013104 Bacteria 29389
148 Ga0157370_10059516 3300013104 Unclassified 3630
149 Ga0157370_10060295 3300013104 Unclassified 3603
150 Ga0157369_10039671 3300013105 Bacteria 5145
151 Ga0157369_10046857 3300013105 Unclassified 4697
152 Ga0157369_10047655 3300013105 Bacteria 4651
153 Ga0157369_10051618 3300013105 Bacteria 4450
154 Ga0157369_10064639 3300013105 Bacteria 3940
155 Ga0157369_10092336 3300013105 Bacteria 3230
156 Ga0157369_10124202 3300013105 Bacteria 2738
157 Ga0157369_10254953 3300013105 Bacteria 1830
158 Ga0157374_10104556 3300013296 Bacteria 2719
159 Ga0157374_10133012 3300013296 Bacteria 2408
160 Ga0157374_10147951 3300013296 Bacteria 2282
161 Ga0157374_10391116 3300013296 Unclassified 1386
162 Ga0157378_10003139 3300013297 Bacteria 14687
163 Ga0157378_10030969 3300013297 Bacteria 4724
164 Ga0157378_10306496 3300013297 Bacteria 1539
165 Ga0163162_10003574 3300013306 Bacteria 14867
166 Ga0163162_10221768 3300013306 Bacteria 2021
167 Ga0163162_10283649 3300013306 Unclassified 1788
168 Ga0163162_10310379 3300013306 Bacteria 1710
169 Ga0157372_10011694 3300013307 Bacteria 9346
170 Ga0157372_10015994 3300013307 Bacteria 8047
171 Ga0157372_10057947 3300013307 Bacteria 4330
172 Ga0157372_10069572 3300013307 Viruses 3958
173 Ga0157372_10534462 3300013307 Bacteria 1367
174 Ga0157375_10005506 3300013308 Bacteria 11018
175 Ga0157375_10273968 3300013308 Bacteria 1850
176 Ga0157375_10355683 3300013308 Bacteria 1630
177 Ga0163163_10012595 3300014325 Bacteria 7713
178 Ga0163163_10058749 3300014325 Bacteria 3803
179 Ga0163163_10277927 3300014325 Bacteria 1726
180 Ga0157379_10215689 3300014968 Unclassified 1738
181 Ga0157376_10130844 3300014969 Bacteria 2239
182 Ga0157376_10257931 3300014969 Bacteria 1632
183 Ga0157376_10396282 3300014969 Bacteria 1334
184 Ga0207642_10078189 3300025899 Bacteria 1598
185 Ga0207680_10203370 3300025903 Unclassified 1351
186 Ga0207699_10344623 3300025906 Unclassified 1050
187 Ga0207707_10202523 3300025912 Bacteria 1730
188 Ga0207695_10003332 3300025913 Bacteria 22762
189 Ga0207695_10022297 3300025913 Bacteria 7196
190 Ga0207695_10035515 3300025913 Bacteria 5405
191 Ga0207695_10170961 3300025913 Bacteria 2099
192 Ga0207695_10277726 3300025913 Bacteria 1569
193 Ga0207671_10028228 3300025914 Bacteria 4194
194 Ga0207671_10047535 3300025914 Bacteria 3176
195 Ga0207671_10179871 3300025914 Bacteria 1645
196 Ga0207663_10116780 3300025916 Bacteria 1820
197 Ga0207663_10128346 3300025916 Bacteria 1748
198 Ga0207660_10007248 3300025917 Bacteria 7178
199 Ga0207660_10171016 3300025917 Bacteria 1682
200 Ga0207657_10003302 3300025919 Bacteria 17245
201 Ga0207657_10047989 3300025919 Unclassified 3730
202 Ga0207694_10007087 3300025924 Bacteria 8516
203 Ga0207694_10007991 3300025924 Bacteria 7998
204 Ga0207694_10009549 3300025924 Bacteria 7318
205 Ga0207694_10010075 3300025924 Bacteria 7124
206 Ga0207694_10015043 3300025924 Bacteria 5835
207 Ga0207694_10033358 3300025924 Unclassified 3944
208 Ga0207694_10226445 3300025924 Bacteria 1526
209 Ga0207694_10247818 3300025924 Bacteria 1457
210 Ga0207687_10004102 3300025927 Bacteria 9763
211 Ga0207687_10104620 3300025927 Unclassified 2090
212 Ga0207700_10012680 3300025928 Bacteria 5447
213 Ga0207700_10092381 3300025928 Bacteria 2393
214 Ga0207664_10065226 3300025929 Unclassified 2915
215 Ga0207644_10236937 3300025931 Bacteria 1452
