F401088

General Info

Members Datasets Scaffolds Average Seq Length
311 148 622 198

Family's Representative Sequence

Representative Sequence 3300005437|Ga0070710_10121487|Ga0070710_101214872
Length 206
Sequence VTVYCATSNPGKLREFQLAAPDFDLRQLPRPVAPPDETGETFEENAIGKAEYYGGFVDGYLFADDSGLEVDALGGAPGVHSARYAASHLNGEATDAANNALLLQRLNGIANRTARFVCVIALVKDGKLVRTFRGAVEGRILEAPRGSGGFGYDPLFYYEPFGCTFGEAAIGDKMLVSHRAQALEKMFTFLRGISASVETQSSSSHR

Samples

Sample ID Description Type Environment
1 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
105 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
106 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
107 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
108 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
109 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
111 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
112 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
113 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
114 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
115 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
116 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
117 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
120 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
121 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
122 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
123 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
124 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
125 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
126 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
127 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
128 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
129 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
130 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
131 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
132 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
133 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
134 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
135 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
136 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
137 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
138 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
139 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
140 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
141 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
144 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
147 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
148 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.32
Nodule 0
Rhizoplane 1.29
Rhizosphere 97.75
Stem 0
Stem Tuber 0
Unclassified 7.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070710_10121487 3300005437 Bacteria 1582
2 Ga0070658_10021656 3300005327 Bacteria 5152
3 Ga0070683_100001187 3300005329 Bacteria 19785
4 Ga0070683_100046161 3300005329 Bacteria 4023
5 Ga0070683_100069901 3300005329 Bacteria 3274
6 Ga0070690_100149619 3300005330 Bacteria 1592
7 Ga0068869_100158901 3300005334 Bacteria 1758
8 Ga0068869_100464358 3300005334 Bacteria 1051
9 Ga0070666_10052738 3300005335 Bacteria 2741
10 Ga0070666_10621882 3300005335 Unclassified 789
11 Ga0070680_100002378 3300005336 Bacteria 13909
12 Ga0070680_100400354 3300005336 Bacteria 1170
