F401096

General Info

Members Datasets Scaffolds Average Seq Length
311 189 622 227

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10060115|Ga0070681_100601151
Length 236
Sequence MPDRTTSARSAAFRPLTLAVDVVLLTPRGNELAVRLVAADSARGTRSRDRWSLPSDAPRGDESLDDTAARVARDVLGAVPSFLEQSAAVGGARRPTDGGTGAAQVSVGYFGLVPDGGRSDSASDWVGLSELPSLAVRHREEIDLAVAAMRARVDQQPIAFRLLPPSFTLSELQSVYELLLGRRLHKASFRRSLHASALVEATDEWRSEGRGRPAQLFRYAPPRRKRAKRGIRFDLL

Samples

Sample ID Description Type Environment
1 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
135 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
136 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
137 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
138 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
139 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
140 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
142 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
148 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
152 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
153 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
154 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
155 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
156 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
157 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
158 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
159 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
160 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
161 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
162 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
163 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
164 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
165 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
166 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
167 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
168 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
169 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
170 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
171 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
172 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
173 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
174 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
179 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
180 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
186 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
187 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
188 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
189 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.36
Metatranscriptomes 0.64
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.61
Rhizosphere 98.39
Stem 0
Stem Tuber 0
Unclassified 24.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070681_10060115 3300005458 Bacteria 3779
2 JGI25406J46586_10082431 3300003203 Bacteria 984
3 Ga0065712_10343530 3300005290 Unclassified 797
4 Ga0070683_100000851 3300005329 Bacteria 22610
5 Ga0070683_100002155 3300005329 Bacteria 15569
6 Ga0070683_100023338 3300005329 Bacteria 5533
7 Ga0070683_100031923 3300005329 Bacteria 4793
8 Ga0070683_100061849 3300005329 Bacteria 3481
9 Ga0070683_100112648 3300005329 Unclassified 2567
10 Ga0070683_100224368 3300005329 Bacteria 1786
11 Ga0070683_100306131 3300005329 Bacteria 1512
12 Ga0070690_100016283 3300005330 Bacteria 4450
13 Ga0070690_100079464 3300005330 Bacteria 2144
14 Ga0070670_100004039 3300005331 Bacteria 12253
15 Ga0070670_100175888 3300005331 Bacteria 1858
