F399795
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 308 | 178 | 308 | 426 |
Family's Representative Sequence
| Representative Sequence | 3300039453|Ga0436362_0372503|Ga0436362_0372503_570_1832 |
| Length | 399 |
| Sequence | MQLHRVLRVLLLATTAFGQSSQDSALVVSARALVLHRSAIVIDTHADTPQRFLDRDFDIGSADPHDQGEVSLDKARAGGLGAEFFSIWVDPATTDAVNYAKRAADLMDSVYHQAKRHPDRMMMAYSVADIERAHKEHKLAALMGIEGGHAIEDDLHLLNDFYRLGIRYMTLTWSNTNDWADSSGDADDAKVQHHGGLSDFGRQVIEEMNRLGMLVDISHVADKTFYDAVAISKAPIIASHSSARALTNAPRNMTDDMLKAMARNNGVVMVNFCSCFIDENFRKAQEAVREPMNAAIRDFITRERASGKAPQYIDSEPLEHQWLARIPHVGLGSDFDGVSGALPAGIDSAADLPKITQALIDRGYSNSDIRKILGGNLLRVMKDAELVSHELEAGQNTRK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 2 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 45 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 48 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 49 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 50 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 57 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 58 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 59 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 60 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 62 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 84 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 85 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 87 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 139 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 140 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 141 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 142 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 143 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 144 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 145 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 146 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 147 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 148 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 149 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 150 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 151 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 152 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 153 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 154 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 155 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 156 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 157 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 158 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 159 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 160 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 167 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 168 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 169 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 170 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 171 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 172 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 173 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 174 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 175 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 177 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.35 |
| Metatranscriptomes | 0.65 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.22 |
| Rhizosphere | 95.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10001676 | 3300002459 | Bacteria | 4558 |
| 2 | Ga0058863_11935134 | 3300004799 | Bacteria | 2392 |
| 3 | Ga0065712_10101789 | 3300005290 | Bacteria | 2025 |
| 4 | Ga0070676_10018091 | 3300005328 | Bacteria | 3902 |
| 5 | Ga0070683_100001090 | 3300005329 | Bacteria | 20440 |
| 6 | Ga0070683_100045912 | 3300005329 | Unclassified | 4033 |
| 7 | Ga0070670_100087776 | 3300005331 | Bacteria | 2673 |
| 8 | Ga0070670_100111807 | 3300005331 | Bacteria | 2354 |
| 9 | Ga0070680_100002185 | 3300005336 | Bacteria | 14425 |
| 10 | Ga0068868_100030130 | 3300005338 | Unclassified | 4160 |
| 11 | Ga0070689_100023175 | 3300005340 | Bacteria | 4645 |
| 12 | Ga0070691_10017504 | 3300005341 | Bacteria | 3298 |
| 13 | Ga0070661_100001447 | 3300005344 | Bacteria | 16492 |
| 14 | Ga0070668_100004795 | 3300005347 | Bacteria | 10024 |
| 15 | Ga0070669_100011011 | 3300005353 | Bacteria | 6419 |
| 16 | Ga0070675_100110660 | 3300005354 | Bacteria | 2323 |
| 17 | Ga0070671_100158913 | 3300005355 | Bacteria | 1910 |
| 18 | Ga0070673_100028152 | 3300005364 | Bacteria | 4175 |
| 19 | Ga0070659_100040187 | 3300005366 | Bacteria | 3654 |
| 20 | Ga0070659_100054016 | 3300005366 | Bacteria | 3163 |
| 21 | Ga0070667_100033097 | 3300005367 | Bacteria | 4316 |
| 22 | Ga0070709_10003110 | 3300005434 | Bacteria | 8906 |
| 23 | Ga0070709_10065238 | 3300005434 | Bacteria | 2331 |
| 24 | Ga0070709_10085129 | 3300005434 | Unclassified | 2073 |
| 25 | Ga0070709_10091091 | 3300005434 | Bacteria | 2012 |
| 26 | Ga0070714_100055914 | 3300005435 | Bacteria | 3374 |
| 27 | Ga0070713_100000561 | 3300005436 | Bacteria | 23535 |
| 28 | Ga0070713_100006965 | 3300005436 | Bacteria | 7892 |
| 29 | Ga0070713_100017911 | 3300005436 | Bacteria | 5373 |
| 30 | Ga0070713_100072850 | 3300005436 | Bacteria | 2906 |
| 31 | Ga0070713_100078138 | 3300005436 | Bacteria | 2816 |
| 32 | Ga0070713_100107046 | 3300005436 | Bacteria | 2431 |
| 33 | Ga0070713_100122532 | 3300005436 | Bacteria | 2282 |
| 34 | Ga0070710_10024592 | 3300005437 | Unclassified | 3179 |
| 35 | Ga0070701_10033951 | 3300005438 | Unclassified | 2553 |
| 36 | Ga0070711_100040073 | 3300005439 | Bacteria | 3157 |
| 37 | Ga0070711_100095272 | 3300005439 | Bacteria | 2154 |
| 38 | Ga0070708_100001308 | 3300005445 | Bacteria | 19092 |