13 Ga0068868_100191320 3300005338 Bacteria 1702
14 Ga0068868_100860841 3300005338 Bacteria 821
15 Ga0070660_100098498 3300005339 Bacteria 2314
16 Ga0070689_100231815 3300005340 Bacteria 1518
17 Ga0070661_100036342 3300005344 Bacteria 3581
18 Ga0070661_100079861 3300005344 Bacteria 2414
19 Ga0070671_101245315 3300005355 Bacteria 655
20 Ga0070659_100281922 3300005366 Bacteria 1382
21 Ga0070709_10404233 3300005434 Unclassified 1020
22 Ga0070709_10862276 3300005434 Bacteria 714
23 Ga0070713_100017337 3300005436 Bacteria 5444
24 Ga0070713_100859561 3300005436 Unclassified 871
25 Ga0070711_100905095 3300005439 Bacteria 753
26 Ga0070700_100279366 3300005441 Bacteria 1210
27 Ga0070662_100012911 3300005457 Bacteria 5550
28 Ga0070681_10000569 3300005458 Bacteria 30428
29 Ga0070681_10084952 3300005458 Bacteria 3117
30 Ga0068867_100150937 3300005459 Bacteria 1825
31 Ga0070679_100000840 3300005530 Bacteria 26739
32 Ga0070679_100557889 3300005530 Unclassified 1089
33 Ga0070684_100000054 3300005535 Bacteria 76916
34 Ga0070684_100014602 3300005535 Bacteria 6368
35 Ga0070684_100109001 3300005535 Bacteria 2481
36 Ga0070684_100238779 3300005535 Bacteria 1660
37 Ga0070684_100724488 3300005535 Bacteria 928
38 Ga0070697_100269892 3300005536 Bacteria 1458
39 Ga0068853_100215378 3300005539 Bacteria 1752
40 Ga0068853_100381753 3300005539 Unclassified 1316
41 Ga0068853_100709155 3300005539 Unclassified 960
42 Ga0068853_101310589 3300005539 Bacteria 700
43 Ga0070672_100244433 3300005543 Bacteria 1510
44 Ga0070695_100157904 3300005545 Bacteria 1589
45 Ga0070665_100004984 3300005548 Bacteria 13774
46 Ga0070665_100963462 3300005548 Bacteria 866
47 Ga0068855_100015833 3300005563 Bacteria 9071
48 Ga0068855_100022164 3300005563 Bacteria 7611
49 Ga0068855_100038372 3300005563 Bacteria 5692
50 Ga0068855_100079538 3300005563 Bacteria 3802
51 Ga0068855_100080014 3300005563 Bacteria 3789
52 Ga0068855_100285434 3300005563 Bacteria 1831
53 Ga0068855_100360226 3300005563 Bacteria 1600
54 Ga0068855_100567902 3300005563 Bacteria 1226
55 Ga0068857_100001968 3300005577 Bacteria 16610
56 Ga0068857_100012396 3300005577 Bacteria 7420
57 Ga0068857_100121734 3300005577 Bacteria 2350
58 Ga0068857_100198234 3300005577 Bacteria 1830
59 Ga0068857_100292300 3300005577 Bacteria 1501
60 Ga0068856_100024598 3300005614 Bacteria 5862
61 Ga0068856_100048427 3300005614 Bacteria 4188
62 Ga0068856_100164537 3300005614 Bacteria 2229
63 Ga0068856_100204758 3300005614 Bacteria 1988
64 Ga0068852_100015536 3300005616 Bacteria 5910
65 Ga0068852_100058671 3300005616 Bacteria 3335
66 Ga0068852_100706815 3300005616 Bacteria 1018
67 Ga0068852_101130670 3300005616 Bacteria 804
68 Ga0068859_100097585 3300005617 Bacteria 2991
69 Ga0068859_100150924 3300005617 Bacteria 2399
70 Ga0068864_100251012 3300005618 Bacteria 1643
71 Ga0068864_100730700 3300005618 Bacteria 969
72 Ga0068864_100887565 3300005618 Bacteria 880
73 Ga0068861_100903859 3300005719 Bacteria 836
74 Ga0068863_100044238 3300005841 Bacteria 4227
75 Ga0068863_100559153 3300005841 Bacteria 1130
76 Ga0068858_100051711 3300005842 Bacteria 3801
77 Ga0068858_100052611 3300005842 Bacteria 3767
78 Ga0068858_100269123 3300005842 Bacteria 1621
79 Ga0068860_100320619 3300005843 Bacteria 1521
80 Ga0068860_100762185 3300005843 Bacteria 980
81 Ga0070717_10224860 3300006028 Bacteria 1651
82 Ga0070716_100202251 3300006173 Bacteria 1321