16 Ga0068869_100001340 3300005334 Bacteria 14600
17 Ga0070666_10099484 3300005335 Bacteria 2003
18 Ga0070666_10348981 3300005335 Archaea 1059
19 Ga0070680_100000608 3300005336 Bacteria 24777
20 Ga0070680_100033706 3300005336 Unclassified 4129
21 Ga0070682_100001710 3300005337 Bacteria 12200
22 Ga0068868_100038011 3300005338 Bacteria 3735
23 Ga0070660_100022734 3300005339 Bacteria 4642
24 Ga0070689_100028114 3300005340 Unclassified 4248
25 Ga0070689_100041106 3300005340 Bacteria 3548
26 Ga0070687_100217873 3300005343 Unclassified 1167
27 Ga0070661_100002082 3300005344 Bacteria 13762
28 Ga0070661_100578839 3300005344 Unclassified 906
29 Ga0070668_100177463 3300005347 Bacteria 1738
30 Ga0070668_100228936 3300005347 Bacteria 1536
31 Ga0070669_100041277 3300005353 Bacteria 3356
32 Ga0070669_100457545 3300005353 Bacteria 1053
33 Ga0070675_100000978 3300005354 Bacteria 20435
34 Ga0070675_100126704 3300005354 Unclassified 2173
35 Ga0070675_100608946 3300005354 Bacteria 991
36 Ga0070673_100105638 3300005364 Bacteria 2327
37 Ga0070659_100000291 3300005366 Bacteria 39272
38 Ga0070667_100091443 3300005367 Bacteria 2616
39 Ga0070667_100121695 3300005367 Bacteria 2270
40 Ga0070667_100206420 3300005367 Unclassified 1745
41 Ga0070709_10005249 3300005434 Bacteria 7009
42 Ga0070713_100002477 3300005436 Bacteria 12058
43 Ga0070713_100591674 3300005436 Unclassified 1053
44 Ga0070705_100461773 3300005440 Bacteria 955
45 Ga0070700_100194122 3300005441 Unclassified 1422
46 Ga0070708_100000057 3300005445 Bacteria 73207
47 Ga0070708_100278162 3300005445 Bacteria 1575
48 Ga0070663_100565509 3300005455 Bacteria 952
49 Ga0070662_100002073 3300005457 Bacteria 12289
50 Ga0070681_10000856 3300005458 Bacteria 25575
51 Ga0070681_10222594 3300005458 Bacteria 1802
52 Ga0070681_10509263 3300005458 Unclassified 1117
53 Ga0068867_100078831 3300005459 Bacteria 2478
54 Ga0070685_10009002 3300005466 Bacteria 5149
55 Ga0070707_100274509 3300005468 Unclassified 1639
56 Ga0070698_100068616 3300005471 Unclassified 3562
57 Ga0070698_100187491 3300005471 Bacteria 2006
58 Ga0070679_100000874 3300005530 Bacteria 26168
59 Ga0070679_100007043 3300005530 Bacteria 10486
60 Ga0070679_100138037 3300005530 Bacteria 2419
61 Ga0070679_100194757 3300005530 Bacteria 1994
62 Ga0070684_100002879 3300005535 Bacteria 12795
63 Ga0070684_100006877 3300005535 Bacteria 8832
64 Ga0070684_100061949 3300005535 Bacteria 3276
65 Ga0070684_100063316 3300005535 Unclassified 3242
66 Ga0070684_100084516 3300005535 Bacteria 2814
67 Ga0070684_100098893 3300005535 Bacteria 2603
68 Ga0070684_100108481 3300005535 Bacteria 2487
69 Ga0070684_100142708 3300005535 Unclassified 2166
70 Ga0068853_100273906 3300005539 Bacteria 1555
71 Ga0070672_100017574 3300005543 Bacteria 5152
72 Ga0070672_100196798 3300005543 Unclassified 1684
73 Ga0070672_100497558 3300005543 Bacteria 1054
74 Ga0070686_100268977 3300005544 Unclassified 1252
75 Ga0070686_100580173 3300005544 Unclassified 881
76 Ga0070695_100014208 3300005545 Bacteria 4798
77 Ga0070696_100000096 3300005546 Bacteria 44146
78 Ga0070693_100003671 3300005547 Bacteria 7172
79 Ga0070665_100118243 3300005548 Bacteria 2653
80 Ga0070665_100958057 3300005548 Unclassified 868
81 Ga0068855_100053996 3300005563 Bacteria 4725
82 Ga0070664_100016587 3300005564 Bacteria 6042
83 Ga0070664_100376020 3300005564 Bacteria 1296
84 Ga0070664_100770161 3300005564 Unclassified 899
85 Ga0068857_100000435 3300005577 Bacteria 29551
86 Ga0068857_100040370 3300005577 Bacteria 4138
87 Ga0068856_100004927 3300005614 Bacteria 13217
88 Ga0068856_100105189 3300005614 Bacteria 2816
89 Ga0068856_100120466 3300005614 Unclassified 2625