216 Ga0207686_10009910 3300025934 Bacteria 5179
217 Ga0207686_10135082 3300025934 Bacteria 1697
218 Ga0207704_10019892 3300025938 Bacteria 3538
219 Ga0207711_10006585 3300025941 Bacteria 9781
220 Ga0207711_10019444 3300025941 Bacteria 5654
221 Ga0207711_10045367 3300025941 Bacteria 3756
222 Ga0207711_10145813 3300025941 Unclassified 2133
223 Ga0207711_10206020 3300025941 Bacteria 1796
224 Ga0207711_10290300 3300025941 Unclassified 1507
225 Ga0207711_10307203 3300025941 Bacteria 1464
226 Ga0207711_10516895 3300025941 Bacteria 1113
227 Ga0207711_10529903 3300025941 Unclassified 1098
228 Ga0207689_10106210 3300025942 Unclassified 2307
229 Ga0207661_10000014 3300025944 Bacteria 322246
230 Ga0207661_10000018 3300025944 Bacteria 242506
231 Ga0207661_10065150 3300025944 Bacteria 2957
232 Ga0207661_10120462 3300025944 Bacteria 2233
233 Ga0207667_10005312 3300025949 Bacteria 15694
234 Ga0207667_10020573 3300025949 Bacteria 7333
235 Ga0207667_10037793 3300025949 Bacteria 5160
236 Ga0207667_10056185 3300025949 Bacteria 4136
237 Ga0207667_10073410 3300025949 Unclassified 3555
238 Ga0207667_10175461 3300025949 Bacteria 2202
239 Ga0207667_10292621 3300025949 Bacteria 1664
240 Ga0207667_10335548 3300025949 Bacteria 1543
241 Ga0207712_10039147 3300025961 Bacteria 3247
242 Ga0207703_10020406 3300026035 Bacteria 5182
243 Ga0207703_10034773 3300026035 Bacteria 4000
244 Ga0207703_10041372 3300026035 Unclassified 3692
245 Ga0207703_10405518 3300026035 Unclassified 1265
246 Ga0207703_10559884 3300026035 Unclassified 1078
247 Ga0207639_10069441 3300026041 Bacteria 2749
248 Ga0207639_10122675 3300026041 Unclassified 2137
249 Ga0207639_10128957 3300026041 Bacteria 2091
250 Ga0207702_10011585 3300026078 Bacteria 7348
251 Ga0207702_10045364 3300026078 Bacteria 3698
252 Ga0207702_10064538 3300026078 Bacteria 3134
253 Ga0207702_10065998 3300026078 Bacteria 3100
254 Ga0207702_10173805 3300026078 Unclassified 1978
255 Ga0207641_10221941 3300026088 Bacteria 1753
256 Ga0207676_10068595 3300026095 Bacteria 2837
257 Ga0207674_10024507 3300026116 Bacteria 6447
258 Ga0207674_10038408 3300026116 Bacteria 4969
259 Ga0207674_10063555 3300026116 Bacteria 3726
260 Ga0207675_100184144 3300026118 Bacteria 2001
261 Ga0207698_10443966 3300026142 Bacteria 1251
262 Ga0268266_10010003 3300028379 Bacteria 8324
263 Ga0268266_10330309 3300028379 Bacteria 1429
264 Ga0268264_10216715 3300028381 Bacteria 1760
265 Ga0268264_10326714 3300028381 Unclassified 1452
266 Ga0265338_10186918 3300028800 Bacteria 1574
267 Ga0265325_10182347 3300031241 Bacteria 977
268 Ga0265329_10048008 3300031242 Unclassified 1362
269 Ga0265316_10060336 3300031344 Bacteria 2948
270 Ga0265313_10100434 3300031595 Bacteria 1285
271 Ga0265314_10047213 3300031711 Bacteria 3032
272 Ga0373926_0126690 3300035083 Bacteria 965
273 Ga0373934_0047383 3300035086 Unclassified 1700
274 Ga0373941_0048095 3300035115 Bacteria 1346
275 Ga0373945_0017758 3300035116 Bacteria 2413
276 Ga0373954_0006147 3300035118 Bacteria 5230
277 Ga0373943_0037485 3300035170 Unclassified 2327
278 Ga0373946_0070588 3300035171 Bacteria 1508
279 Ga0373927_0000524 3300035695 Bacteria 29117
280 Ga0373927_0006307 3300035695 Bacteria 8087
281 Ga0373927_0042996 3300035695 Unclassified 2927
282 Ga0373927_0144575 3300035695 Bacteria 1556
283 Ga0373947_0000741 3300035725 Bacteria 19572
284 Ga0373947_0007434 3300035725 Bacteria 6344