83 Ga0097621_100018965 3300006237 Bacteria 5272
84 Ga0097621_100321490 3300006237 Unclassified 1371
85 Ga0097621_101001580 3300006237 Bacteria 782
86 Ga0097621_101486795 3300006237 Bacteria 642
87 Ga0068871_100005713 3300006358 Bacteria 8733
88 Ga0068871_100009522 3300006358 Bacteria 7047
89 Ga0068871_100133222 3300006358 Bacteria 2109
90 Ga0068865_100028331 3300006881 Bacteria 3707
91 Ga0068865_100346902 3300006881 Bacteria 1201
92 Ga0097620_100097579 3300006931 Bacteria 2991
93 Ga0097620_100150926 3300006931 Bacteria 2399
94 Ga0105240_10022789 3300009093 Bacteria 8296
95 Ga0105240_10113979 3300009093 Bacteria 3266
96 Ga0105240_10200469 3300009093 Bacteria 2339
97 Ga0105240_10240525 3300009093 Bacteria 2099
98 Ga0105240_10323275 3300009093 Bacteria 1758
99 Ga0105240_10342898 3300009093 Bacteria 1697
100 Ga0105240_10558198 3300009093 Bacteria 1266
101 Ga0105240_11330152 3300009093 Bacteria 757
102 Ga0105245_10079708 3300009098 Bacteria 2990
103 Ga0105245_10260005 3300009098 Unclassified 1689
104 Ga0105245_10268612 3300009098 Bacteria 1663
105 Ga0105247_10331970 3300009101 Bacteria 1064
106 Ga0105243_11182895 3300009148 Bacteria 777
107 Ga0105241_10002235 3300009174 Bacteria 14555
108 Ga0105241_10037313 3300009174 Bacteria 3660
109 Ga0105241_10126470 3300009174 Bacteria 2064
110 Ga0105241_10222621 3300009174 Bacteria 1587
111 Ga0105241_10225458 3300009174 Unclassified 1577
112 Ga0105241_10256650 3300009174 Bacteria 1484
113 Ga0105241_10307183 3300009174 Bacteria 1363
114 Ga0105241_10495677 3300009174 Unclassified 1088
115 Ga0105242_10021357 3300009176 Bacteria 5080
116 Ga0105242_10024178 3300009176 Bacteria 4795
117 Ga0105242_10035923 3300009176 Bacteria 3973
118 Ga0105242_10097490 3300009176 Bacteria 2486
119 Ga0105242_11089914 3300009176 Bacteria 812
120 Ga0105248_10002427 3300009177 Bacteria 20684
121 Ga0105248_10287590 3300009177 Bacteria 1851
122 Ga0105237_10011618 3300009545 Bacteria 9318
123 Ga0105237_10124348 3300009545 Bacteria 2574
124 Ga0105237_10226846 3300009545 Bacteria 1868
125 Ga0105237_10261913 3300009545 Bacteria 1732
126 Ga0105237_10540551 3300009545 Bacteria 1172
127 Ga0105238_10000748 3300009551 Bacteria 33846
128 Ga0105238_10014034 3300009551 Bacteria 8099
129 Ga0105238_10062230 3300009551 Bacteria 3733
130 Ga0105238_10081514 3300009551 Bacteria 3225
131 Ga0105238_10216008 3300009551 Bacteria 1894
132 Ga0105238_10483869 3300009551 Bacteria 1237
133 Ga0105249_10171986 3300009553 Bacteria 2102
134 Ga0105249_10624625 3300009553 Bacteria 1133
135 Ga0105239_10030581 3300010375 Bacteria 5921
136 Ga0105239_10032885 3300010375 Bacteria 5699
137 Ga0105239_10045242 3300010375 Bacteria 4824
138 Ga0105239_10117619 3300010375 Bacteria 2950
139 Ga0105239_10201632 3300010375 Bacteria 2229
140 Ga0105246_10114255 3300011119 Bacteria 1989
141 Ga0105246_10220662 3300011119 Bacteria 1486
142 Ga0157370_10003059 3300013104 Bacteria 19840
143 Ga0157370_10019490 3300013104 Bacteria 6803
144 Ga0157370_10049132 3300013104 Bacteria 4039
145 Ga0157369_10002292 3300013105 Bacteria 23011
146 Ga0157369_10006604 3300013105 Bacteria 13416
147 Ga0157369_10318027 3300013105 Bacteria 1618
148 Ga0157374_10209186 3300013296 Bacteria 1912
149 Ga0157374_10750108 3300013296 Bacteria 991
150 Ga0157378_11310780 3300013297 Bacteria 765
151 Ga0163162_10060676 3300013306 Bacteria 3818
152 Ga0163162_10831836 3300013306 Bacteria 1039