| 39 | Ga0070708_100005753 | 3300005445 | Bacteria | 9836 |
| 40 | Ga0070708_100008028 | 3300005445 | Bacteria | 8456 |
| 41 | Ga0070708_100008351 | 3300005445 | Bacteria | 8316 |
| 42 | Ga0070708_100059462 | 3300005445 | Bacteria | 3407 |
| 43 | Ga0070708_100108291 | 3300005445 | Bacteria | 2552 |
| 44 | Ga0070663_100018760 | 3300005455 | Bacteria | 4543 |
| 45 | Ga0070663_100085845 | 3300005455 | Bacteria | 2323 |
| 46 | Ga0070662_100008569 | 3300005457 | Bacteria | 6669 |
| 47 | Ga0070662_100106557 | 3300005457 | Bacteria | 2129 |
| 48 | Ga0070681_10000179 | 3300005458 | Bacteria | 48474 |
| 49 | Ga0070681_10031022 | 3300005458 | Bacteria | 5365 |
| 50 | Ga0070681_10133408 | 3300005458 | Bacteria | 2415 |
| 51 | Ga0068867_100024568 | 3300005459 | Bacteria | 4318 |
| 52 | Ga0070685_10005877 | 3300005466 | Bacteria | 6243 |
| 53 | Ga0070706_100001063 | 3300005467 | Bacteria | 29766 |
| 54 | Ga0070706_100009023 | 3300005467 | Bacteria | 9285 |
| 55 | Ga0070706_100038464 | 3300005467 | Bacteria | 4415 |
| 56 | Ga0070706_100044382 | 3300005467 | Bacteria | 4107 |
| 57 | Ga0070707_100008857 | 3300005468 | Bacteria | 9329 |
| 58 | Ga0070698_100004977 | 3300005471 | Bacteria | 14557 |
| 59 | Ga0070698_100019296 | 3300005471 | Bacteria | 7161 |
| 60 | Ga0070699_100001625 | 3300005518 | Bacteria | 20496 |
| 61 | Ga0070699_100116350 | 3300005518 | Unclassified | 2350 |
| 62 | Ga0070679_100000089 | 3300005530 | Bacteria | 69218 |
| 63 | Ga0070679_100026145 | 3300005530 | Bacteria | 5730 |
| 64 | Ga0070679_100182281 | 3300005530 | Bacteria | 2072 |
| 65 | Ga0070684_100017052 | 3300005535 | Bacteria | 5953 |
| 66 | Ga0070697_100000374 | 3300005536 | Bacteria | 34993 |
| 67 | Ga0070697_100001728 | 3300005536 | Bacteria | 16681 |
| 68 | Ga0070697_100025693 | 3300005536 | Bacteria | 4698 |
| 69 | Ga0070697_100073817 | 3300005536 | Bacteria | 2801 |
| 70 | Ga0068853_100009297 | 3300005539 | Bacteria | 7928 |
| 71 | Ga0068853_100064268 | 3300005539 | Bacteria | 3181 |
| 72 | Ga0068853_100080308 | 3300005539 | Unclassified | 2853 |
| 73 | Ga0070672_100033033 | 3300005543 | Bacteria | 3914 |
| 74 | Ga0070686_100014356 | 3300005544 | Bacteria | 4566 |
| 75 | Ga0070686_100032576 | 3300005544 | Bacteria | 3196 |
| 76 | Ga0070665_100075713 | 3300005548 | Bacteria | 3373 |
| 77 | Ga0068855_100067881 | 3300005563 | Bacteria | 4152 |
| 78 | Ga0068857_100000303 | 3300005577 | Bacteria | 34068 |
| 79 | Ga0068854_100003332 | 3300005578 | Bacteria | 10010 |
| 80 | Ga0068856_100000240 | 3300005614 | Bacteria | 59772 |
| 81 | Ga0068856_100026395 | 3300005614 | Bacteria | 5664 |
| 82 | Ga0068856_100098457 | 3300005614 | Bacteria | 2914 |
| 83 | Ga0068852_100074161 | 3300005616 | Bacteria | 2996 |
| 84 | Ga0068859_100019699 | 3300005617 | Bacteria | 6776 |
| 85 | Ga0068859_100309071 | 3300005617 | Bacteria | 1674 |
| 86 | Ga0068866_10002981 | 3300005718 | Bacteria | 6982 |
| 87 | Ga0068861_100040579 | 3300005719 | Bacteria | 3482 |
| 88 | Ga0068851_10062307 | 3300005834 | Bacteria | 1913 |
| 89 | Ga0068863_100160556 | 3300005841 | Bacteria | 2153 |
| 90 | Ga0068858_100023113 | 3300005842 | Bacteria | 5798 |
| 91 | Ga0070717_10003392 | 3300006028 | Bacteria | 11393 |
| 92 | Ga0070717_10003852 | 3300006028 | Bacteria | 10790 |
| 93 | Ga0070717_10034560 | 3300006028 | Bacteria | 4087 |
| 94 | Ga0070717_10045514 | 3300006028 | Unclassified | 3588 |
| 95 | Ga0070717_10167262 | 3300006028 | Unclassified | 1911 |
| 96 | Ga0070716_100000266 | 3300006173 | Bacteria | 21014 |
| 97 | Ga0070716_100001403 | 3300006173 | Bacteria | 10679 |
| 98 | Ga0070716_100099539 | 3300006173 | Bacteria | 1779 |
| 99 | Ga0070712_100002903 | 3300006175 | Bacteria | 10625 |
| 100 | Ga0070712_100005277 | 3300006175 | Bacteria | 7994 |
| 101 | Ga0068871_100029562 | 3300006358 | Bacteria | 4305 |
| 102 | Ga0075433_10030955 | 3300006852 | Bacteria | 4570 |
| 103 | Ga0075434_100003665 | 3300006871 | Bacteria | 13726 |
| 104 | Ga0075436_100003655 | 3300006914 | Bacteria | 10533 |
| 105 | Ga0075436_100005040 | 3300006914 | Bacteria | 9083 |
| 106 | Ga0097620_100019698 | 3300006931 | Bacteria | 6776 |
| 107 | Ga0097620_100309049 | 3300006931 | Bacteria | 1674 |
| 108 | Ga0075435_100018124 | 3300007076 | Bacteria | 5343 |
| 109 | Ga0105250_10010613 | 3300009092 | Bacteria | 3837 |
| 110 | Ga0105240_10019287 | 3300009093 | Bacteria | 9115 |
| 111 | Ga0105240_10298665 | 3300009093 | Bacteria | 1843 |
| 112 | Ga0105245_10000539 | 3300009098 | Bacteria | 34684 |
| 113 | Ga0105245_10022181 | 3300009098 | Bacteria | 5575 |
| 114 | Ga0105245_10271389 | 3300009098 | Bacteria | 1655 |
| 115 | Ga0105247_10010029 | 3300009101 | Bacteria | 5736 |
| 116 | Ga0105243_10090406 | 3300009148 | Bacteria | 2519 |
| 117 | Ga0105243_10309185 | 3300009148 | Bacteria | 1435 |
| 118 | Ga0105241_10023553 | 3300009174 | Bacteria | 4566 |
| 119 | Ga0105241_10029352 | 3300009174 | Bacteria | 4103 |
| 120 | Ga0105241_10057553 | 3300009174 | Bacteria | 2983 |
| 121 | Ga0105242_10017393 | 3300009176 | Bacteria | 5603 |
| 122 | Ga0105242_10021738 | 3300009176 | Bacteria | 5041 |
| 123 | Ga0105242_10021948 | 3300009176 | Bacteria | 5017 |
| 124 | Ga0105237_10115369 | 3300009545 | Bacteria | 2679 |
| 125 | Ga0105237_10225901 | 3300009545 | Bacteria | 1872 |
| 126 | Ga0105238_10092297 | 3300009551 | Unclassified | 3016 |
| 127 | Ga0105239_10145568 | 3300010375 | Bacteria | 2642 |
| 128 | Ga0105246_10017179 | 3300011119 | Bacteria | 4596 |
| 129 | Ga0157373_10060925 | 3300013100 | Bacteria | 2673 |
| 130 | Ga0157371_10002229 | 3300013102 | Bacteria | 18748 |
| 131 | Ga0157369_10016706 | 3300013105 | Bacteria | 8249 |
| 132 | Ga0157369_10033834 | 3300013105 | Bacteria | 5613 |
| 133 | Ga0157369_10077941 | 3300013105 | Bacteria | 3551 |