90 Ga0068856_100129176 3300005614 Bacteria 2531
91 Ga0068856_101135606 3300005614 Unclassified 798
92 Ga0070702_100000053 3300005615 Bacteria 32512
93 Ga0070702_100067052 3300005615 Archaea 2107
94 Ga0068852_100002837 3300005616 Bacteria 12019
95 Ga0068852_100023020 3300005616 Bacteria 5007
96 Ga0068859_100101340 3300005617 Bacteria 2936
97 Ga0068859_100539653 3300005617 Unclassified 1261
98 Ga0068864_100009631 3300005618 Bacteria 7970
99 Ga0068864_100066331 3300005618 Bacteria 3133
100 Ga0068861_100850029 3300005719 Unclassified 860
101 Ga0068863_100011015 3300005841 Bacteria 8770
102 Ga0068858_100028981 3300005842 Bacteria 5141
103 Ga0068858_100102475 3300005842 Bacteria 2670
104 Ga0068858_100262854 3300005842 Unclassified 1641
105 Ga0068860_100009087 3300005843 Bacteria 9888
106 Ga0068860_100465905 3300005843 Bacteria 1258
107 Ga0068862_100057790 3300005844 Bacteria 3327
108 Ga0081455_10054632 3300005937 Bacteria 3402
109 Ga0081539_10000206 3300005985 Bacteria 137177
110 Ga0070716_100025643 3300006173 Unclassified 3148
111 Ga0097621_100633235 3300006237 Unclassified 980
112 Ga0068871_100212720 3300006358 Bacteria 1673
113 Ga0068865_100157105 3300006881 Unclassified 1731
114 Ga0097620_100101344 3300006931 Bacteria 2936
115 Ga0097620_100539651 3300006931 Unclassified 1261
116 Ga0105240_10097134 3300009093 Bacteria 3590
117 Ga0105245_10001721 3300009098 Bacteria 19954
118 Ga0105245_10416719 3300009098 Unclassified 1345
119 Ga0105245_10831370 3300009098 Unclassified 963
120 Ga0105243_10314601 3300009148 Unclassified 1424
121 Ga0105241_10020328 3300009174 Bacteria 4905
122 Ga0105241_10267329 3300009174 Bacteria 1455
123 Ga0105242_10002208 3300009176 Bacteria 15351
124 Ga0105242_10303099 3300009176 Bacteria 1459
125 Ga0105248_10007802 3300009177 Bacteria 11750
126 Ga0105248_10039763 3300009177 Bacteria 5270
127 Ga0105248_10203176 3300009177 Bacteria 2232
128 Ga0105248_10228319 3300009177 Bacteria 2095
129 Ga0105237_10057899 3300009545 Bacteria 3878
130 Ga0105239_10046813 3300010375 Bacteria 4739
131 Ga0105246_10000122 3300011119 Bacteria 35630
132 Ga0157373_10004871 3300013100 Bacteria 10101
133 Ga0157371_10008029 3300013102 Bacteria 8448
134 Ga0157370_10000976 3300013104 Bacteria 36246
135 Ga0157370_10037906 3300013104 Bacteria 4666
136 Ga0157369_10154345 3300013105 Bacteria 2426
137 Ga0157369_11148880 3300013105 Unclassified 793
138 Ga0157374_10004743 3300013296 Bacteria 11399
139 Ga0157374_11025886 3300013296 Archaea 844
140 Ga0157378_10490361 3300013297 Unclassified 1226
141 Ga0163162_10680680 3300013306 Unclassified 1151
142 Ga0157372_10019007 3300013307 Bacteria 7395
143 Ga0157372_10079489 3300013307 Bacteria 3709
144 Ga0157372_10126606 3300013307 Bacteria 2937
145 Ga0157375_10005513 3300013308 Bacteria 11011
146 Ga0157375_10031371 3300013308 Bacteria 5023
147 Ga0157375_10037686 3300013308 Bacteria 4635
148 Ga0163163_10035496 3300014325 Bacteria 4837
149 Ga0157377_10099012 3300014745 Bacteria 1734
150 Ga0157377_10427156 3300014745 Bacteria 909
151 Ga0157379_10245403 3300014968 Unclassified 1624
152 Ga0157376_10230785 3300014969 Bacteria 1719
153 Ga0182005_1049545 3300015265 Unclassified 1142
154 Ga0163161_10719663 3300017792 Unclassified 833
155 Ga0206354_11717820 3300020081 Bacteria 851
156 Ga0206353_11044118 3300020082 Bacteria 1716
157 Ga0207682_10196996 3300025893 Bacteria 925
158 Ga0207680_10583024 3300025903 Unclassified 799
159 Ga0207645_10033256 3300025907 Bacteria 3315
160 Ga0207643_10038736 3300025908 Bacteria 2678
161 Ga0207643_10115060 3300025908 Bacteria 1588
162 Ga0207684_10015138 3300025910 Bacteria 6642