153 Ga0157372_10003445 3300013307 Bacteria 17066
154 Ga0157372_10090316 3300013307 Bacteria 3482
155 Ga0157375_11198382 3300013308 Bacteria 891
156 Ga0163163_10022492 3300014325 Bacteria 5971
157 Ga0163163_10093349 3300014325 Bacteria 3026
158 Ga0163163_10986950 3300014325 Unclassified 905
159 Ga0157379_10113841 3300014968 Bacteria 2431
160 Ga0157379_10185203 3300014968 Bacteria 1881
161 Ga0213876_10495525 3300021384 Bacteria 650
162 Ga0207680_10516157 3300025903 Unclassified 852
163 Ga0207699_10275357 3300025906 Bacteria 1168
164 Ga0207705_10216988 3300025909 Bacteria 1452
165 Ga0207654_10023399 3300025911 Bacteria 3309
166 Ga0207654_10028156 3300025911 Bacteria 3062
167 Ga0207654_10048709 3300025911 Bacteria 2426
168 Ga0207654_10083584 3300025911 Unclassified 1928
169 Ga0207654_10145394 3300025911 Bacteria 1516
170 Ga0207654_10155464 3300025911 Bacteria 1472
171 Ga0207707_10012837 3300025912 Bacteria 7288
172 Ga0207695_10000597 3300025913 Bacteria 72390
173 Ga0207695_10033536 3300025913 Bacteria 5598
174 Ga0207695_10089537 3300025913 Bacteria 3094
175 Ga0207695_10091400 3300025913 Bacteria 3058
176 Ga0207695_10327031 3300025913 Bacteria 1422
177 Ga0207695_10863604 3300025913 Unclassified 785
178 Ga0207695_11007919 3300025913 Bacteria 712
179 Ga0207671_10017070 3300025914 Bacteria 5612
180 Ga0207671_10055669 3300025914 Bacteria 2930
181 Ga0207671_10100816 3300025914 Bacteria 2187
182 Ga0207663_10436888 3300025916 Bacteria 1007
183 Ga0207660_10006515 3300025917 Bacteria 7574
184 Ga0207657_10000879 3300025919 Bacteria 31764
185 Ga0207657_10241999 3300025919 Bacteria 1440
186 Ga0207649_10024044 3300025920 Bacteria 3536
187 Ga0207649_10052101 3300025920 Bacteria 2538
188 Ga0207652_10000972 3300025921 Bacteria 26766
189 Ga0207694_10000375 3300025924 Bacteria 41549
190 Ga0207694_10021258 3300025924 Bacteria 4916
191 Ga0207694_10034739 3300025924 Bacteria 3867
192 Ga0207694_10055217 3300025924 Bacteria 3083
193 Ga0207694_10203722 3300025924 Unclassified 1610
194 Ga0207687_10007990 3300025927 Bacteria 6926
195 Ga0207687_10008511 3300025927 Bacteria 6710
196 Ga0207700_10032107 3300025928 Bacteria 3741
197 Ga0207644_10237890 3300025931 Bacteria 1449
198 Ga0207706_10010093 3300025933 Bacteria 8648
199 Ga0207686_10003448 3300025934 Bacteria 8492
200 Ga0207686_10012120 3300025934 Bacteria 4737
201 Ga0207686_10033228 3300025934 Bacteria 3077
202 Ga0207709_10143939 3300025935 Bacteria 1642
203 Ga0207711_10004203 3300025941 Bacteria 12322
204 Ga0207711_10011020 3300025941 Bacteria 7511
205 Ga0207711_10405003 3300025941 Bacteria 1268
206 Ga0207689_10105870 3300025942 Bacteria 2311
207 Ga0207689_10429602 3300025942 Bacteria 1103
208 Ga0207689_10445403 3300025942 Bacteria 1082
209 Ga0207661_10000010 3300025944 Bacteria 375338
210 Ga0207661_10002605 3300025944 Bacteria 12415
211 Ga0207661_10009145 3300025944 Bacteria 7103
212 Ga0207667_10001346 3300025949 Bacteria 30841
213 Ga0207667_10030479 3300025949 Bacteria 5835
214 Ga0207667_10074017 3300025949 Bacteria 3538
215 Ga0207667_10111726 3300025949 Bacteria 2818
216 Ga0207667_10117672 3300025949 Bacteria 2739
217 Ga0207667_10124170 3300025949 Bacteria 2659
218 Ga0207667_10132226 3300025949 Bacteria 2570
219 Ga0207651_10193569 3300025960 Bacteria 1624
220 Ga0207712_10131902 3300025961 Bacteria 1905
221 Ga0207658_10271868 3300025986 Unclassified 1449
222 Ga0207677_10118177 3300026023 Bacteria 1989