| 134 | Ga0157369_10133478 | 3300013105 | Bacteria | 2630 |
| 135 | Ga0157369_10156566 | 3300013105 | Unclassified | 2406 |
| 136 | Ga0157374_10052938 | 3300013296 | Bacteria | 3782 |
| 137 | Ga0163162_10074865 | 3300013306 | Bacteria | 3445 |
| 138 | Ga0157372_10018033 | 3300013307 | Bacteria | 7588 |
| 139 | Ga0163163_10005653 | 3300014325 | Bacteria | 10841 |
| 140 | Ga0163163_10047538 | 3300014325 | Bacteria | 4218 |
| 141 | Ga0157380_10081636 | 3300014326 | Bacteria | 2645 |
| 142 | Ga0157377_10005494 | 3300014745 | Bacteria | 5962 |
| 143 | Ga0157376_10006505 | 3300014969 | Bacteria | 8260 |
| 144 | Ga0182006_1027225 | 3300015261 | Bacteria | 2334 |
| 145 | Ga0182007_10003686 | 3300015262 | Bacteria | 7170 |
| 146 | Ga0163161_10011286 | 3300017792 | Bacteria | 6191 |
| 147 | Ga0228598_1000129 | 3300024227 | Bacteria | 12851 |
| 148 | Ga0207697_10001415 | 3300025315 | Bacteria | 13133 |
| 149 | Ga0207656_10026391 | 3300025321 | Bacteria | 2368 |
| 150 | Ga0207710_10013168 | 3300025900 | Unclassified | 3485 |
| 151 | Ga0207688_10012155 | 3300025901 | Bacteria | 4684 |
| 152 | Ga0207680_10061450 | 3300025903 | Bacteria | 2291 |
| 153 | Ga0207647_10015912 | 3300025904 | Bacteria | 5147 |
| 154 | Ga0207699_10005666 | 3300025906 | Bacteria | 5998 |
| 155 | Ga0207699_10010275 | 3300025906 | Bacteria | 4690 |
| 156 | Ga0207699_10024676 | 3300025906 | Bacteria | 3290 |
| 157 | Ga0207699_10069861 | 3300025906 | Bacteria | 2143 |
| 158 | Ga0207645_10000073 | 3300025907 | Bacteria | 71786 |
| 159 | Ga0207643_10002582 | 3300025908 | Bacteria | 9795 |
| 160 | Ga0207705_10061374 | 3300025909 | Bacteria | 2716 |
| 161 | Ga0207684_10001271 | 3300025910 | Bacteria | 27841 |
| 162 | Ga0207684_10002114 | 3300025910 | Bacteria | 20371 |
| 163 | Ga0207684_10063886 | 3300025910 | Bacteria | 3125 |
| 164 | Ga0207654_10005326 | 3300025911 | Bacteria | 6498 |
| 165 | Ga0207707_10001177 | 3300025912 | Bacteria | 24644 |
| 166 | Ga0207707_10031615 | 3300025912 | Bacteria | 4632 |
| 167 | Ga0207707_10044133 | 3300025912 | Bacteria | 3888 |
| 168 | Ga0207695_10010685 | 3300025913 | Bacteria | 11213 |
| 169 | Ga0207695_10092392 | 3300025913 | Bacteria | 3037 |
| 170 | Ga0207695_10128352 | 3300025913 | Bacteria | 2495 |
| 171 | Ga0207695_10188903 | 3300025913 | Bacteria | 1978 |
| 172 | Ga0207693_10001860 | 3300025915 | Bacteria | 18476 |
| 173 | Ga0207693_10006023 | 3300025915 | Bacteria | 10053 |
| 174 | Ga0207693_10014695 | 3300025915 | Bacteria | 6290 |
| 175 | Ga0207693_10127739 | 3300025915 | Bacteria | 1998 |
| 176 | Ga0207693_10166073 | 3300025915 | Bacteria | 1737 |
| 177 | Ga0207660_10000064 | 3300025917 | Bacteria | 55686 |
| 178 | Ga0207657_10000379 | 3300025919 | Bacteria | 47118 |
| 179 | Ga0207657_10001005 | 3300025919 | Bacteria | 30014 |
| 180 | Ga0207649_10001371 | 3300025920 | Bacteria | 14450 |
| 181 | Ga0207652_10042654 | 3300025921 | Bacteria | 3862 |
| 182 | Ga0207652_10118874 | 3300025921 | Bacteria | 2350 |
| 183 | Ga0207650_10000045 | 3300025925 | Bacteria | 181507 |
| 184 | Ga0207687_10016308 | 3300025927 | Bacteria | 4878 |
| 185 | Ga0207700_10000650 | 3300025928 | Bacteria | 20313 |
| 186 | Ga0207700_10017040 | 3300025928 | Bacteria | 4841 |
| 187 | Ga0207700_10023275 | 3300025928 | Bacteria | 4267 |
| 188 | Ga0207700_10121936 | 3300025928 | Bacteria | 2115 |
| 189 | Ga0207700_10212522 | 3300025928 | Bacteria | 1636 |
| 190 | Ga0207664_10017230 | 3300025929 | Bacteria | 5290 |
| 191 | Ga0207706_10000213 | 3300025933 | Bacteria | 63821 |
| 192 | Ga0207706_10001614 | 3300025933 | Bacteria | 22381 |
| 193 | Ga0207686_10093925 | 3300025934 | Bacteria | 1987 |
| 194 | Ga0207686_10183837 | 3300025934 | Bacteria | 1484 |
| 195 | Ga0207670_10100065 | 3300025936 | Bacteria | 2069 |
| 196 | Ga0207665_10003206 | 3300025939 | Bacteria | 10965 |
| 197 | Ga0207665_10006136 | 3300025939 | Bacteria | 7979 |
| 198 | Ga0207665_10017602 | 3300025939 | Bacteria | 4696 |
| 199 | Ga0207665_10029215 | 3300025939 | Bacteria | 3645 |
| 200 | Ga0207665_10030100 | 3300025939 | Bacteria | 3588 |
| 201 | Ga0207691_10000556 | 3300025940 | Bacteria | 37289 |
| 202 | Ga0207711_10000749 | 3300025941 | Bacteria | 31810 |
| 203 | Ga0207711_10015005 | 3300025941 | Bacteria | 6435 |
| 204 | Ga0207689_10000780 | 3300025942 | Bacteria | 30597 |
| 205 | Ga0207689_10048460 | 3300025942 | Bacteria | 3504 |
| 206 | Ga0207661_10003233 | 3300025944 | Bacteria | 11292 |
| 207 | Ga0207661_10007216 | 3300025944 | Bacteria | 7898 |
| 208 | Ga0207679_10000096 | 3300025945 | Bacteria | 76971 |
| 209 | Ga0207679_10196845 | 3300025945 | Unclassified | 1680 |
| 210 | Ga0207667_10005088 | 3300025949 | Bacteria | 16059 |
| 211 | Ga0207667_10005625 | 3300025949 | Bacteria | 15289 |
| 212 | Ga0207651_10011411 | 3300025960 | Bacteria | 4975 |
| 213 | Ga0207712_10073676 | 3300025961 | Bacteria | 2464 |
| 214 | Ga0207668_10005927 | 3300025972 | Bacteria | 7200 |
| 215 | Ga0207677_10015780 | 3300026023 | Bacteria | 4455 |
| 216 | Ga0207703_10021954 | 3300026035 | Bacteria | 4999 |
| 217 | Ga0207703_10034960 | 3300026035 | Bacteria | 3991 |
| 218 | Ga0207639_10052581 | 3300026041 | Bacteria | 3104 |
| 219 | Ga0207678_10000026 | 3300026067 | Bacteria | 116850 |
| 220 | Ga0207678_10000103 | 3300026067 | Bacteria | 69649 |
| 221 | Ga0207702_10000711 | 3300026078 | Bacteria | 35806 |
| 222 | Ga0207641_10000075 | 3300026088 | Bacteria | 145149 |
| 223 | Ga0207648_10000679 | 3300026089 | Bacteria | 38160 |
| 224 | Ga0207648_10136441 | 3300026089 | Bacteria | 2161 |
| 225 | Ga0207676_10000212 | 3300026095 | Bacteria | 50034 |
| 226 | Ga0207676_10221308 | 3300026095 | Bacteria | 1686 |
| 227 | Ga0207674_10000670 | 3300026116 | Bacteria | 44517 |
| 228 | Ga0207674_10250859 | 3300026116 | Bacteria | 1717 |