285 Ga0373947_0104837 3300035725 Bacteria 1781
286 Ga0373937_0093851 3300036401 Bacteria 2782
287 Ga0373937_0266307 3300036401 Unclassified 1617
288 Ga0373925_0001648 3300037068 Bacteria 18821
289 Ga0373925_0049320 3300037068 Unclassified 3138
290 Ga0373925_0114289 3300037068 Bacteria 2089
291 Ga0395898_0130123 3300037466 Bacteria 2411
292 Ga0395898_0559380 3300037466 Bacteria 1086
293 Ga0436364_0409404 3300037853 Bacteria 4098
294 Ga0436364_0620686 3300037853 Bacteria 2733
295 Ga0436364_1324725 3300037853 Bacteria 5389
296 Ga0451576_0010589 3300045051 Bacteria 10561
297 Ga0451576_0137687 3300045051 Bacteria 2546
298 Ga0495592_0041489 3300046454 Bacteria 3449
299 Ga0495580_0018700 3300046472 Bacteria 5157
300 Ga0495594_0086708 3300046499 Unclassified 1752
301 Ga0495665_0162490 3300046531 Bacteria 1164
302 Ga0495586_0054559 3300046535 Bacteria 2166
303 Ga0495674_0049120 3300047319 Bacteria 3730
304 Ga0496112_0087971 3300048915 Bacteria 3074
305 Ga0495612_0093278 3300053078 Unclassified 1277
306 Ga0500641_0029567 3300053096 Bacteria 2148
307 Ga0501082_0000102 3300060353 Bacteria 66513
308 Ga0501082_0000111 3300060353 Bacteria 64014
309 Ga0207667_10177695
310 Ga0070658_10006094
311 Ga0070658_10383197
312 Ga0070683_100000003
313 Ga0070683_100000013
314 Ga0070683_100137662
315 Ga0070683_100147351
316 Ga0070683_100275230
317 Ga0070690_100012199
318 Ga0070670_100232040
319 Ga0070670_100318905
320 Ga0068869_100033140
321 Ga0070666_10001216
322 Ga0070666_10236787
323 Ga0070680_100000873
324 Ga0070680_100214853
325 Ga0068868_100009388
326 Ga0068868_100111492
327 Ga0068868_100397323
328 Ga0070660_100218150
329 Ga0070660_100237660
330 Ga0070692_10146383
331 Ga0070673_100016854
332 Ga0070667_100119398
333 Ga0070667_100140552
334 Ga0070714_100008375
335 Ga0070714_100010197
336 Ga0070714_100123869
337 Ga0070714_100138751
338 Ga0070713_100003973
339 Ga0070713_100053322
340 Ga0070713_100172263
341 Ga0070713_100175054
342 Ga0070701_10280544
343 Ga0070711_100211639
344 Ga0070708_100169094
345 Ga0070681_10080708
346 Ga0070681_10094699
347 Ga0070707_100274533
348 Ga0070679_100059592
349 Ga0070679_100087611
350 Ga0070684_100000014
351 Ga0070684_100000115
352 Ga0070684_100046458
353 Ga0068853_100034376
354 Ga0068853_100076428
355 Ga0070693_100097266
356 Ga0070665_100032064
357 Ga0070665_100206770
358 Ga0070704_100179702
359 Ga0068855_100007115
360 Ga0068855_100010093
361 Ga0068855_100012858
362 Ga0068855_100038464
363 Ga0068855_100057204
364 Ga0068855_100120654
365 Ga0068855_100184629
366 Ga0068855_100208699
367 Ga0068855_100247001
368 Ga0068855_100314012
369 Ga0070664_100073127
370 Ga0068857_100006280
371 Ga0068857_100028846
372 Ga0068856_100005125
373 Ga0068856_100092494
374 Ga0068856_100150992
375 Ga0068852_100564284
376 Ga0068859_100140701
377 Ga0068864_100153077
378 Ga0068861_100717851
379 Ga0068863_100038407
380 Ga0068863_100246237
381 Ga0068858_100028624
382 Ga0068858_100053838
383 Ga0068858_100358752
384 Ga0068860_100163080
385 Ga0068860_100209882
386 Ga0068860_100646153
387 Ga0070717_10107995
388 Ga0070716_100173030
389 Ga0097621_100047331
390 Ga0097621_100293950
391 Ga0097621_100375978
392 Ga0068871_100028088
393 Ga0068871_100058853
394 Ga0068871_100276800
395 Ga0068865_100028853
396 Ga0097620_100140696
397 Ga0105240_10005063
398 Ga0105240_10027859
399 Ga0105240_10035495
400 Ga0105240_10052047
401 Ga0105240_10117154
402 Ga0105240_10292508
403 Ga0111539_10658158
404 Ga0105245_10000396
405 Ga0105245_10014488
406 Ga0105245_10033408
407 Ga0105245_10156046
408 Ga0105245_10272452
409 Ga0105245_10512244
410 Ga0105245_10786253
411 Ga0105243_10053913
412 Ga0105241_10023546
413 Ga0105241_10042319
414 Ga0105241_10251671
415 Ga0105242_10030869
416 Ga0105242_10085866
417 Ga0105242_10338226
418 Ga0105248_10037260
419 Ga0105248_10065874
420 Ga0105248_10253893
421 Ga0105248_10274129
422 Ga0105248_10511844
423 Ga0105248_10632355
424 Ga0105248_10644183
425 Ga0105248_10755247
426 Ga0105237_10032833
427 Ga0105237_10055185
428 Ga0105237_10070751
429 Ga0105237_10361871
430 Ga0105238_10005217
431 Ga0105238_10011285
432 Ga0105238_10012251
433 Ga0105238_10013699
434 Ga0105238_10026692
435 Ga0105238_10044963
436 Ga0105238_10148328
437 Ga0105238_10188108
438 Ga0105238_10307115
439 Ga0105238_10334868
440 Ga0105238_10367940
441 Ga0105238_10433882
442 Ga0105249_10023006
443 Ga0105249_10193418
444 Ga0105249_10242517
445 Ga0105239_10010057
446 Ga0105239_10068642
447 Ga0105239_10092028
448 Ga0105239_10242063
449 Ga0105239_10415470
450 Ga0105239_10458512
451 Ga0105239_10696846
452 Ga0105246_10009300
453 Ga0105246_10107147
454 Ga0157370_10001165
455 Ga0157370_10001444
456 Ga0157370_10059516
457 Ga0157370_10060295
458 Ga0157369_10039671
459 Ga0157369_10046857
460 Ga0157369_10047655
461 Ga0157369_10051618
462 Ga0157369_10064639
463 Ga0157369_10092336
464 Ga0157369_10124202
465 Ga0157369_10254953
466 Ga0157374_10104556
467 Ga0157374_10133012
468 Ga0157374_10147951
469 Ga0157374_10391116
470 Ga0157378_10003139
471 Ga0157378_10030969
472 Ga0157378_10306496
473 Ga0163162_10003574
474 Ga0163162_10221768
475 Ga0163162_10283649
476 Ga0163162_10310379
477 Ga0157372_10011694
478 Ga0157372_10015994
479 Ga0157372_10057947
480 Ga0157372_10069572
481 Ga0157372_10534462
482 Ga0157375_10005506
483 Ga0157375_10273968
484 Ga0157375_10355683
485 Ga0163163_10012595
486 Ga0163163_10058749
487 Ga0163163_10277927
488 Ga0157379_10215689
489 Ga0157376_10130844
490 Ga0157376_10257931
491 Ga0157376_10396282
492 Ga0207642_10078189
493 Ga0207680_10203370
494 Ga0207699_10344623
495 Ga0207707_10202523
496 Ga0207695_10003332
497 Ga0207695_10022297
498 Ga0207695_10035515
499 Ga0207695_10170961
500 Ga0207695_10277726
501 Ga0207671_10028228
502 Ga0207671_10047535
503 Ga0207671_10179871
504 Ga0207663_10116780
505 Ga0207663_10128346
506 Ga0207660_10007248
507 Ga0207660_10171016
508 Ga0207657_10003302
509 Ga0207657_10047989
510 Ga0207694_10007087
511 Ga0207694_10007991
512 Ga0207694_10009549
513 Ga0207694_10010075
514 Ga0207694_10015043
515 Ga0207694_10033358
516 Ga0207694_10226445
517 Ga0207694_10247818
518 Ga0207687_10004102
519 Ga0207687_10104620
520 Ga0207700_10012680
521 Ga0207700_10092381
522 Ga0207664_10065226
523 Ga0207644_10236937
524 Ga0207686_10009910
525 Ga0207686_10135082
526 Ga0207704_10019892
527 Ga0207711_10006585
528 Ga0207711_10019444
529 Ga0207711_10045367
530 Ga0207711_10145813
531 Ga0207711_10206020
532 Ga0207711_10290300
533 Ga0207711_10307203
534 Ga0207711_10516895
535 Ga0207711_10529903
536 Ga0207689_10106210
537 Ga0207661_10000014
538 Ga0207661_10000018
539 Ga0207661_10065150
540 Ga0207661_10120462
541 Ga0207667_10005312
542 Ga0207667_10020573
543 Ga0207667_10037793
544 Ga0207667_10056185
545 Ga0207667_10073410
546 Ga0207667_10175461
547 Ga0207667_10292621
548 Ga0207667_10335548
549 Ga0207712_10039147
550 Ga0207703_10020406
551 Ga0207703_10034773
552 Ga0207703_10041372
553 Ga0207703_10405518
554 Ga0207703_10559884
555 Ga0207639_10069441
556 Ga0207639_10122675
557 Ga0207639_10128957
558 Ga0207702_10011585
559 Ga0207702_10045364
560 Ga0207702_10064538
561 Ga0207702_10065998
562 Ga0207702_10173805
563 Ga0207641_10221941
564 Ga0207676_10068595
565 Ga0207674_10024507
566 Ga0207674_10038408
567 Ga0207674_10063555
568 Ga0207675_100184144
569 Ga0207698_10443966
570 Ga0268266_10010003
571 Ga0268266_10330309
572 Ga0268264_10216715
573 Ga0268264_10326714
574 Ga0265338_10186918
575 Ga0265325_10182347
576 Ga0265329_10048008
577 Ga0265316_10060336
578 Ga0265313_10100434
579 Ga0265314_10047213
580 Ga0373926_0126690
581 Ga0373934_0047383
582 Ga0373941_0048095
583 Ga0373945_0017758
584 Ga0373954_0006147
585 Ga0373943_0037485
586 Ga0373946_0070588
587 Ga0373927_0000524
588 Ga0373927_0006307
589 Ga0373927_0042996
590 Ga0373927_0144575
591 Ga0373947_0000741
592 Ga0373947_0007434
593 Ga0373947_0104837
594 Ga0373937_0093851
595 Ga0373937_0266307
596 Ga0373925_0001648
597 Ga0373925_0049320
598 Ga0373925_0114289
599 Ga0395898_0130123
600 Ga0395898_0559380
601 Ga0436364_0409404
602 Ga0436364_0620686
603 Ga0436364_1324725
604 Ga0451576_0010589
605 Ga0451576_0137687
606 Ga0495592_0041489
607 Ga0495580_0018700
608 Ga0495594_0086708
609 Ga0495665_0162490
610 Ga0495586_0054559
611 Ga0495674_0049120
612 Ga0496112_0087971
613 Ga0495612_0093278
614 Ga0500641_0029567
615 Ga0501082_0000102
616 Ga0501082_0000111

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13709

DUF4159

Domain of unknown function (DUF4159)

98

305

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4i66-assembly1.cif.gz_A-2 crystal structure of hoch_4089 protein from haliangium ochraceum 0.8095 83 286
4i66-assembly1.cif.gz_A-2 crystal structure of hoch_4089 protein from haliangium ochraceum 0.7575 83 286
3m8c-assembly1.cif.gz_A crystal structure of ketosteroid isomerase d99n from pseudomonas testosteroni (tksi) with equilenin bound 0.7303 232 250
1ohs-assembly2.cif.gz_D crystal structure of 5-3-ketosteroid isomerase mutant y14f/d38n from pseudomonas testosteroni complexed with androstanedione 0.7245 232 253
3unl-assembly2.cif.gz_D crystal structure of ketosteroid isomerase f54g from pseudomonas testosteroni 0.7237 232 253
ID Description Score Start End Superfamily
4i66A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Domain of unknown function DUF4159 0.7916 83 286 3.40.50.12140
4i66A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Domain of unknown function DUF4159 0.7401 83 286 3.40.50.12140
af_A0A2R8RL16_66_203_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.714 231 252 2.60.40.10
af_P75800_529_779_3.20.20.450 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;EAL domain 0.7011 122 155 3.20.20.450
5hgrA02 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.6989 229 252 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A257VSL0-F1-model_v4 DUF4159 domain-containing protein 0.9612 114 186
AF-A0A6L7WQY4-F1-model_v4 DUF4159 domain-containing protein 0.9497 106 288
AF-A0A2N9MZG7-F1-model_v4 DUF4159 domain-containing protein 0.9454 103 288
AF-A0A7C2NMW8-F1-model_v4 DUF4159 domain-containing protein 0.9397 47 288
AF-A0A554JJS8-F1-model_v4 DUF4159 domain-containing protein 0.9381 118 288

Map