223 Ga0207703_10025584 3300026035 Bacteria 4642
224 Ga0207639_10077495 3300026041 Bacteria 2621
225 Ga0207639_10426358 3300026041 Bacteria 1200
226 Ga0207702_10014734 3300026078 Bacteria 6485
227 Ga0207702_10078337 3300026078 Bacteria 2861
228 Ga0207702_10114960 3300026078 Bacteria 2399
229 Ga0207702_10447109 3300026078 Bacteria 1253
230 Ga0207641_10032715 3300026088 Bacteria 4319
231 Ga0207641_10354529 3300026088 Bacteria 1399
232 Ga0207648_10135756 3300026089 Bacteria 2167
233 Ga0207648_10494614 3300026089 Bacteria 1118
234 Ga0207676_10014679 3300026095 Bacteria 5642
235 Ga0207674_10000544 3300026116 Bacteria 49416
236 Ga0207674_10001922 3300026116 Bacteria 26373
237 Ga0207674_10005231 3300026116 Bacteria 15448
238 Ga0207674_10040133 3300026116 Bacteria 4851
239 Ga0207675_100879819 3300026118 Bacteria 911
240 Ga0207698_10005116 3300026142 Bacteria 8059
241 Ga0207698_10652799 3300026142 Bacteria 1042
242 Ga0268266_10546075 3300028379 Bacteria 1110
243 Ga0268264_10214765 3300028381 Bacteria 1768
244 Ga0268264_11061578 3300028381 Bacteria 818
245 Ga0265338_10274135 3300028800 Bacteria 1235
246 Ga0265338_10401742 3300028800 Bacteria 977
247 Ga0265339_10143421 3300031249 Bacteria 1213
248 Ga0265314_10003252 3300031711 Bacteria 15884
249 Ga0373926_0071858 3300035083 Bacteria 1272
250 Ga0373934_0109594 3300035086 Bacteria 1119
251 Ga0373923_0077488 3300035111 Bacteria 1437
252 Ga0373953_0014925 3300035117 Bacteria 2804
253 Ga0373954_0000262 3300035118 Bacteria 18999
254 Ga0373954_0007157 3300035118 Bacteria 4872
255 Ga0373957_0064842 3300035120 Bacteria 1421
256 Ga0373955_0010837 3300035172 Bacteria 4323
257 Ga0373955_0122744 3300035172 Bacteria 1511
258 Ga0373924_0129788 3300035410 Unclassified 1096
259 Ga0373935_0097816 3300035692 Bacteria 1931
260 Ga0373935_0279138 3300035692 Bacteria 1176
261 Ga0373933_0216165 3300035724 Bacteria 1229
262 Ga0373933_0300641 3300035724 Bacteria 1039
263 Ga0373933_0466879 3300035724 Bacteria 826
264 Ga0373947_0061624 3300035725 Bacteria 2280
265 Ga0373947_0553087 3300035725 Bacteria 783
266 Ga0373937_0010662 3300036401 Bacteria 8036
267 Ga0373937_0036772 3300036401 Bacteria 4462
268 Ga0373937_0057937 3300036401 Bacteria 3559
269 Ga0373937_0219793 3300036401 Unclassified 1788
270 Ga0373937_0478349 3300036401 Bacteria 1183
271 Ga0373937_0491294 3300036401 Unclassified 1166
272 Ga0373925_0022340 3300037068 Bacteria 4614
273 Ga0373925_0081454 3300037068 Bacteria 2461
274 Ga0373925_0284744 3300037068 Bacteria 1332
275 Ga0436365_0879315 3300039437 Bacteria 967
276 Ga0436362_0104369 3300039453 Bacteria 1039
277 Ga0495592_0133899 3300046454 Bacteria 1730
278 Ga0495629_0909285 3300046459 Bacteria 576
279 Ga0495651_0377945 3300046462 Bacteria 930
280 Ga0495580_0359559 3300046472 Bacteria 985
281 Ga0495580_0389372 3300046472 Bacteria 941
282 Ga0495582_0006449 3300046473 Bacteria 6517
283 Ga0495664_0200006 3300046477 Bacteria 1211
284 Ga0495594_0026713 3300046499 Bacteria 3108
285 Ga0495594_0455599 3300046499 Bacteria 727
286 Ga0495628_0236130 3300046516 Bacteria 1369
287 Ga0495652_0028792 3300046529 Bacteria 4884
288 Ga0495652_0109742 3300046529 Bacteria 2221
289 Ga0495652_0265987 3300046529 Bacteria 1263
290 Ga0495665_0027529 3300046531 Bacteria 3051
291 Ga0495665_0035331 3300046531 Bacteria 2670
292 Ga0495665_0300982 3300046531 Bacteria 821
293 Ga0495587_0023612 3300046536 Bacteria 3778