| 229 | Ga0207675_100033917 | 3300026118 | Bacteria | 4757 |
| 230 | Ga0207683_10000438 | 3300026121 | Bacteria | 38515 |
| 231 | Ga0207683_10009712 | 3300026121 | Bacteria | 8207 |
| 232 | Ga0207698_10147754 | 3300026142 | Bacteria | 2035 |
| 233 | Ga0268266_10001444 | 3300028379 | Bacteria | 28286 |
| 234 | Ga0268266_10049093 | 3300028379 | Bacteria | 3618 |
| 235 | Ga0268265_10008138 | 3300028380 | Bacteria | 7086 |
| 236 | Ga0268264_10113497 | 3300028381 | Bacteria | 2377 |
| 237 | Ga0265338_10003670 | 3300028800 | Bacteria | 21390 |
| 238 | Ga0265338_10081539 | 3300028800 | Bacteria | 2712 |
| 239 | Ga0265760_10006617 | 3300031090 | Bacteria | 3316 |
| 240 | Ga0265339_10006686 | 3300031249 | Bacteria | 7537 |
| 241 | Ga0265339_10024708 | 3300031249 | Bacteria | 3458 |
| 242 | Ga0265316_10004401 | 3300031344 | Bacteria | 14029 |
| 243 | Ga0265316_10012508 | 3300031344 | Bacteria | 7606 |
| 244 | Ga0265316_10023588 | 3300031344 | Bacteria | 5167 |
| 245 | Ga0265314_10007310 | 3300031711 | Bacteria | 9593 |
| 246 | Ga0265314_10019093 | 3300031711 | Bacteria | 5319 |
| 247 | Ga0265314_10040685 | 3300031711 | Bacteria | 3334 |
| 248 | Ga0373926_0028800 | 3300035083 | Bacteria | 1950 |
| 249 | Ga0373936_0002065 | 3300035113 | Bacteria | 7450 |
| 250 | Ga0373945_0001146 | 3300035116 | Bacteria | 8030 |
| 251 | Ga0373945_0015017 | 3300035116 | Bacteria | 2601 |
| 252 | Ga0373943_0000002 | 3300035170 | Bacteria | 106064 |
| 253 | Ga0373943_0017239 | 3300035170 | Bacteria | 3303 |
| 254 | Ga0373955_0008819 | 3300035172 | Bacteria | 4700 |
| 255 | Ga0373924_0000072 | 3300035410 | Bacteria | 27145 |
| 256 | Ga0373924_0052237 | 3300035410 | Bacteria | 1696 |
| 257 | Ga0373935_0009140 | 3300035692 | Bacteria | 5931 |
| 258 | Ga0373935_0045317 | 3300035692 | Bacteria | 2775 |
| 259 | Ga0373935_0139527 | 3300035692 | Unclassified | 1636 |
| 260 | Ga0373927_0000021 | 3300035695 | Bacteria | 124647 |
| 261 | Ga0373927_0006499 | 3300035695 | Bacteria | 7963 |
| 262 | Ga0373933_0028548 | 3300035724 | Bacteria | 3220 |
| 263 | Ga0373933_0061565 | 3300035724 | Bacteria | 2265 |
| 264 | Ga0373933_0066081 | 3300035724 | Unclassified | 2191 |
| 265 | Ga0373933_0069417 | 3300035724 | Bacteria | 2142 |
| 266 | Ga0373947_0000800 | 3300035725 | Bacteria | 18959 |
| 267 | Ga0373947_0097388 | 3300035725 | Unclassified | 1843 |
| 268 | Ga0373937_0000139 | 3300036401 | Bacteria | 70018 |
| 269 | Ga0373937_0168569 | 3300036401 | Bacteria | 2054 |
| 270 | Ga0373925_0000829 | 3300037068 | Bacteria | 28513 |
| 271 | Ga0373925_0010372 | 3300037068 | Bacteria | 6760 |
| 272 | Ga0373925_0046919 | 3300037068 | Bacteria | 3214 |
| 273 | Ga0373925_0113975 | 3300037068 | Bacteria | 2091 |
| 274 | Ga0373925_0142717 | 3300037068 | Bacteria | 1875 |
| 275 | Ga0395898_0053749 | 3300037466 | Bacteria | 3933 |
| 276 | Ga0436362_0372503 | 3300039453 | Bacteria | 10579 |
| 277 | Ga0466963_0004580 | 3300044694 | Bacteria | 8047 |
| 278 | Ga0466959_0060725 | 3300045049 | Unclassified | 2750 |
| 279 | Ga0466967_0002538 | 3300045976 | Bacteria | 11430 |
| 280 | Ga0466967_0019543 | 3300045976 | Bacteria | 5450 |
| 281 | Ga0495653_0137129 | 3300046463 | Bacteria | 1725 |
| 282 | Ga0495580_0002155 | 3300046472 | Bacteria | 17299 |
| 283 | Ga0495580_0006771 | 3300046472 | Bacteria | 9291 |
| 284 | Ga0495580_0007871 | 3300046472 | Bacteria | 8527 |
| 285 | Ga0495580_0036249 | 3300046472 | Bacteria | 3542 |
| 286 | Ga0495580_0061664 | 3300046472 | Bacteria | 2632 |
| 287 | Ga0495664_0041163 | 3300046477 | Unclassified | 2733 |
| 288 | Ga0495635_0034056 | 3300046663 | Unclassified | 3534 |
| 289 | Ga0495599_0059461 | 3300046678 | Unclassified | 2391 |
| 290 | Ga0495674_0133464 | 3300047319 | Unclassified | 2090 |
| 291 | Ga0496105_0006729 | 3300048908 | Bacteria | 8838 |
| 292 | Ga0496108_0000304 | 3300048911 | Bacteria | 42250 |
| 293 | Ga0496109_0000164 | 3300048912 | Bacteria | 65491 |
| 294 | Ga0496110_0002655 | 3300048913 | Bacteria | 13491 |
| 295 | Ga0496110_0245476 | 3300048913 | Bacteria | 1630 |
| 296 | Ga0496111_0002195 | 3300048914 | Bacteria | 11701 |
| 297 | Ga0496111_0009537 | 3300048914 | Bacteria | 6487 |
| 298 | Ga0496112_0000078 | 3300048915 | Bacteria | 64712 |
| 299 | Ga0496112_0009798 | 3300048915 | Bacteria | 8653 |
| 300 | Ga0496112_0061875 | 3300048915 | Bacteria | 3691 |
| 301 | Ga0496113_0000536 | 3300048916 | Bacteria | 18720 |
| 302 | Ga0496113_0000617 | 3300048916 | Bacteria | 17839 |
| 303 | Ga0496115_0053907 | 3300048918 | Unclassified | 3229 |
| 304 | nmdc:mga0rr50_7939_c1 | 3300050513 | Bacteria | 6584 |
| 305 | nmdc:mga08x19_27110_c1 | 3300050514 | Bacteria | 3582 |
| 306 | nmdc:mga0a205_35472_c1 | 3300050515 | Bacteria | 4790 |
| 307 | Ga0495601_0009440 | 3300053077 | Bacteria | 5770 |
| 308 | Ga0495612_0026712 | 3300053078 | Unclassified | 2320 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025906 | Ga0207699_10010275 | Ga0207699_100102756 | 368 |
| 2 | 3300005467 | Ga0070706_100044382 | Ga0070706_1000443825 | 378 |
| 3 | 3300005471 | Ga0070698_100019296 | Ga0070698_1000192962 | 378 |
| 4 | 3300028800 | Ga0265338_10003670 | Ga0265338_100036708 | 378 |
| 5 | 3300026035 | Ga0207703_10034960 | Ga0207703_100349602 | 389 |
| 6 | 3300046472 | Ga0495580_0036249 | Ga0495580_0036249_1384_2583 | 389 |
| 7 | 3300025928 | Ga0207700_10000650 | Ga0207700_1000065021 | 390 |
| 8 | 3300005436 | Ga0070713_100078138 | Ga0070713_1000781383 | 393 |
| 9 | 3300005439 | Ga0070711_100095272 | Ga0070711_1000952721 | 393 |
| 10 | 3300025915 | Ga0207693_10014695 | Ga0207693_100146952 | 393 |
| 11 | 3300031249 | Ga0265339_10024708 | Ga0265339_100247083 | 393 |
| 12 | 3300031711 | Ga0265314_10019093 | Ga0265314_100190936 | 394 |
| 13 | 3300005341 | Ga0070691_10017504 | Ga0070691_100175042 | 395 |