163 Ga0207684_10359108 3300025910 Bacteria 1254
164 Ga0207654_10317731 3300025911 Bacteria 1064
165 Ga0207707_10001018 3300025912 Bacteria 26906
166 Ga0207707_10001965 3300025912 Bacteria 18684
167 Ga0207707_10433342 3300025912 Unclassified 1126
168 Ga0207695_10001619 3300025913 Bacteria 36517
169 Ga0207660_10008644 3300025917 Bacteria 6584
170 Ga0207660_10016572 3300025917 Bacteria 4879
171 Ga0207660_10030833 3300025917 Unclassified 3687
172 Ga0207662_10002787 3300025918 Bacteria 8836
173 Ga0207649_10096770 3300025920 Unclassified 1945
174 Ga0207649_10103593 3300025920 Bacteria 1888
175 Ga0207649_10413198 3300025920 Archaea 1012
176 Ga0207652_10006158 3300025921 Bacteria 9699
177 Ga0207652_10014818 3300025921 Bacteria 6321
178 Ga0207652_10406182 3300025921 Bacteria 1229
179 Ga0207646_10514292 3300025922 Unclassified 1078
180 Ga0207681_10115083 3300025923 Bacteria 1963
181 Ga0207650_10052436 3300025925 Bacteria 3021
182 Ga0207650_10145870 3300025925 Bacteria 1864
183 Ga0207659_10053451 3300025926 Bacteria 2881
184 Ga0207659_10062170 3300025926 Bacteria 2694
185 Ga0207659_10106388 3300025926 Bacteria 2124
186 Ga0207700_10031117 3300025928 Bacteria 3787
187 Ga0207664_10080090 3300025929 Unclassified 2654
188 Ga0207690_10116676 3300025932 Bacteria 1931
189 Ga0207706_10118859 3300025933 Bacteria 2324
190 Ga0207686_10046408 3300025934 Bacteria 2679
191 Ga0207709_10072984 3300025935 Unclassified 2185
192 Ga0207670_10027224 3300025936 Bacteria 3613
193 Ga0207670_10111283 3300025936 Bacteria 1974
194 Ga0207704_10078008 3300025938 Bacteria 2129
195 Ga0207665_10023882 3300025939 Unclassified 4027
196 Ga0207691_10053713 3300025940 Bacteria 3677
197 Ga0207691_10166427 3300025940 Bacteria 1932
198 Ga0207711_10025893 3300025941 Bacteria 4920
199 Ga0207711_10101599 3300025941 Bacteria 2545
200 Ga0207689_10004714 3300025942 Bacteria 12305
201 Ga0207689_10025280 3300025942 Bacteria 4976
202 Ga0207661_10000382 3300025944 Bacteria 28535
203 Ga0207661_10002129 3300025944 Bacteria 13616
204 Ga0207661_10097665 3300025944 Bacteria 2460
205 Ga0207661_10104091 3300025944 Bacteria 2389
206 Ga0207661_10238020 3300025944 Bacteria 1614
207 Ga0207661_10277843 3300025944 Bacteria 1496
208 Ga0207661_10330297 3300025944 Bacteria 1372
209 Ga0207679_10000495 3300025945 Bacteria 27188
210 Ga0207679_10269329 3300025945 Bacteria 1456
211 Ga0207679_10722432 3300025945 Unclassified 905
212 Ga0207667_10020175 3300025949 Bacteria 7419
213 Ga0207667_10064794 3300025949 Bacteria 3814
214 Ga0207668_10056783 3300025972 Bacteria 2728
215 Ga0207677_10201873 3300026023 Bacteria 1581
216 Ga0207677_10450149 3300026023 Unclassified 1103
217 Ga0207703_10074334 3300026035 Bacteria 2814
218 Ga0207639_10248823 3300026041 Bacteria 1549
219 Ga0207678_10578434 3300026067 Unclassified 984
220 Ga0207708_10276162 3300026075 Unclassified 1360
221 Ga0207702_10088577 3300026078 Bacteria 2704
222 Ga0207702_10215093 3300026078 Unclassified 1788
223 Ga0207702_10889159 3300026078 Bacteria 882
224 Ga0207702_10934059 3300026078 Unclassified 860
225 Ga0207641_10161328 3300026088 Unclassified 2038
226 Ga0207648_10051186 3300026089 Bacteria 3610
227 Ga0207676_10059849 3300026095 Bacteria 3009
228 Ga0207676_10166198 3300026095 Bacteria 1917
229 Ga0207676_10399527 3300026095 Archaea 1284
230 Ga0207674_10000033 3300026116 Bacteria 142149
231 Ga0207674_10020628 3300026116 Bacteria 7115
232 Ga0207674_10118110 3300026116 Bacteria 2622
233 Ga0207683_10155320 3300026121 Archaea 2066
234 Ga0207698_10024418 3300026142 Bacteria 4243
235 Ga0207698_10040150 3300026142 Bacteria 3474
236 Ga0268265_10131252 3300028380 Bacteria 2082
237 Ga0268264_10006679 3300028381 Bacteria 9698
238 Ga0268264_10201351 3300028381 Bacteria 1822
239 Ga0373934_0008779 3300035086 Bacteria 3775
240 Ga0373956_0025116 3300035119 Bacteria 2572
241 Ga0373957_0003308 3300035120 Bacteria 4750
242 Ga0373955_0000821 3300035172 Bacteria 13283
243 Ga0373924_0007662 3300035410 Bacteria 3903
244 Ga0373931_0004359 3300035691 Bacteria 6461
245 Ga0373935_0359576 3300035692 Bacteria 1039
246 Ga0373927_0001991 3300035695 Bacteria 15058
247 Ga0373927_0138951 3300035695 Unclassified 1588
248 Ga0373933_0035170 3300035724 Unclassified 2924
249 Ga0373947_0025293 3300035725 Bacteria 3462
250 Ga0373937_0000105 3300036401 Bacteria 80211
251 Ga0373937_0146889 3300036401 Bacteria 2208
252 Ga0373925_0268024 3300037068 Bacteria 1373
253 Ga0395905_0630548 3300037471 Unclassified 974
254 Ga0439448_0079780 3300042005 Unclassified 1098
255 Ga0466963_0014955 3300044694 Bacteria 4796
256 Ga0451576_0211603 3300045051 Bacteria 2025
257 Ga0466967_0012540 3300045976 Bacteria 6490
258 Ga0466967_0099496 3300045976 Bacteria 2656
259 Ga0466967_0185189 3300045976 Bacteria 1966
260 Ga0466967_1409148 3300045976 Unclassified 694
261 Ga0495629_0077180 3300046459 Unclassified 2325
262 Ga0495651_0047876 3300046462 Unclassified 3303
263 Ga0495580_0048260 3300046472 Bacteria 3016
264 Ga0495582_0004073 3300046473 Bacteria 8210
265 Ga0495639_0081219 3300046475 Unclassified 1510
266 Ga0495662_0164100 3300046476 Bacteria 1095
267 Ga0495594_0015784 3300046499 Bacteria 3972
268 Ga0495594_0081963 3300046499 Bacteria 1802
269 Ga0495628_0088650 3300046516 Unclassified 2397
270 Ga0495665_0027479 3300046531 Bacteria 3054
271 Ga0495665_0088292 3300046531 Bacteria 1630
272 Ga0495587_0000787 3300046536 Bacteria 21216
273 Ga0495645_0000158 3300046543 Bacteria 46716
274 Ga0495645_0045685 3300046543 Bacteria 3196
275 Ga0495667_0031163 3300046559 Bacteria 3580
276 Ga0495659_0027790 3300046664 Bacteria 1954
277 Ga0495588_0049071 3300046674 Unclassified 2170
278 Ga0495588_0341722 3300046674 Unclassified 787
279 Ga0495657_0087391 3300046675 Unclassified 2006
280 Ga0495599_0030427 3300046678 Unclassified 3387
281 Ga0495623_0004559 3300046679 Bacteria 9103
282 Ga0495600_0262540 3300046809 Bacteria 1097
283 Ga0495581_0032232 3300047315 Bacteria 3035
284 Ga0495581_0213125 3300047315 Bacteria 1129
285 Ga0495581_0277358 3300047315 Unclassified 980
286 Ga0495581_0437564 3300047315 Bacteria 762
287 Ga0495674_0071274 3300047319 Unclassified 3001
288 Ga0495672_0067632 3300047320 Unclassified 2034
289 Ga0495675_0008180 3300047444 Bacteria 6473
290 Ga0495675_0156882 3300047444 Bacteria 1403
291 Ga0495684_0046675 3300047471 Bacteria 3313
292 Ga0495602_0199105 3300048088 Bacteria 1529
293 Ga0496108_0049171 3300048911 Bacteria 3527
294 Ga0496111_0102315 3300048914 Bacteria 2106
295 Ga0496112_0000936 3300048915 Bacteria 21161
296 Ga0496112_0586682 3300048915 Unclassified 1047
297 Ga0496113_0027755 3300048916 Bacteria 4062
298 Ga0501291_015656 3300049514 Bacteria 1149
299 Ga0501033_0034492 3300049570 Bacteria 3795
300 Ga0501036_0047457 3300049572 Bacteria 3637
301 Ga0501043_0042822 3300049579 Bacteria 3559
302 Ga0501047_0107381 3300049581 Bacteria 2673
303 Ga0501047_0493425 3300049581 Unclassified 1051
304 Ga0501035_0759756 3300049822 Unclassified 777
305 Ga0501044_0004280 3300049823 Bacteria 16013
306 Ga0501044_0118739 3300049823 Bacteria 2647
307 Ga0501044_0515078 3300049823 Unclassified 1096
308 Ga0495601_0026523 3300053077 Unclassified 3578
309 Ga0495595_0018138 3300053084 Unclassified 3038
310 Ga0495619_0049223 3300053085 Unclassified 2779
311 Ga0501082_0392082 3300060353 Unclassified 1212
312 Ga0070681_10060115
313 JGI25406J46586_10082431
314 Ga0065712_10343530
315 Ga0070683_100000851
316 Ga0070683_100002155
317 Ga0070683_100023338
318 Ga0070683_100031923
319 Ga0070683_100061849
320 Ga0070683_100112648
321 Ga0070683_100224368
322 Ga0070683_100306131
323 Ga0070690_100016283
324 Ga0070690_100079464
325 Ga0070670_100004039
326 Ga0070670_100175888
327 Ga0068869_100001340
328 Ga0070666_10099484
329 Ga0070666_10348981
330 Ga0070680_100000608
331 Ga0070680_100033706
332 Ga0070682_100001710
333 Ga0068868_100038011
334 Ga0070660_100022734
335 Ga0070689_100028114
336 Ga0070689_100041106
337 Ga0070687_100217873
338 Ga0070661_100002082
339 Ga0070661_100578839
340 Ga0070668_100177463
341 Ga0070668_100228936
342 Ga0070669_100041277
343 Ga0070669_100457545
344 Ga0070675_100000978
345 Ga0070675_100126704
346 Ga0070675_100608946
347 Ga0070673_100105638
348 Ga0070659_100000291
349 Ga0070667_100091443
350 Ga0070667_100121695
351 Ga0070667_100206420
352 Ga0070709_10005249
353 Ga0070713_100002477
354 Ga0070713_100591674
355 Ga0070705_100461773
356 Ga0070700_100194122
357 Ga0070708_100000057
358 Ga0070708_100278162
359 Ga0070663_100565509
360 Ga0070662_100002073
361 Ga0070681_10000856
362 Ga0070681_10222594
363 Ga0070681_10509263
364 Ga0068867_100078831
365 Ga0070685_10009002
366 Ga0070707_100274509
367 Ga0070698_100068616
368 Ga0070698_100187491
369 Ga0070679_100000874
370 Ga0070679_100007043
371 Ga0070679_100138037
372 Ga0070679_100194757
373 Ga0070684_100002879
374 Ga0070684_100006877
375 Ga0070684_100061949
376 Ga0070684_100063316
377 Ga0070684_100084516
378 Ga0070684_100098893
379 Ga0070684_100108481
380 Ga0070684_100142708
381 Ga0068853_100273906
382 Ga0070672_100017574
383 Ga0070672_100196798
384 Ga0070672_100497558
385 Ga0070686_100268977
386 Ga0070686_100580173
387 Ga0070695_100014208
388 Ga0070696_100000096
389 Ga0070693_100003671
390 Ga0070665_100118243
391 Ga0070665_100958057
392 Ga0068855_100053996
393 Ga0070664_100016587
394 Ga0070664_100376020
395 Ga0070664_100770161
396 Ga0068857_100000435
397 Ga0068857_100040370
398 Ga0068856_100004927
399 Ga0068856_100105189
400 Ga0068856_100120466
401 Ga0068856_100129176
402 Ga0068856_101135606
403 Ga0070702_100000053
404 Ga0070702_100067052
405 Ga0068852_100002837
406 Ga0068852_100023020
407 Ga0068859_100101340
408 Ga0068859_100539653
409 Ga0068864_100009631
410 Ga0068864_100066331
411 Ga0068861_100850029
412 Ga0068863_100011015
413 Ga0068858_100028981
414 Ga0068858_100102475
415 Ga0068858_100262854
416 Ga0068860_100009087
417 Ga0068860_100465905
418 Ga0068862_100057790
419 Ga0081455_10054632
420 Ga0081539_10000206
421 Ga0070716_100025643
422 Ga0097621_100633235
423 Ga0068871_100212720
424 Ga0068865_100157105
425 Ga0097620_100101344
426 Ga0097620_100539651
427 Ga0105240_10097134
428 Ga0105245_10001721
429 Ga0105245_10416719
430 Ga0105245_10831370
431 Ga0105243_10314601
432 Ga0105241_10020328
433 Ga0105241_10267329
434 Ga0105242_10002208
435 Ga0105242_10303099
436 Ga0105248_10007802
437 Ga0105248_10039763
438 Ga0105248_10203176
439 Ga0105248_10228319
440 Ga0105237_10057899
441 Ga0105239_10046813
442 Ga0105246_10000122
443 Ga0157373_10004871
444 Ga0157371_10008029
445 Ga0157370_10000976
446 Ga0157370_10037906
447 Ga0157369_10154345
448 Ga0157369_11148880
449 Ga0157374_10004743
450 Ga0157374_11025886
451 Ga0157378_10490361
452 Ga0163162_10680680
453 Ga0157372_10019007
454 Ga0157372_10079489
455 Ga0157372_10126606
456 Ga0157375_10005513
457 Ga0157375_10031371
458 Ga0157375_10037686
459 Ga0163163_10035496
460 Ga0157377_10099012
461 Ga0157377_10427156
462 Ga0157379_10245403
463 Ga0157376_10230785
464 Ga0182005_1049545
465 Ga0163161_10719663
466 Ga0206354_11717820
467 Ga0206353_11044118
468 Ga0207682_10196996
469 Ga0207680_10583024
470 Ga0207645_10033256
471 Ga0207643_10038736
472 Ga0207643_10115060
473 Ga0207684_10015138
474 Ga0207684_10359108
475 Ga0207654_10317731
476 Ga0207707_10001018
477 Ga0207707_10001965
478 Ga0207707_10433342
479 Ga0207695_10001619
480 Ga0207660_10008644
481 Ga0207660_10016572
482 Ga0207660_10030833
483 Ga0207662_10002787
484 Ga0207649_10096770
485 Ga0207649_10103593
486 Ga0207649_10413198
487 Ga0207652_10006158
488 Ga0207652_10014818
489 Ga0207652_10406182
490 Ga0207646_10514292
491 Ga0207681_10115083
492 Ga0207650_10052436
493 Ga0207650_10145870
494 Ga0207659_10053451
495 Ga0207659_10062170
496 Ga0207659_10106388
497 Ga0207700_10031117
498 Ga0207664_10080090
499 Ga0207690_10116676
500 Ga0207706_10118859
501 Ga0207686_10046408
502 Ga0207709_10072984
503 Ga0207670_10027224
504 Ga0207670_10111283
505 Ga0207704_10078008
506 Ga0207665_10023882
507 Ga0207691_10053713
508 Ga0207691_10166427
509 Ga0207711_10025893
510 Ga0207711_10101599
511 Ga0207689_10004714
512 Ga0207689_10025280
513 Ga0207661_10000382
514 Ga0207661_10002129
515 Ga0207661_10097665
516 Ga0207661_10104091
517 Ga0207661_10238020
518 Ga0207661_10277843
519 Ga0207661_10330297
520 Ga0207679_10000495
521 Ga0207679_10269329
522 Ga0207679_10722432
523 Ga0207667_10020175
524 Ga0207667_10064794
525 Ga0207668_10056783
526 Ga0207677_10201873
527 Ga0207677_10450149
528 Ga0207703_10074334
529 Ga0207639_10248823
530 Ga0207678_10578434
531 Ga0207708_10276162
532 Ga0207702_10088577
533 Ga0207702_10215093
534 Ga0207702_10889159
535 Ga0207702_10934059
536 Ga0207641_10161328
537 Ga0207648_10051186
538 Ga0207676_10059849
539 Ga0207676_10166198
540 Ga0207676_10399527
541 Ga0207674_10000033
542 Ga0207674_10020628
543 Ga0207674_10118110
544 Ga0207683_10155320
545 Ga0207698_10024418
546 Ga0207698_10040150
547 Ga0268265_10131252
548 Ga0268264_10006679
549 Ga0268264_10201351
550 Ga0373934_0008779
551 Ga0373956_0025116
552 Ga0373957_0003308
553 Ga0373955_0000821
554 Ga0373924_0007662
555 Ga0373931_0004359
556 Ga0373935_0359576
557 Ga0373927_0001991
558 Ga0373927_0138951
559 Ga0373933_0035170
560 Ga0373947_0025293
561 Ga0373937_0000105
562 Ga0373937_0146889
563 Ga0373925_0268024
564 Ga0395905_0630548
565 Ga0439448_0079780
566 Ga0466963_0014955
567 Ga0451576_0211603
568 Ga0466967_0012540
569 Ga0466967_0099496
570 Ga0466967_0185189
571 Ga0466967_1409148
572 Ga0495629_0077180
573 Ga0495651_0047876
574 Ga0495580_0048260
575 Ga0495582_0004073
576 Ga0495639_0081219
577 Ga0495662_0164100
578 Ga0495594_0015784
579 Ga0495594_0081963
580 Ga0495628_0088650
581 Ga0495665_0027479
582 Ga0495665_0088292
583 Ga0495587_0000787
584 Ga0495645_0000158
585 Ga0495645_0045685
586 Ga0495667_0031163
587 Ga0495659_0027790
588 Ga0495588_0049071
589 Ga0495588_0341722
590 Ga0495657_0087391
591 Ga0495599_0030427
592 Ga0495623_0004559
593 Ga0495600_0262540
594 Ga0495581_0032232
595 Ga0495581_0213125
596 Ga0495581_0277358
597 Ga0495581_0437564
598 Ga0495674_0071274
599 Ga0495672_0067632
600 Ga0495675_0008180
601 Ga0495675_0156882
602 Ga0495684_0046675
603 Ga0495602_0199105
604 Ga0496108_0049171
605 Ga0496111_0102315
606 Ga0496112_0000936
607 Ga0496112_0586682
608 Ga0496113_0027755
609 Ga0501291_015656
610 Ga0501033_0034492
611 Ga0501036_0047457
612 Ga0501043_0042822
613 Ga0501047_0107381
614 Ga0501047_0493425
615 Ga0501035_0759756
616 Ga0501044_0004280
617 Ga0501044_0118739
618 Ga0501044_0515078
619 Ga0495601_0026523
620 Ga0495595_0018138
621 Ga0495619_0049223
622 Ga0501082_0392082

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21906

NrtR_WHD

NrtR DNA-binding winged helix domain

159

219

0.98

PF19368

AraR_C

AraR C-terminal winged HTH domain

155

229

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5bs6-assembly1.cif.gz_B apo structure of transcriptional factor arar from bacteroides thetaiotaomicron vpi 0.9031 15 214
5bs6-assembly2.cif.gz_D apo structure of transcriptional factor arar from bacteroides thetaiotaomicron vpi 0.8806 4 214
3gz6-assembly1.cif.gz_B crystal structure of shewanella oneidensis nrtr complexed with a 27mer dna 0.8571 18 215
3gz5-assembly1.cif.gz_B crystal structure of shewanella oneidensis nrtr 0.8431 18 215
3gz5-assembly1.cif.gz_A crystal structure of shewanella oneidensis nrtr 0.8389 17 215
ID Description Score Start End Superfamily
3gz5A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9346 151 216 1.10.10.10
3gz5B02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9267 151 216 1.10.10.10
5bs6A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8872 146 214 1.10.10.10
2fb1D02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.873 146 213 1.10.10.10
3gz6B01 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8598 18 130 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A2W5GG01-F1-model_v4 DNA mismatch repair protein MutT 0.9355 119 214 GO:0005737
AF-K1SF19-F1-model_v4 Hydrolase, NUDIX family 0.9347 119 215 GO:0016787
AF-A0A7W0W2K8-F1-model_v4 NrtR DNA-binding winged helix domain-containing protein 0.9287 147 233
AF-A0A7Y5HB07-F1-model_v4 NUDIX domain-containing protein 0.9218 14 215
AF-A0A4Q3B0S1-F1-model_v4 deleted 0.9101 11 215

Map