294 Ga0495667_0087679 3300046559 Bacteria 2018
295 Ga0495599_0084948 3300046678 Bacteria 1977
296 Ga0495658_0211503 3300046683 Unclassified 1212
297 Ga0495604_0122684 3300047317 Bacteria 1879
298 Ga0495674_0182677 3300047319 Unclassified 1746
299 Ga0495674_0255426 3300047319 Bacteria 1441
300 Ga0495674_0281264 3300047319 Unclassified 1363
301 Ga0495680_0784697 3300047322 Bacteria 623
302 Ga0495684_0012994 3300047471 Bacteria 6427
303 Ga0495593_0203089 3300047673 Bacteria 996
304 Ga0495602_0018739 3300048088 Bacteria 6899
305 Ga0496102_0263481 3300048905 Bacteria 1625
306 Ga0496104_0274659 3300048907 Bacteria 1598
307 Ga0496106_1144409 3300048909 Bacteria 608
308 Ga0496112_0272488 3300048915 Bacteria 1641
309 Ga0495612_0149146 3300053078 Bacteria 1017
310 Ga0495619_0233674 3300053085 Bacteria 1274
311 Ga0500568_0010318 3300053139 Bacteria 4380
312 Ga0070710_10121487
313 Ga0070658_10021656
314 Ga0070683_100001187
315 Ga0070683_100046161
316 Ga0070683_100069901
317 Ga0070690_100149619
318 Ga0068869_100158901
319 Ga0068869_100464358
320 Ga0070666_10052738
321 Ga0070666_10621882
322 Ga0070680_100002378
323 Ga0070680_100400354
324 Ga0068868_100191320
325 Ga0068868_100860841
326 Ga0070660_100098498
327 Ga0070689_100231815
328 Ga0070661_100036342
329 Ga0070661_100079861
330 Ga0070671_101245315
331 Ga0070659_100281922
332 Ga0070709_10404233
333 Ga0070709_10862276
334 Ga0070713_100017337
335 Ga0070713_100859561
336 Ga0070711_100905095
337 Ga0070700_100279366
338 Ga0070662_100012911
339 Ga0070681_10000569
340 Ga0070681_10084952
341 Ga0068867_100150937
342 Ga0070679_100000840
343 Ga0070679_100557889
344 Ga0070684_100000054
345 Ga0070684_100014602
346 Ga0070684_100109001
347 Ga0070684_100238779
348 Ga0070684_100724488
349 Ga0070697_100269892
350 Ga0068853_100215378
351 Ga0068853_100381753
352 Ga0068853_100709155
353 Ga0068853_101310589
354 Ga0070672_100244433
355 Ga0070695_100157904
356 Ga0070665_100004984
357 Ga0070665_100963462
358 Ga0068855_100015833
359 Ga0068855_100022164
360 Ga0068855_100038372
361 Ga0068855_100079538
362 Ga0068855_100080014
363 Ga0068855_100285434
364 Ga0068855_100360226
365 Ga0068855_100567902
366 Ga0068857_100001968
367 Ga0068857_100012396
368 Ga0068857_100121734
369 Ga0068857_100198234
370 Ga0068857_100292300
371 Ga0068856_100024598
372 Ga0068856_100048427
373 Ga0068856_100164537
374 Ga0068856_100204758
375 Ga0068852_100015536
376 Ga0068852_100058671
377 Ga0068852_100706815
378 Ga0068852_101130670
379 Ga0068859_100097585
380 Ga0068859_100150924
381 Ga0068864_100251012
382 Ga0068864_100730700
383 Ga0068864_100887565
384 Ga0068861_100903859
385 Ga0068863_100044238
386 Ga0068863_100559153
387 Ga0068858_100051711
388 Ga0068858_100052611
389 Ga0068858_100269123
390 Ga0068860_100320619
391 Ga0068860_100762185
392 Ga0070717_10224860
393 Ga0070716_100202251
394 Ga0097621_100018965
395 Ga0097621_100321490
396 Ga0097621_101001580
397 Ga0097621_101486795
398 Ga0068871_100005713
399 Ga0068871_100009522
400 Ga0068871_100133222
401 Ga0068865_100028331
402 Ga0068865_100346902
403 Ga0097620_100097579
404 Ga0097620_100150926
405 Ga0105240_10022789
406 Ga0105240_10113979
407 Ga0105240_10200469
408 Ga0105240_10240525
409 Ga0105240_10323275
410 Ga0105240_10342898
411 Ga0105240_10558198
412 Ga0105240_11330152
413 Ga0105245_10079708
414 Ga0105245_10260005
415 Ga0105245_10268612
416 Ga0105247_10331970