| 14 | 3300005347 | Ga0070668_100004795 | Ga0070668_1000047956 | 395 |
| 15 | 3300005366 | Ga0070659_100054016 | Ga0070659_1000540162 | 395 |
| 16 | 3300005455 | Ga0070663_100018760 | Ga0070663_1000187606 | 395 |
| 17 | 3300005458 | Ga0070681_10031022 | Ga0070681_100310222 | 395 |
| 18 | 3300005539 | Ga0068853_100064268 | Ga0068853_1000642682 | 395 |
| 19 | 3300005548 | Ga0070665_100075713 | Ga0070665_1000757133 | 395 |
| 20 | 3300005578 | Ga0068854_100003332 | Ga0068854_1000033327 | 395 |
| 21 | 3300005616 | Ga0068852_100074161 | Ga0068852_1000741612 | 395 |
| 22 | 3300005617 | Ga0068859_100019699 | Ga0068859_1000196993 | 395 |
| 23 | 3300005834 | Ga0068851_10062307 | Ga0068851_100623072 | 395 |
| 24 | 3300006175 | Ga0070712_100005277 | Ga0070712_1000052778 | 395 |
| 25 | 3300006931 | Ga0097620_100019698 | Ga0097620_1000196983 | 395 |
| 26 | 3300009148 | Ga0105243_10090406 | Ga0105243_100904062 | 395 |
| 27 | 3300009174 | Ga0105241_10023553 | Ga0105241_100235531 | 395 |
| 28 | 3300009176 | Ga0105242_10017393 | Ga0105242_100173937 | 395 |
| 29 | 3300025321 | Ga0207656_10026391 | Ga0207656_100263912 | 395 |
| 30 | 3300025911 | Ga0207654_10005326 | Ga0207654_100053264 | 395 |
| 31 | 3300025928 | Ga0207700_10121936 | Ga0207700_101219362 | 395 |
| 32 | 3300025934 | Ga0207686_10093925 | Ga0207686_100939252 | 395 |
| 33 | 3300025939 | Ga0207665_10017602 | Ga0207665_100176021 | 395 |
| 34 | 3300025941 | Ga0207711_10000749 | Ga0207711_1000074911 | 395 |
| 35 | 3300025942 | Ga0207689_10048460 | Ga0207689_100484602 | 395 |
| 36 | 3300025949 | Ga0207667_10005625 | Ga0207667_100056252 | 395 |
| 37 | 3300025972 | Ga0207668_10005927 | Ga0207668_100059279 | 395 |
| 38 | 3300026067 | Ga0207678_10000103 | Ga0207678_1000010340 | 395 |
| 39 | 3300026089 | Ga0207648_10136441 | Ga0207648_101364411 | 395 |
| 40 | 3300026095 | Ga0207676_10221308 | Ga0207676_102213082 | 395 |
| 41 | 3300028379 | Ga0268266_10049093 | Ga0268266_100490935 | 395 |
| 42 | 3300028381 | Ga0268264_10113497 | Ga0268264_101134972 | 395 |
| 43 | 3300039453 | Ga0436362_0372503 | Ga0436362_0372503_570_1832 | 395 |
| 44 | 3300046472 | Ga0495580_0007871 | Ga0495580_0007871_1540_2793 | 395 |
| 45 | 3300005614 | Ga0068856_100000240 | Ga0068856_10000024041 | 396 |
| 46 | 3300006173 | Ga0070716_100099539 | Ga0070716_1000995393 | 396 |
| 47 | 3300026078 | Ga0207702_10000711 | Ga0207702_1000071121 | 396 |
| 48 | 3300031344 | Ga0265316_10004401 | Ga0265316_100044014 | 396 |
| 49 | 3300031711 | Ga0265314_10007310 | Ga0265314_100073104 | 396 |
| 50 | 3300035724 | Ga0373933_0028548 | Ga0373933_0028548_1275_2543 | 396 |
| 51 | 3300036401 | Ga0373937_0168569 | Ga0373937_0168569_445_1713 | 396 |
| 52 | 3300005436 | Ga0070713_100017911 | Ga0070713_1000179112 | 397 |
| 53 | 3300005445 | Ga0070708_100005753 | Ga0070708_1000057532 | 397 |
| 54 | 3300005445 | Ga0070708_100108291 | Ga0070708_1001082911 | 397 |
| 55 | 3300005536 | Ga0070697_100073817 | Ga0070697_1000738172 | 397 |
| 56 | 3300006028 | Ga0070717_10003392 | Ga0070717_1000339212 | 397 |
| 57 | 3300025961 | Ga0207712_10073676 | Ga0207712_100736762 | 397 |
| 58 | 3300028800 | Ga0265338_10081539 | Ga0265338_100815392 | 397 |
| 59 | 3300031249 | Ga0265339_10006686 | Ga0265339_100066864 | 397 |
| 60 | 3300031344 | Ga0265316_10012508 | Ga0265316_100125082 | 397 |
| 61 | 3300031344 | Ga0265316_10023588 | Ga0265316_100235885 | 397 |
| 62 | 3300031711 | Ga0265314_10040685 | Ga0265314_100406853 | 397 |
| 63 | 3300005434 | Ga0070709_10003110 | Ga0070709_100031105 | 399 |
| 64 | 3300005436 | Ga0070713_100000561 | Ga0070713_10000056116 | 399 |
| 65 | 3300006173 | Ga0070716_100001403 | Ga0070716_1000014035 | 399 |
| 66 | 3300006175 | Ga0070712_100002903 | Ga0070712_1000029035 | 399 |
| 67 | 3300025906 | Ga0207699_10005666 | Ga0207699_100056665 | 399 |
| 68 | 3300048913 | Ga0496110_0245476 | Ga0496110_0245476_352_1584 | 399 |
| 69 | 3300048915 | Ga0496112_0009798 | Ga0496112_0009798_6780_8012 | 399 |
| 70 | 3300005367 | Ga0070667_100033097 | Ga0070667_1000330975 | 400 |
| 71 | 3300005457 | Ga0070662_100008569 | Ga0070662_1000085697 | 400 |
| 72 | 3300005458 | Ga0070681_10133408 | Ga0070681_101334081 | 400 |
| 73 | 3300005544 | Ga0070686_100014356 | Ga0070686_1000143561 | 400 |
| 74 | 3300006028 | Ga0070717_10045514 | Ga0070717_100455145 | 400 |
| 75 | 3300006358 | Ga0068871_100029562 | Ga0068871_1000295624 | 400 |
| 76 | 3300009093 | Ga0105240_10298665 | Ga0105240_102986652 | 400 |
| 77 | 3300009148 | Ga0105243_10309185 | Ga0105243_103091851 | 400 |
| 78 | 3300009174 | Ga0105241_10057553 | Ga0105241_100575531 | 400 |
| 79 | 3300009176 | Ga0105242_10021738 | Ga0105242_100217387 | 400 |
| 80 | 3300011119 | Ga0105246_10017179 | Ga0105246_100171792 | 400 |
| 81 | 3300013105 | Ga0157369_10077941 | Ga0157369_100779415 | 400 |
| 82 | 3300025912 | Ga0207707_10044133 | Ga0207707_100441332 | 400 |
| 83 | 3300025913 | Ga0207695_10010685 | Ga0207695_100106852 | 400 |
| 84 | 3300025919 | Ga0207657_10001005 | Ga0207657_100010056 | 400 |
| 85 | 3300025933 | Ga0207706_10001614 | Ga0207706_100016149 | 400 |
| 86 | 3300025934 | Ga0207686_10183837 | Ga0207686_101838371 | 400 |
| 87 | 3300025939 | Ga0207665_10029215 | Ga0207665_100292152 | 400 |
| 88 | 3300025945 | Ga0207679_10196845 | Ga0207679_101968452 | 400 |
| 89 | 3300026121 | Ga0207683_10009712 | Ga0207683_100097127 | 400 |
| 90 | 3300048915 | Ga0496112_0061875 | Ga0496112_0061875_1702_2949 | 400 |
| 91 | 3300004799 | Ga0058863_11935134 | Ga0058863_119351342 | 401 |
| 92 | 3300005336 | Ga0070680_100002185 | Ga0070680_1000021852 | 401 |
| 93 | 3300005458 | Ga0070681_10000179 | Ga0070681_1000017937 | 401 |
| 94 | 3300005530 | Ga0070679_100000089 | Ga0070679_10000008960 | 401 |