417 Ga0105243_11182895
418 Ga0105241_10002235
419 Ga0105241_10037313
420 Ga0105241_10126470
421 Ga0105241_10222621
422 Ga0105241_10225458
423 Ga0105241_10256650
424 Ga0105241_10307183
425 Ga0105241_10495677
426 Ga0105242_10021357
427 Ga0105242_10024178
428 Ga0105242_10035923
429 Ga0105242_10097490
430 Ga0105242_11089914
431 Ga0105248_10002427
432 Ga0105248_10287590
433 Ga0105237_10011618
434 Ga0105237_10124348
435 Ga0105237_10226846
436 Ga0105237_10261913
437 Ga0105237_10540551
438 Ga0105238_10000748
439 Ga0105238_10014034
440 Ga0105238_10062230
441 Ga0105238_10081514
442 Ga0105238_10216008
443 Ga0105238_10483869
444 Ga0105249_10171986
445 Ga0105249_10624625
446 Ga0105239_10030581
447 Ga0105239_10032885
448 Ga0105239_10045242
449 Ga0105239_10117619
450 Ga0105239_10201632
451 Ga0105246_10114255
452 Ga0105246_10220662
453 Ga0157370_10003059
454 Ga0157370_10019490
455 Ga0157370_10049132
456 Ga0157369_10002292
457 Ga0157369_10006604
458 Ga0157369_10318027
459 Ga0157374_10209186
460 Ga0157374_10750108
461 Ga0157378_11310780
462 Ga0163162_10060676
463 Ga0163162_10831836
464 Ga0157372_10003445
465 Ga0157372_10090316
466 Ga0157375_11198382
467 Ga0163163_10022492
468 Ga0163163_10093349
469 Ga0163163_10986950
470 Ga0157379_10113841
471 Ga0157379_10185203
472 Ga0213876_10495525
473 Ga0207680_10516157
474 Ga0207699_10275357
475 Ga0207705_10216988
476 Ga0207654_10023399
477 Ga0207654_10028156
478 Ga0207654_10048709
479 Ga0207654_10083584
480 Ga0207654_10145394
481 Ga0207654_10155464
482 Ga0207707_10012837
483 Ga0207695_10000597
484 Ga0207695_10033536
485 Ga0207695_10089537
486 Ga0207695_10091400
487 Ga0207695_10327031
488 Ga0207695_10863604
489 Ga0207695_11007919
490 Ga0207671_10017070
491 Ga0207671_10055669
492 Ga0207671_10100816
493 Ga0207663_10436888
494 Ga0207660_10006515
495 Ga0207657_10000879
496 Ga0207657_10241999
497 Ga0207649_10024044
498 Ga0207649_10052101
499 Ga0207652_10000972
500 Ga0207694_10000375
501 Ga0207694_10021258
502 Ga0207694_10034739
503 Ga0207694_10055217
504 Ga0207694_10203722
505 Ga0207687_10007990
506 Ga0207687_10008511
507 Ga0207700_10032107
508 Ga0207644_10237890
509 Ga0207706_10010093
510 Ga0207686_10003448
511 Ga0207686_10012120
512 Ga0207686_10033228
513 Ga0207709_10143939
514 Ga0207711_10004203
515 Ga0207711_10011020
516 Ga0207711_10405003
517 Ga0207689_10105870
518 Ga0207689_10429602
519 Ga0207689_10445403
520 Ga0207661_10000010
521 Ga0207661_10002605
522 Ga0207661_10009145
523 Ga0207667_10001346
524 Ga0207667_10030479
525 Ga0207667_10074017
526 Ga0207667_10111726
527 Ga0207667_10117672
528 Ga0207667_10124170
529 Ga0207667_10132226
530 Ga0207651_10193569
531 Ga0207712_10131902
532 Ga0207658_10271868
533 Ga0207677_10118177
534 Ga0207703_10025584
535 Ga0207639_10077495
536 Ga0207639_10426358
537 Ga0207702_10014734
538 Ga0207702_10078337
539 Ga0207702_10114960
540 Ga0207702_10447109
541 Ga0207641_10032715
542 Ga0207641_10354529
543 Ga0207648_10135756
544 Ga0207648_10494614
545 Ga0207676_10014679
546 Ga0207674_10000544
547 Ga0207674_10001922
548 Ga0207674_10005231
549 Ga0207674_10040133
550 Ga0207675_100879819
551 Ga0207698_10005116
552 Ga0207698_10652799
553 Ga0268266_10546075
554 Ga0268264_10214765
555 Ga0268264_11061578
556 Ga0265338_10274135
557 Ga0265338_10401742
558 Ga0265339_10143421
559 Ga0265314_10003252
560 Ga0373926_0071858
561 Ga0373934_0109594
562 Ga0373923_0077488
563 Ga0373953_0014925