| 95 | 3300025912 | Ga0207707_10001177 | Ga0207707_1000117730 | 401 |
| 96 | 3300025915 | Ga0207693_10001860 | Ga0207693_100018602 | 401 |
| 97 | 3300025917 | Ga0207660_10000064 | Ga0207660_1000006442 | 401 |
| 98 | 3300025921 | Ga0207652_10042654 | Ga0207652_100426544 | 401 |
| 99 | 3300046472 | Ga0495580_0002155 | Ga0495580_0002155_917_2167 | 401 |
| 100 | 3300005445 | Ga0070708_100008028 | Ga0070708_1000080283 | 402 |
| 101 | 3300005445 | Ga0070708_100001308 | Ga0070708_1000013089 | 403 |
| 102 | 3300005467 | Ga0070706_100001063 | Ga0070706_10000106318 | 403 |
| 103 | 3300005536 | Ga0070697_100000374 | Ga0070697_10000037419 | 403 |
| 104 | 3300006852 | Ga0075433_10030955 | Ga0075433_100309553 | 403 |
| 105 | 3300006871 | Ga0075434_100003665 | Ga0075434_10000366511 | 403 |
| 106 | 3300006914 | Ga0075436_100003655 | Ga0075436_1000036555 | 403 |
| 107 | 3300007076 | Ga0075435_100018124 | Ga0075435_1000181244 | 403 |
| 108 | 3300025910 | Ga0207684_10001271 | Ga0207684_1000127121 | 403 |
| 109 | 3300048914 | Ga0496111_0009537 | Ga0496111_0009537_2101_3570 | 403 |
| 110 | 3300050513 | nmdc:mga0rr50_7939_c1 | nmdc:mga0rr50_7939_c1_3017_4255 | 403 |
| 111 | 3300050515 | nmdc:mga0a205_35472_c1 | nmdc:mga0a205_35472_c1_1553_2791 | 403 |
| 112 | 3300037466 | Ga0395898_0053749 | Ga0395898_0053749_1235_2710 | 405 |
| 113 | 3300013105 | Ga0157369_10133478 | Ga0157369_101334783 | 406 |
| 114 | 3300025913 | Ga0207695_10128352 | Ga0207695_101283522 | 406 |
| 115 | 3300025949 | Ga0207667_10005088 | Ga0207667_1000508811 | 406 |
| 116 | 3300035116 | Ga0373945_0015017 | Ga0373945_0015017_66_1541 | 406 |
| 117 | 3300035172 | Ga0373955_0008819 | Ga0373955_0008819_720_2177 | 406 |
| 118 | 3300035410 | Ga0373924_0000072 | Ga0373924_0000072_7898_9373 | 406 |
| 119 | 3300035692 | Ga0373935_0045317 | Ga0373935_0045317_234_1691 | 406 |
| 120 | 3300035724 | Ga0373933_0069417 | Ga0373933_0069417_204_1661 | 406 |
| 121 | 3300036401 | Ga0373937_0000139 | Ga0373937_0000139_45303_46775 | 406 |
| 122 | 3300045049 | Ga0466959_0060725 | Ga0466959_0060725_1202_2650 | 406 |
| 123 | 3300035083 | Ga0373926_0028800 | Ga0373926_0028800_59_1534 | 407 |
| 124 | 3300035170 | Ga0373943_0017239 | Ga0373943_0017239_44_1519 | 407 |
| 125 | 3300035692 | Ga0373935_0139527 | Ga0373935_0139527_111_1586 | 407 |
| 126 | 3300035695 | Ga0373927_0006499 | Ga0373927_0006499_43_1518 | 407 |
| 127 | 3300035724 | Ga0373933_0061565 | Ga0373933_0061565_601_2076 | 407 |
| 128 | 3300035725 | Ga0373947_0097388 | Ga0373947_0097388_296_1771 | 407 |
| 129 | 3300037068 | Ga0373925_0010372 | Ga0373925_0010372_1963_3438 | 407 |
| 130 | 3300037068 | Ga0373925_0113975 | Ga0373925_0113975_523_1998 | 407 |
| 131 | 3300037068 | Ga0373925_0142717 | Ga0373925_0142717_23_1498 | 407 |
| 132 | 3300045976 | Ga0466967_0019543 | Ga0466967_0019543_1080_2567 | 407 |
| 133 | 3300046463 | Ga0495653_0137129 | Ga0495653_0137129_170_1645 | 407 |
| 134 | 3300046472 | Ga0495580_0061664 | Ga0495580_0061664_579_2054 | 407 |
| 135 | 3300046663 | Ga0495635_0034056 | Ga0495635_0034056_1534_3009 | 407 |
| 136 | 3300048916 | Ga0496113_0000536 | Ga0496113_0000536_16134_17609 | 407 |
| 137 | 3300005329 | Ga0070683_100045912 | Ga0070683_1000459123 | 408 |
| 138 | 3300005434 | Ga0070709_10085129 | Ga0070709_100851292 | 408 |
| 139 | 3300005434 | Ga0070709_10091091 | Ga0070709_100910912 | 408 |
| 140 | 3300005435 | Ga0070714_100055914 | Ga0070714_1000559142 | 408 |
| 141 | 3300005436 | Ga0070713_100006965 | Ga0070713_1000069654 | 408 |
| 142 | 3300005436 | Ga0070713_100072850 | Ga0070713_1000728502 | 408 |
| 143 | 3300005436 | Ga0070713_100122532 | Ga0070713_1001225322 | 408 |
| 144 | 3300005437 | Ga0070710_10024592 | Ga0070710_100245923 | 408 |
| 145 | 3300005530 | Ga0070679_100026145 | Ga0070679_1000261455 | 408 |
| 146 | 3300005539 | Ga0068853_100009297 | Ga0068853_1000092977 | 408 |
| 147 | 3300005614 | Ga0068856_100098457 | Ga0068856_1000984573 | 408 |
| 148 | 3300006028 | Ga0070717_10034560 | Ga0070717_100345604 | 408 |
| 149 | 3300009098 | Ga0105245_10000539 | Ga0105245_1000053927 | 408 |
| 150 | 3300009551 | Ga0105238_10092297 | Ga0105238_100922972 | 408 |
| 151 | 3300013105 | Ga0157369_10033834 | Ga0157369_100338346 | 408 |
| 152 | 3300025906 | Ga0207699_10024676 | Ga0207699_100246762 | 408 |
| 153 | 3300025921 | Ga0207652_10118874 | Ga0207652_101188742 | 408 |
| 154 | 3300025927 | Ga0207687_10016308 | Ga0207687_100163085 | 408 |
| 155 | 3300025928 | Ga0207700_10017040 | Ga0207700_100170405 | 408 |
| 156 | 3300025928 | Ga0207700_10023275 | Ga0207700_100232755 | 408 |
| 157 | 3300025928 | Ga0207700_10212522 | Ga0207700_102125221 | 408 |
| 158 | 3300025929 | Ga0207664_10017230 | Ga0207664_100172304 | 408 |
| 159 | 3300025939 | Ga0207665_10003206 | Ga0207665_100032066 | 408 |
| 160 | 3300025944 | Ga0207661_10007216 | Ga0207661_100072162 | 408 |
| 161 | 3300026116 | Ga0207674_10250859 | Ga0207674_102508592 | 408 |
| 162 | 3300026142 | Ga0207698_10147754 | Ga0207698_101477542 | 408 |
| 163 | 3300035410 | Ga0373924_0052237 | Ga0373924_0052237_119_1594 | 408 |
| 164 | 3300044694 | Ga0466963_0004580 | Ga0466963_0004580_6062_7540 | 408 |
| 165 | 3300045976 | Ga0466967_0002538 | Ga0466967_0002538_3526_5004 | 408 |
| 166 | 3300046678 | Ga0495599_0059461 | Ga0495599_0059461_902_2374 | 408 |
| 167 | 3300048908 | Ga0496105_0006729 | Ga0496105_0006729_797_2269 | 408 |
| 168 | 3300053077 | Ga0495601_0009440 | Ga0495601_0009440_2751_4217 | 408 |
| 169 | 3300035113 | Ga0373936_0002065 | Ga0373936_0002065_1451_2725 | 409 |
| 170 | 3300035116 | Ga0373945_0001146 | Ga0373945_0001146_6447_7721 | 409 |
| 171 | 3300035170 | Ga0373943_0000002 | Ga0373943_0000002_11364_12638 | 409 |
| 172 | 3300035692 | Ga0373935_0009140 | Ga0373935_0009140_3634_4908 | 409 |