564 Ga0373954_0000262
565 Ga0373954_0007157
566 Ga0373957_0064842
567 Ga0373955_0010837
568 Ga0373955_0122744
569 Ga0373924_0129788
570 Ga0373935_0097816
571 Ga0373935_0279138
572 Ga0373933_0216165
573 Ga0373933_0300641
574 Ga0373933_0466879
575 Ga0373947_0061624
576 Ga0373947_0553087
577 Ga0373937_0010662
578 Ga0373937_0036772
579 Ga0373937_0057937
580 Ga0373937_0219793
581 Ga0373937_0478349
582 Ga0373937_0491294
583 Ga0373925_0022340
584 Ga0373925_0081454
585 Ga0373925_0284744
586 Ga0436365_0879315
587 Ga0436362_0104369
588 Ga0495592_0133899
589 Ga0495629_0909285
590 Ga0495651_0377945
591 Ga0495580_0359559
592 Ga0495580_0389372
593 Ga0495582_0006449
594 Ga0495664_0200006
595 Ga0495594_0026713
596 Ga0495594_0455599
597 Ga0495628_0236130
598 Ga0495652_0028792
599 Ga0495652_0109742
600 Ga0495652_0265987
601 Ga0495665_0027529
602 Ga0495665_0035331
603 Ga0495665_0300982
604 Ga0495587_0023612
605 Ga0495667_0087679
606 Ga0495599_0084948
607 Ga0495658_0211503
608 Ga0495604_0122684
609 Ga0495674_0182677
610 Ga0495674_0255426
611 Ga0495674_0281264
612 Ga0495680_0784697
613 Ga0495684_0012994
614 Ga0495593_0203089
615 Ga0495602_0018739
616 Ga0496102_0263481
617 Ga0496104_0274659
618 Ga0496106_1144409
619 Ga0496112_0272488
620 Ga0495612_0149146
621 Ga0495619_0233674
622 Ga0500568_0010318

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01725

Ham1p_like

Ham1 family

3

189

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pyu-assembly1.cif.gz_A-2 structure of the e. coli inosine triphosphate pyrophosphatase rgdb in complex with imp 0.9346 1 187
1k7k-assembly1.cif.gz_A crystal structure of rdgb- inosine triphosphate pyrophosphatase from e. coli 0.9336 1 187
3tqu-assembly2.cif.gz_D structure of a ham1 protein from coxiella burnetii 0.925 1 188
2pyu-assembly1.cif.gz_A-2 structure of the e. coli inosine triphosphate pyrophosphatase rgdb in complex with imp 0.9069 1 187
1k7k-assembly1.cif.gz_A crystal structure of rdgb- inosine triphosphate pyrophosphatase from e. coli 0.9059 1 187
ID Description Score Start End Superfamily
af_P9WMR7_2_201_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9131 1 188 3.90.950.10
af_Q2FZC5_1_195_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.8943 2 187 3.90.950.10
1b78B00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.8909 3 189 3.90.950.10
af_P9WMR7_2_201_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.8906 1 188 3.90.950.10
1b78B00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.8772 3 189 3.90.950.10
ID Description Score Start End GO Terms
AF-A0A2N9JDD3-F1-model_v4 dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) 0.9583 1 189 GO:0000166
GO:0005829
GO:0009117
GO:0009146
GO:0017111
GO:0035870
GO:0036220
GO:0036222
GO:0046872
AF-B9YCE2-F1-model_v4 Non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family 0.9569 30 190 GO:0005829
GO:0009143
GO:0047429
AF-A0A1E7GQ60-F1-model_v4 Non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family 0.9569 31 188 GO:0000166
GO:0005829
GO:0009117
GO:0009143
GO:0017111
GO:0046872
GO:0047429
AF-A0A3B9FX60-F1-model_v4 Non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family 0.9533 33 191 GO:0000166
GO:0005829
GO:0009117
GO:0009143
GO:0017111
GO:0046872
GO:0047429
AF-A0A7V7C3N9-F1-model_v4 RdgB/HAM1 family non-canonical purine NTP pyrophosphatase 0.9524 46 191 GO:0005829
GO:0009143
GO:0047429

Map