| 173 | 3300035695 | Ga0373927_0000021 | Ga0373927_0000021_12533_13807 | 409 |
| 174 | 3300035725 | Ga0373947_0000800 | Ga0373947_0000800_15478_16752 | 409 |
| 175 | 3300037068 | Ga0373925_0000829 | Ga0373925_0000829_18601_19875 | 409 |
| 176 | 3300046477 | Ga0495664_0041163 | Ga0495664_0041163_1348_2622 | 409 |
| 177 | 3300047319 | Ga0495674_0133464 | Ga0495674_0133464_668_1942 | 409 |
| 178 | 3300053078 | Ga0495612_0026712 | Ga0495612_0026712_383_1657 | 409 |
| 179 | 3300005536 | Ga0070697_100025693 | Ga0070697_1000256933 | 410 |
| 180 | 3300009093 | Ga0105240_10019287 | Ga0105240_100192873 | 410 |
| 181 | 3300009545 | Ga0105237_10225901 | Ga0105237_102259012 | 410 |
| 182 | 3300013105 | Ga0157369_10156566 | Ga0157369_101565662 | 410 |
| 183 | 3300025912 | Ga0207707_10031615 | Ga0207707_100316155 | 410 |
| 184 | 3300025913 | Ga0207695_10092392 | Ga0207695_100923923 | 410 |
| 185 | 3300006028 | Ga0070717_10167262 | Ga0070717_101672622 | 411 |
| 186 | 3300005445 | Ga0070708_100008351 | Ga0070708_1000083513 | 412 |
| 187 | 3300005445 | Ga0070708_100059462 | Ga0070708_1000594622 | 412 |
| 188 | 3300005467 | Ga0070706_100009023 | Ga0070706_1000090234 | 412 |
| 189 | 3300005468 | Ga0070707_100008857 | Ga0070707_1000088576 | 412 |
| 190 | 3300005471 | Ga0070698_100004977 | Ga0070698_1000049774 | 412 |
| 191 | 3300005518 | Ga0070699_100001625 | Ga0070699_1000016256 | 412 |
| 192 | 3300005518 | Ga0070699_100116350 | Ga0070699_1001163502 | 412 |
| 193 | 3300005536 | Ga0070697_100001728 | Ga0070697_10000172813 | 412 |
| 194 | 3300025910 | Ga0207684_10002114 | Ga0207684_1000211412 | 412 |
| 195 | 3300031090 | Ga0265760_10006617 | Ga0265760_100066173 | 412 |
| 196 | 3300006914 | Ga0075436_100005040 | Ga0075436_1000050406 | 413 |
| 197 | 3300009545 | Ga0105237_10115369 | Ga0105237_101153692 | 413 |
| 198 | 3300025913 | Ga0207695_10188903 | Ga0207695_101889031 | 413 |
| 199 | 3300050514 | nmdc:mga08x19_27110_c1 | nmdc:mga08x19_27110_c1_1049_2296 | 413 |
| 200 | 3300005467 | Ga0070706_100038464 | Ga0070706_1000384642 | 414 |
| 201 | 3300006028 | Ga0070717_10003852 | Ga0070717_100038522 | 414 |
| 202 | 3300025910 | Ga0207684_10063886 | Ga0207684_100638862 | 414 |
| 203 | 3300025939 | Ga0207665_10030100 | Ga0207665_100301002 | 414 |
| 204 | 3300035724 | Ga0373933_0066081 | Ga0373933_0066081_902_2167 | 414 |
| 205 | 3300014969 | Ga0157376_10006505 | Ga0157376_100065052 | 416 |
| 206 | 3300005436 | Ga0070713_100107046 | Ga0070713_1001070462 | 417 |
| 207 | 3300025915 | Ga0207693_10127739 | Ga0207693_101277391 | 417 |
| 208 | 3300025915 | Ga0207693_10166073 | Ga0207693_101660731 | 417 |
| 209 | 3300024227 | Ga0228598_1000129 | Ga0228598_10001294 | 418 |
| 210 | 3300005434 | Ga0070709_10065238 | Ga0070709_100652382 | 420 |
| 211 | 3300005439 | Ga0070711_100040073 | Ga0070711_1000400732 | 420 |
| 212 | 3300006173 | Ga0070716_100000266 | Ga0070716_10000026617 | 420 |
| 213 | 3300009098 | Ga0105245_10271389 | Ga0105245_102713892 | 420 |
| 214 | 3300013296 | Ga0157374_10052938 | Ga0157374_100529383 | 420 |
| 215 | 3300014325 | Ga0163163_10047538 | Ga0163163_100475384 | 420 |
| 216 | 3300015261 | Ga0182006_1027225 | Ga0182006_10272251 | 420 |
| 217 | 3300015262 | Ga0182007_10003686 | Ga0182007_100036865 | 420 |
| 218 | 3300025906 | Ga0207699_10069861 | Ga0207699_100698612 | 420 |
| 219 | 3300025915 | Ga0207693_10006023 | Ga0207693_1000602310 | 420 |
| 220 | 3300025939 | Ga0207665_10006136 | Ga0207665_100061362 | 420 |
| 221 | 3300026023 | Ga0207677_10015780 | Ga0207677_100157804 | 420 |
| 222 | 3300037068 | Ga0373925_0046919 | Ga0373925_0046919_989_2260 | 420 |
| 223 | 3300046472 | Ga0495580_0006771 | Ga0495580_0006771_1549_2817 | 420 |
| 224 | 3300002459 | JGI24751J29686_10001676 | JGI24751J29686_100016764 | 422 |
| 225 | 3300005290 | Ga0065712_10101789 | Ga0065712_101017892 | 422 |
| 226 | 3300005328 | Ga0070676_10018091 | Ga0070676_100180914 | 422 |
| 227 | 3300005329 | Ga0070683_100001090 | Ga0070683_10000109014 | 422 |
| 228 | 3300005331 | Ga0070670_100087776 | Ga0070670_1000877762 | 422 |
| 229 | 3300005331 | Ga0070670_100111807 | Ga0070670_1001118072 | 422 |
| 230 | 3300005338 | Ga0068868_100030130 | Ga0068868_1000301305 | 422 |
| 231 | 3300005340 | Ga0070689_100023175 | Ga0070689_1000231753 | 422 |
| 232 | 3300005344 | Ga0070661_100001447 | Ga0070661_10000144713 | 422 |
| 233 | 3300005353 | Ga0070669_100011011 | Ga0070669_1000110116 | 422 |
| 234 | 3300005354 | Ga0070675_100110660 | Ga0070675_1001106602 | 422 |
| 235 | 3300005355 | Ga0070671_100158913 | Ga0070671_1001589132 | 422 |
| 236 | 3300005364 | Ga0070673_100028152 | Ga0070673_1000281523 | 422 |
| 237 | 3300005366 | Ga0070659_100040187 | Ga0070659_1000401872 | 422 |
| 238 | 3300005438 | Ga0070701_10033951 | Ga0070701_100339511 | 422 |
| 239 | 3300005455 | Ga0070663_100085845 | Ga0070663_1000858453 | 422 |
| 240 | 3300005457 | Ga0070662_100106557 | Ga0070662_1001065572 | 422 |
| 241 | 3300005459 | Ga0068867_100024568 | Ga0068867_1000245683 | 422 |
| 242 | 3300005466 | Ga0070685_10005877 | Ga0070685_100058775 | 422 |
| 243 | 3300005530 | Ga0070679_100182281 | Ga0070679_1001822812 | 422 |
| 244 | 3300005535 | Ga0070684_100017052 | Ga0070684_1000170524 | 422 |
| 245 | 3300005539 | Ga0068853_100080308 | Ga0068853_1000803081 | 422 |
| 246 | 3300005543 | Ga0070672_100033033 | Ga0070672_1000330332 | 422 |
| 247 | 3300005544 | Ga0070686_100032576 | Ga0070686_1000325763 | 422 |
| 248 | 3300005563 | Ga0068855_100067881 | Ga0068855_1000678813 | 422 |
| 249 | 3300005577 | Ga0068857_100000303 | Ga0068857_10000030322 | 422 |
| 250 | 3300005614 | Ga0068856_100026395 | Ga0068856_1000263955 | 422 |
| 251 | 3300005617 | Ga0068859_100309071 | Ga0068859_1003090712 | 422 |
| 252 | 3300005718 | Ga0068866_10002981 | Ga0068866_100029813 | 422 |
| 253 | 3300005719 | Ga0068861_100040579 | Ga0068861_1000405793 | 422 |
| 254 | 3300005841 | Ga0068863_100160556 | Ga0068863_1001605563 | 422 |
| 255 | 3300005842 | Ga0068858_100023113 | Ga0068858_1000231133 | 422 |
| 256 | 3300006931 | Ga0097620_100309049 | Ga0097620_1003090492 | 422 |
| 257 | 3300009092 | Ga0105250_10010613 | Ga0105250_100106133 | 422 |
| 258 | 3300009098 | Ga0105245_10022181 | Ga0105245_100221816 | 422 |
| 259 | 3300009101 | Ga0105247_10010029 | Ga0105247_100100295 | 422 |
| 260 | 3300009174 | Ga0105241_10029352 | Ga0105241_100293524 | 422 |
| 261 | 3300009176 | Ga0105242_10021948 | Ga0105242_100219484 | 422 |
| 262 | 3300010375 | Ga0105239_10145568 | Ga0105239_101455681 | 422 |
| 263 | 3300013100 | Ga0157373_10060925 | Ga0157373_100609251 | 422 |
| 264 | 3300013102 | Ga0157371_10002229 | Ga0157371_100022292 | 422 |
| 265 | 3300013105 | Ga0157369_10016706 | Ga0157369_1001670610 | 422 |
| 266 | 3300013306 | Ga0163162_10074865 | Ga0163162_100748654 | 422 |
| 267 | 3300013307 | Ga0157372_10018033 | Ga0157372_100180332 | 422 |
| 268 | 3300014325 | Ga0163163_10005653 | Ga0163163_100056538 | 422 |
| 269 | 3300014326 | Ga0157380_10081636 | Ga0157380_100816362 | 422 |
| 270 | 3300014745 | Ga0157377_10005494 | Ga0157377_100054945 | 422 |
| 271 | 3300017792 | Ga0163161_10011286 | Ga0163161_100112865 | 422 |
| 272 | 3300025315 | Ga0207697_10001415 | Ga0207697_100014158 | 422 |
| 273 | 3300025900 | Ga0207710_10013168 | Ga0207710_100131684 | 422 |
| 274 | 3300025901 | Ga0207688_10012155 | Ga0207688_100121555 | 422 |
| 275 | 3300025903 | Ga0207680_10061450 | Ga0207680_100614502 | 422 |
| 276 | 3300025904 | Ga0207647_10015912 | Ga0207647_100159125 | 422 |
| 277 | 3300025907 | Ga0207645_10000073 | Ga0207645_1000007330 | 422 |
| 278 | 3300025908 | Ga0207643_10002582 | Ga0207643_100025825 | 422 |
| 279 | 3300025909 | Ga0207705_10061374 | Ga0207705_100613742 | 422 |
| 280 | 3300025919 | Ga0207657_10000379 | Ga0207657_1000037929 | 422 |
| 281 | 3300025920 | Ga0207649_10001371 | Ga0207649_1000137111 | 422 |
| 282 | 3300025925 | Ga0207650_10000045 | Ga0207650_1000004564 | 422 |
| 283 | 3300025933 | Ga0207706_10000213 | Ga0207706_1000021336 | 422 |
| 284 | 3300025936 | Ga0207670_10100065 | Ga0207670_101000652 | 422 |
| 285 | 3300025940 | Ga0207691_10000556 | Ga0207691_100005567 | 422 |
| 286 | 3300025941 | Ga0207711_10015005 | Ga0207711_100150053 | 422 |
| 287 | 3300025942 | Ga0207689_10000780 | Ga0207689_100007805 | 422 |
| 288 | 3300025944 | Ga0207661_10003233 | Ga0207661_100032334 | 422 |
| 289 | 3300025945 | Ga0207679_10000096 | Ga0207679_100000967 | 422 |
| 290 | 3300025960 | Ga0207651_10011411 | Ga0207651_100114114 | 422 |
| 291 | 3300026035 | Ga0207703_10021954 | Ga0207703_100219545 | 422 |
| 292 | 3300026041 | Ga0207639_10052581 | Ga0207639_100525814 | 422 |
| 293 | 3300026067 | Ga0207678_10000026 | Ga0207678_1000002684 | 422 |
| 294 | 3300026088 | Ga0207641_10000075 | Ga0207641_1000007564 | 422 |
| 295 | 3300026089 | Ga0207648_10000679 | Ga0207648_100006795 | 422 |
| 296 | 3300026095 | Ga0207676_10000212 | Ga0207676_1000021220 | 422 |
| 297 | 3300026116 | Ga0207674_10000670 | Ga0207674_100006704 | 422 |
| 298 | 3300026118 | Ga0207675_100033917 | Ga0207675_1000339174 | 422 |
| 299 | 3300026121 | Ga0207683_10000438 | Ga0207683_100004385 | 422 |
| 300 | 3300028379 | Ga0268266_10001444 | Ga0268266_100014442 | 422 |
| 301 | 3300028380 | Ga0268265_10008138 | Ga0268265_100081382 | 422 |
| 302 | 3300048911 | Ga0496108_0000304 | Ga0496108_0000304_26831_28099 | 422 |
| 303 | 3300048912 | Ga0496109_0000164 | Ga0496109_0000164_55828_57096 | 422 |
| 304 | 3300048913 | Ga0496110_0002655 | Ga0496110_0002655_10728_11996 | 422 |
| 305 | 3300048914 | Ga0496111_0002195 | Ga0496111_0002195_403_1671 | 422 |
| 306 | 3300048915 | Ga0496112_0000078 | Ga0496112_0000078_24752_26020 | 422 |
| 307 | 3300048916 | Ga0496113_0000617 | Ga0496113_0000617_5785_7053 | 422 |
| 308 | 3300048918 | Ga0496115_0053907 | Ga0496115_0053907_664_1932 | 422 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1itq-assembly1.cif.gz_A | human renal dipeptidase | 0.9081 | 33 | 410 |
| 3lu2-assembly1.cif.gz_A | structure of lmo2462, a listeria monocytogenes amidohydrolase family putative dipeptidase | 0.887 | 41 | 403 |
| 6vgo-assembly1.cif.gz_A | crystal structure of human dipeptidase 3 | 0.8855 | 33 | 415 |
| 5lx7-assembly1.cif.gz_A-2 | cys-gly dipeptidase glij mutant d38n | 0.8846 | 33 | 416 |
| 5lwz-assembly2.cif.gz_C | cys-gly dipeptidase glij (space group c2) | 0.8823 | 28 | 416 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_F1QFU9_23_390_3.20.20.140 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.9123 | 33 | 415 | 3.20.20.140 |
| af_E7FBC7_31_399_3.20.20.140 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.8978 | 33 | 415 | 3.20.20.140 |
| 3b40A01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.8884 | 30 | 409 | 3.20.20.140 |
| 5nruA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.881 | 33 | 416 | 3.20.20.140 |
| 3b40A01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.8735 | 30 | 409 | 3.20.20.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0C9R7I6-F1-model_v4 | Dipeptidase (EC 3.4.13.19) | 0.9679 | 84 | 173 |
GO:0006508
GO:0046872 GO:0070573 GO:0098552 |
| AF-A0A7V0XFJ2-F1-model_v4 | Membrane dipeptidase | 0.9479 | 42 | 260 |
GO:0006508
GO:0070573 |
| AF-A0A256WMH3-F1-model_v4 | Membrane dipeptidase | 0.9475 | 95 | 269 |
GO:0006508
GO:0070573 |
| AF-A0A820JQI1-F1-model_v4 | Dipeptidase (EC 3.4.13.19) | 0.9473 | 111 | 264 |
GO:0006508
GO:0046872 GO:0070573 GO:0098552 |
| AF-A0A3C1J1J8-F1-model_v4 | deleted | 0.9473 | 43 | 179 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar