F399795

General Info

Members Datasets Scaffolds Average Seq Length
308 178 308 426

Family's Representative Sequence

Representative Sequence 3300039453|Ga0436362_0372503|Ga0436362_0372503_570_1832
Length 399
Sequence MQLHRVLRVLLLATTAFGQSSQDSALVVSARALVLHRSAIVIDTHADTPQRFLDRDFDIGSADPHDQGEVSLDKARAGGLGAEFFSIWVDPATTDAVNYAKRAADLMDSVYHQAKRHPDRMMMAYSVADIERAHKEHKLAALMGIEGGHAIEDDLHLLNDFYRLGIRYMTLTWSNTNDWADSSGDADDAKVQHHGGLSDFGRQVIEEMNRLGMLVDISHVADKTFYDAVAISKAPIIASHSSARALTNAPRNMTDDMLKAMARNNGVVMVNFCSCFIDENFRKAQEAVREPMNAAIRDFITRERASGKAPQYIDSEPLEHQWLARIPHVGLGSDFDGVSGALPAGIDSAADLPKITQALIDRGYSNSDIRKILGGNLLRVMKDAELVSHELEAGQNTRK

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
84 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
139 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
141 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
142 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
143 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
144 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
145 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
146 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
147 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
148 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
149 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
151 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
152 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
153 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
157 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
158 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
163 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
164 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
165 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
175 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
176 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
177 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
178 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.35
Metatranscriptomes 0.65
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.22
Rhizosphere 95.78
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10001676 3300002459 Bacteria 4558
2 Ga0058863_11935134 3300004799 Bacteria 2392
3 Ga0065712_10101789 3300005290 Bacteria 2025
4 Ga0070676_10018091 3300005328 Bacteria 3902
5 Ga0070683_100001090 3300005329 Bacteria 20440
6 Ga0070683_100045912 3300005329 Unclassified 4033
7 Ga0070670_100087776 3300005331 Bacteria 2673
8 Ga0070670_100111807 3300005331 Bacteria 2354
9 Ga0070680_100002185 3300005336 Bacteria 14425
10 Ga0068868_100030130 3300005338 Unclassified 4160
11 Ga0070689_100023175 3300005340 Bacteria 4645
12 Ga0070691_10017504 3300005341 Bacteria 3298
13 Ga0070661_100001447 3300005344 Bacteria 16492
14 Ga0070668_100004795 3300005347 Bacteria 10024
15 Ga0070669_100011011 3300005353 Bacteria 6419
16 Ga0070675_100110660 3300005354 Bacteria 2323
17 Ga0070671_100158913 3300005355 Bacteria 1910
18 Ga0070673_100028152 3300005364 Bacteria 4175
19 Ga0070659_100040187 3300005366 Bacteria 3654
20 Ga0070659_100054016 3300005366 Bacteria 3163
21 Ga0070667_100033097 3300005367 Bacteria 4316
22 Ga0070709_10003110 3300005434 Bacteria 8906
23 Ga0070709_10065238 3300005434 Bacteria 2331
24 Ga0070709_10085129 3300005434 Unclassified 2073
25 Ga0070709_10091091 3300005434 Bacteria 2012
26 Ga0070714_100055914 3300005435 Bacteria 3374
27 Ga0070713_100000561 3300005436 Bacteria 23535
28 Ga0070713_100006965 3300005436 Bacteria 7892
29 Ga0070713_100017911 3300005436 Bacteria 5373
30 Ga0070713_100072850 3300005436 Bacteria 2906
31 Ga0070713_100078138 3300005436 Bacteria 2816
32 Ga0070713_100107046 3300005436 Bacteria 2431
33 Ga0070713_100122532 3300005436 Bacteria 2282
34 Ga0070710_10024592 3300005437 Unclassified 3179
35 Ga0070701_10033951 3300005438 Unclassified 2553
36 Ga0070711_100040073 3300005439 Bacteria 3157
37 Ga0070711_100095272 3300005439 Bacteria 2154
38 Ga0070708_100001308 3300005445 Bacteria 19092
39 Ga0070708_100005753 3300005445 Bacteria 9836
40 Ga0070708_100008028 3300005445 Bacteria 8456
41 Ga0070708_100008351 3300005445 Bacteria 8316
42 Ga0070708_100059462 3300005445 Bacteria 3407
43 Ga0070708_100108291 3300005445 Bacteria 2552
44 Ga0070663_100018760 3300005455 Bacteria 4543
45 Ga0070663_100085845 3300005455 Bacteria 2323
46 Ga0070662_100008569 3300005457 Bacteria 6669
47 Ga0070662_100106557 3300005457 Bacteria 2129
48 Ga0070681_10000179 3300005458 Bacteria 48474
49 Ga0070681_10031022 3300005458 Bacteria 5365
50 Ga0070681_10133408 3300005458 Bacteria 2415
51 Ga0068867_100024568 3300005459 Bacteria 4318
52 Ga0070685_10005877 3300005466 Bacteria 6243
53 Ga0070706_100001063 3300005467 Bacteria 29766
54 Ga0070706_100009023 3300005467 Bacteria 9285
55 Ga0070706_100038464 3300005467 Bacteria 4415
56 Ga0070706_100044382 3300005467 Bacteria 4107
57 Ga0070707_100008857 3300005468 Bacteria 9329
58 Ga0070698_100004977 3300005471 Bacteria 14557
59 Ga0070698_100019296 3300005471 Bacteria 7161
60 Ga0070699_100001625 3300005518 Bacteria 20496
61 Ga0070699_100116350 3300005518 Unclassified 2350
62 Ga0070679_100000089 3300005530 Bacteria 69218
63 Ga0070679_100026145 3300005530 Bacteria 5730
64 Ga0070679_100182281 3300005530 Bacteria 2072
65 Ga0070684_100017052 3300005535 Bacteria 5953
66 Ga0070697_100000374 3300005536 Bacteria 34993
67 Ga0070697_100001728 3300005536 Bacteria 16681
68 Ga0070697_100025693 3300005536 Bacteria 4698
69 Ga0070697_100073817 3300005536 Bacteria 2801
70 Ga0068853_100009297 3300005539 Bacteria 7928
71 Ga0068853_100064268 3300005539 Bacteria 3181
72 Ga0068853_100080308 3300005539 Unclassified 2853
73 Ga0070672_100033033 3300005543 Bacteria 3914
74 Ga0070686_100014356 3300005544 Bacteria 4566
75 Ga0070686_100032576 3300005544 Bacteria 3196
76 Ga0070665_100075713 3300005548 Bacteria 3373
77 Ga0068855_100067881 3300005563 Bacteria 4152
78 Ga0068857_100000303 3300005577 Bacteria 34068
79 Ga0068854_100003332 3300005578 Bacteria 10010
80 Ga0068856_100000240 3300005614 Bacteria 59772
81 Ga0068856_100026395 3300005614 Bacteria 5664
82 Ga0068856_100098457 3300005614 Bacteria 2914
83 Ga0068852_100074161 3300005616 Bacteria 2996
84 Ga0068859_100019699 3300005617 Bacteria 6776
85 Ga0068859_100309071 3300005617 Bacteria 1674
86 Ga0068866_10002981 3300005718 Bacteria 6982
87 Ga0068861_100040579 3300005719 Bacteria 3482
88 Ga0068851_10062307 3300005834 Bacteria 1913
89 Ga0068863_100160556 3300005841 Bacteria 2153
90 Ga0068858_100023113 3300005842 Bacteria 5798
91 Ga0070717_10003392 3300006028 Bacteria 11393
92 Ga0070717_10003852 3300006028 Bacteria 10790
93 Ga0070717_10034560 3300006028 Bacteria 4087
94 Ga0070717_10045514 3300006028 Unclassified 3588
95 Ga0070717_10167262 3300006028 Unclassified 1911
96 Ga0070716_100000266 3300006173 Bacteria 21014
97 Ga0070716_100001403 3300006173 Bacteria 10679
98 Ga0070716_100099539 3300006173 Bacteria 1779
99 Ga0070712_100002903 3300006175 Bacteria 10625
100 Ga0070712_100005277 3300006175 Bacteria 7994
101 Ga0068871_100029562 3300006358 Bacteria 4305
102 Ga0075433_10030955 3300006852 Bacteria 4570
103 Ga0075434_100003665 3300006871 Bacteria 13726
104 Ga0075436_100003655 3300006914 Bacteria 10533
105 Ga0075436_100005040 3300006914 Bacteria 9083
106 Ga0097620_100019698 3300006931 Bacteria 6776
107 Ga0097620_100309049 3300006931 Bacteria 1674
108 Ga0075435_100018124 3300007076 Bacteria 5343
109 Ga0105250_10010613 3300009092 Bacteria 3837
110 Ga0105240_10019287 3300009093 Bacteria 9115
111 Ga0105240_10298665 3300009093 Bacteria 1843
112 Ga0105245_10000539 3300009098 Bacteria 34684
113 Ga0105245_10022181 3300009098 Bacteria 5575
114 Ga0105245_10271389 3300009098 Bacteria 1655
115 Ga0105247_10010029 3300009101 Bacteria 5736
116 Ga0105243_10090406 3300009148 Bacteria 2519
117 Ga0105243_10309185 3300009148 Bacteria 1435
118 Ga0105241_10023553 3300009174 Bacteria 4566
119 Ga0105241_10029352 3300009174 Bacteria 4103
120 Ga0105241_10057553 3300009174 Bacteria 2983
121 Ga0105242_10017393 3300009176 Bacteria 5603
122 Ga0105242_10021738 3300009176 Bacteria 5041
123 Ga0105242_10021948 3300009176 Bacteria 5017
124 Ga0105237_10115369 3300009545 Bacteria 2679
125 Ga0105237_10225901 3300009545 Bacteria 1872
126 Ga0105238_10092297 3300009551 Unclassified 3016
127 Ga0105239_10145568 3300010375 Bacteria 2642
128 Ga0105246_10017179 3300011119 Bacteria 4596
129 Ga0157373_10060925 3300013100 Bacteria 2673
130 Ga0157371_10002229 3300013102 Bacteria 18748
131 Ga0157369_10016706 3300013105 Bacteria 8249
132 Ga0157369_10033834 3300013105 Bacteria 5613
133 Ga0157369_10077941 3300013105 Bacteria 3551
134 Ga0157369_10133478 3300013105 Bacteria 2630
135 Ga0157369_10156566 3300013105 Unclassified 2406
136 Ga0157374_10052938 3300013296 Bacteria 3782
137 Ga0163162_10074865 3300013306 Bacteria 3445
138 Ga0157372_10018033 3300013307 Bacteria 7588
139 Ga0163163_10005653 3300014325 Bacteria 10841
140 Ga0163163_10047538 3300014325 Bacteria 4218
141 Ga0157380_10081636 3300014326 Bacteria 2645
142 Ga0157377_10005494 3300014745 Bacteria 5962
143 Ga0157376_10006505 3300014969 Bacteria 8260
144 Ga0182006_1027225 3300015261 Bacteria 2334
145 Ga0182007_10003686 3300015262 Bacteria 7170
146 Ga0163161_10011286 3300017792 Bacteria 6191
147 Ga0228598_1000129 3300024227 Bacteria 12851
148 Ga0207697_10001415 3300025315 Bacteria 13133
149 Ga0207656_10026391 3300025321 Bacteria 2368
150 Ga0207710_10013168 3300025900 Unclassified 3485
151 Ga0207688_10012155 3300025901 Bacteria 4684
152 Ga0207680_10061450 3300025903 Bacteria 2291
153 Ga0207647_10015912 3300025904 Bacteria 5147
154 Ga0207699_10005666 3300025906 Bacteria 5998
155 Ga0207699_10010275 3300025906 Bacteria 4690
156 Ga0207699_10024676 3300025906 Bacteria 3290
157 Ga0207699_10069861 3300025906 Bacteria 2143
158 Ga0207645_10000073 3300025907 Bacteria 71786
159 Ga0207643_10002582 3300025908 Bacteria 9795
160 Ga0207705_10061374 3300025909 Bacteria 2716
161 Ga0207684_10001271 3300025910 Bacteria 27841
162 Ga0207684_10002114 3300025910 Bacteria 20371
163 Ga0207684_10063886 3300025910 Bacteria 3125
164 Ga0207654_10005326 3300025911 Bacteria 6498
165 Ga0207707_10001177 3300025912 Bacteria 24644
166 Ga0207707_10031615 3300025912 Bacteria 4632
167 Ga0207707_10044133 3300025912 Bacteria 3888
168 Ga0207695_10010685 3300025913 Bacteria 11213
169 Ga0207695_10092392 3300025913 Bacteria 3037
170 Ga0207695_10128352 3300025913 Bacteria 2495
171 Ga0207695_10188903 3300025913 Bacteria 1978
172 Ga0207693_10001860 3300025915 Bacteria 18476
173 Ga0207693_10006023 3300025915 Bacteria 10053
174 Ga0207693_10014695 3300025915 Bacteria 6290
175 Ga0207693_10127739 3300025915 Bacteria 1998
176 Ga0207693_10166073 3300025915 Bacteria 1737
177 Ga0207660_10000064 3300025917 Bacteria 55686
178 Ga0207657_10000379 3300025919 Bacteria 47118
179 Ga0207657_10001005 3300025919 Bacteria 30014
180 Ga0207649_10001371 3300025920 Bacteria 14450
181 Ga0207652_10042654 3300025921 Bacteria 3862
182 Ga0207652_10118874 3300025921 Bacteria 2350
183 Ga0207650_10000045 3300025925 Bacteria 181507
184 Ga0207687_10016308 3300025927 Bacteria 4878
185 Ga0207700_10000650 3300025928 Bacteria 20313
186 Ga0207700_10017040 3300025928 Bacteria 4841
187 Ga0207700_10023275 3300025928 Bacteria 4267
188 Ga0207700_10121936 3300025928 Bacteria 2115
189 Ga0207700_10212522 3300025928 Bacteria 1636
190 Ga0207664_10017230 3300025929 Bacteria 5290
191 Ga0207706_10000213 3300025933 Bacteria 63821
192 Ga0207706_10001614 3300025933 Bacteria 22381
193 Ga0207686_10093925 3300025934 Bacteria 1987
194 Ga0207686_10183837 3300025934 Bacteria 1484
195 Ga0207670_10100065 3300025936 Bacteria 2069
196 Ga0207665_10003206 3300025939 Bacteria 10965
197 Ga0207665_10006136 3300025939 Bacteria 7979
198 Ga0207665_10017602 3300025939 Bacteria 4696
199 Ga0207665_10029215 3300025939 Bacteria 3645
200 Ga0207665_10030100 3300025939 Bacteria 3588
201 Ga0207691_10000556 3300025940 Bacteria 37289
202 Ga0207711_10000749 3300025941 Bacteria 31810
203 Ga0207711_10015005 3300025941 Bacteria 6435
204 Ga0207689_10000780 3300025942 Bacteria 30597
205 Ga0207689_10048460 3300025942 Bacteria 3504
206 Ga0207661_10003233 3300025944 Bacteria 11292
207 Ga0207661_10007216 3300025944 Bacteria 7898
208 Ga0207679_10000096 3300025945 Bacteria 76971
209 Ga0207679_10196845 3300025945 Unclassified 1680
210 Ga0207667_10005088 3300025949 Bacteria 16059
211 Ga0207667_10005625 3300025949 Bacteria 15289
212 Ga0207651_10011411 3300025960 Bacteria 4975
213 Ga0207712_10073676 3300025961 Bacteria 2464
214 Ga0207668_10005927 3300025972 Bacteria 7200
215 Ga0207677_10015780 3300026023 Bacteria 4455
216 Ga0207703_10021954 3300026035 Bacteria 4999
217 Ga0207703_10034960 3300026035 Bacteria 3991
218 Ga0207639_10052581 3300026041 Bacteria 3104
219 Ga0207678_10000026 3300026067 Bacteria 116850
220 Ga0207678_10000103 3300026067 Bacteria 69649
221 Ga0207702_10000711 3300026078 Bacteria 35806
222 Ga0207641_10000075 3300026088 Bacteria 145149
223 Ga0207648_10000679 3300026089 Bacteria 38160
224 Ga0207648_10136441 3300026089 Bacteria 2161
225 Ga0207676_10000212 3300026095 Bacteria 50034
226 Ga0207676_10221308 3300026095 Bacteria 1686
227 Ga0207674_10000670 3300026116 Bacteria 44517
228 Ga0207674_10250859 3300026116 Bacteria 1717
229 Ga0207675_100033917 3300026118 Bacteria 4757
230 Ga0207683_10000438 3300026121 Bacteria 38515
231 Ga0207683_10009712 3300026121 Bacteria 8207
232 Ga0207698_10147754 3300026142 Bacteria 2035
233 Ga0268266_10001444 3300028379 Bacteria 28286
234 Ga0268266_10049093 3300028379 Bacteria 3618
235 Ga0268265_10008138 3300028380 Bacteria 7086
236 Ga0268264_10113497 3300028381 Bacteria 2377
237 Ga0265338_10003670 3300028800 Bacteria 21390
238 Ga0265338_10081539 3300028800 Bacteria 2712
239 Ga0265760_10006617 3300031090 Bacteria 3316
240 Ga0265339_10006686 3300031249 Bacteria 7537
241 Ga0265339_10024708 3300031249 Bacteria 3458
242 Ga0265316_10004401 3300031344 Bacteria 14029
243 Ga0265316_10012508 3300031344 Bacteria 7606
244 Ga0265316_10023588 3300031344 Bacteria 5167
245 Ga0265314_10007310 3300031711 Bacteria 9593
246 Ga0265314_10019093 3300031711 Bacteria 5319
247 Ga0265314_10040685 3300031711 Bacteria 3334
248 Ga0373926_0028800 3300035083 Bacteria 1950
249 Ga0373936_0002065 3300035113 Bacteria 7450
250 Ga0373945_0001146 3300035116 Bacteria 8030
251 Ga0373945_0015017 3300035116 Bacteria 2601
252 Ga0373943_0000002 3300035170 Bacteria 106064
253 Ga0373943_0017239 3300035170 Bacteria 3303
254 Ga0373955_0008819 3300035172 Bacteria 4700
255 Ga0373924_0000072 3300035410 Bacteria 27145
256 Ga0373924_0052237 3300035410 Bacteria 1696
257 Ga0373935_0009140 3300035692 Bacteria 5931
258 Ga0373935_0045317 3300035692 Bacteria 2775
259 Ga0373935_0139527 3300035692 Unclassified 1636
260 Ga0373927_0000021 3300035695 Bacteria 124647
261 Ga0373927_0006499 3300035695 Bacteria 7963
262 Ga0373933_0028548 3300035724 Bacteria 3220
263 Ga0373933_0061565 3300035724 Bacteria 2265
264 Ga0373933_0066081 3300035724 Unclassified 2191
265 Ga0373933_0069417 3300035724 Bacteria 2142
266 Ga0373947_0000800 3300035725 Bacteria 18959
267 Ga0373947_0097388 3300035725 Unclassified 1843
268 Ga0373937_0000139 3300036401 Bacteria 70018
269 Ga0373937_0168569 3300036401 Bacteria 2054
270 Ga0373925_0000829 3300037068 Bacteria 28513
271 Ga0373925_0010372 3300037068 Bacteria 6760
272 Ga0373925_0046919 3300037068 Bacteria 3214
273 Ga0373925_0113975 3300037068 Bacteria 2091
274 Ga0373925_0142717 3300037068 Bacteria 1875
275 Ga0395898_0053749 3300037466 Bacteria 3933
276 Ga0436362_0372503 3300039453 Bacteria 10579
277 Ga0466963_0004580 3300044694 Bacteria 8047
278 Ga0466959_0060725 3300045049 Unclassified 2750
279 Ga0466967_0002538 3300045976 Bacteria 11430
280 Ga0466967_0019543 3300045976 Bacteria 5450
281 Ga0495653_0137129 3300046463 Bacteria 1725
282 Ga0495580_0002155 3300046472 Bacteria 17299
283 Ga0495580_0006771 3300046472 Bacteria 9291
284 Ga0495580_0007871 3300046472 Bacteria 8527
285 Ga0495580_0036249 3300046472 Bacteria 3542
286 Ga0495580_0061664 3300046472 Bacteria 2632
287 Ga0495664_0041163 3300046477 Unclassified 2733
288 Ga0495635_0034056 3300046663 Unclassified 3534
289 Ga0495599_0059461 3300046678 Unclassified 2391
290 Ga0495674_0133464 3300047319 Unclassified 2090
291 Ga0496105_0006729 3300048908 Bacteria 8838
292 Ga0496108_0000304 3300048911 Bacteria 42250
293 Ga0496109_0000164 3300048912 Bacteria 65491
294 Ga0496110_0002655 3300048913 Bacteria 13491
295 Ga0496110_0245476 3300048913 Bacteria 1630
296 Ga0496111_0002195 3300048914 Bacteria 11701
297 Ga0496111_0009537 3300048914 Bacteria 6487
298 Ga0496112_0000078 3300048915 Bacteria 64712
299 Ga0496112_0009798 3300048915 Bacteria 8653
300 Ga0496112_0061875 3300048915 Bacteria 3691
301 Ga0496113_0000536 3300048916 Bacteria 18720
302 Ga0496113_0000617 3300048916 Bacteria 17839
303 Ga0496115_0053907 3300048918 Unclassified 3229
304 nmdc:mga0rr50_7939_c1 3300050513 Bacteria 6584
305 nmdc:mga08x19_27110_c1 3300050514 Bacteria 3582
306 nmdc:mga0a205_35472_c1 3300050515 Bacteria 4790
307 Ga0495601_0009440 3300053077 Bacteria 5770
308 Ga0495612_0026712 3300053078 Unclassified 2320

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025906 Ga0207699_10010275 Ga0207699_100102756 368
2 3300005467 Ga0070706_100044382 Ga0070706_1000443825 378
3 3300005471 Ga0070698_100019296 Ga0070698_1000192962 378
4 3300028800 Ga0265338_10003670 Ga0265338_100036708 378
5 3300026035 Ga0207703_10034960 Ga0207703_100349602 389
6 3300046472 Ga0495580_0036249 Ga0495580_0036249_1384_2583 389
7 3300025928 Ga0207700_10000650 Ga0207700_1000065021 390
8 3300005436 Ga0070713_100078138 Ga0070713_1000781383 393
9 3300005439 Ga0070711_100095272 Ga0070711_1000952721 393
10 3300025915 Ga0207693_10014695 Ga0207693_100146952 393
11 3300031249 Ga0265339_10024708 Ga0265339_100247083 393
12 3300031711 Ga0265314_10019093 Ga0265314_100190936 394
13 3300005341 Ga0070691_10017504 Ga0070691_100175042 395
14 3300005347 Ga0070668_100004795 Ga0070668_1000047956 395
15 3300005366 Ga0070659_100054016 Ga0070659_1000540162 395
16 3300005455 Ga0070663_100018760 Ga0070663_1000187606 395
17 3300005458 Ga0070681_10031022 Ga0070681_100310222 395
18 3300005539 Ga0068853_100064268 Ga0068853_1000642682 395
19 3300005548 Ga0070665_100075713 Ga0070665_1000757133 395
20 3300005578 Ga0068854_100003332 Ga0068854_1000033327 395
21 3300005616 Ga0068852_100074161 Ga0068852_1000741612 395
22 3300005617 Ga0068859_100019699 Ga0068859_1000196993 395
23 3300005834 Ga0068851_10062307 Ga0068851_100623072 395
24 3300006175 Ga0070712_100005277 Ga0070712_1000052778 395
25 3300006931 Ga0097620_100019698 Ga0097620_1000196983 395
26 3300009148 Ga0105243_10090406 Ga0105243_100904062 395
27 3300009174 Ga0105241_10023553 Ga0105241_100235531 395
28 3300009176 Ga0105242_10017393 Ga0105242_100173937 395
29 3300025321 Ga0207656_10026391 Ga0207656_100263912 395
30 3300025911 Ga0207654_10005326 Ga0207654_100053264 395
31 3300025928 Ga0207700_10121936 Ga0207700_101219362 395
32 3300025934 Ga0207686_10093925 Ga0207686_100939252 395
33 3300025939 Ga0207665_10017602 Ga0207665_100176021 395
34 3300025941 Ga0207711_10000749 Ga0207711_1000074911 395
35 3300025942 Ga0207689_10048460 Ga0207689_100484602 395
36 3300025949 Ga0207667_10005625 Ga0207667_100056252 395
37 3300025972 Ga0207668_10005927 Ga0207668_100059279 395
38 3300026067 Ga0207678_10000103 Ga0207678_1000010340 395
39 3300026089 Ga0207648_10136441 Ga0207648_101364411 395
40 3300026095 Ga0207676_10221308 Ga0207676_102213082 395
41 3300028379 Ga0268266_10049093 Ga0268266_100490935 395
42 3300028381 Ga0268264_10113497 Ga0268264_101134972 395
43 3300039453 Ga0436362_0372503 Ga0436362_0372503_570_1832 395
44 3300046472 Ga0495580_0007871 Ga0495580_0007871_1540_2793 395
45 3300005614 Ga0068856_100000240 Ga0068856_10000024041 396
46 3300006173 Ga0070716_100099539 Ga0070716_1000995393 396
47 3300026078 Ga0207702_10000711 Ga0207702_1000071121 396
48 3300031344 Ga0265316_10004401 Ga0265316_100044014 396
49 3300031711 Ga0265314_10007310 Ga0265314_100073104 396
50 3300035724 Ga0373933_0028548 Ga0373933_0028548_1275_2543 396
51 3300036401 Ga0373937_0168569 Ga0373937_0168569_445_1713 396
52 3300005436 Ga0070713_100017911 Ga0070713_1000179112 397
53 3300005445 Ga0070708_100005753 Ga0070708_1000057532 397
54 3300005445 Ga0070708_100108291 Ga0070708_1001082911 397
55 3300005536 Ga0070697_100073817 Ga0070697_1000738172 397
56 3300006028 Ga0070717_10003392 Ga0070717_1000339212 397
57 3300025961 Ga0207712_10073676 Ga0207712_100736762 397
58 3300028800 Ga0265338_10081539 Ga0265338_100815392 397
59 3300031249 Ga0265339_10006686 Ga0265339_100066864 397
60 3300031344 Ga0265316_10012508 Ga0265316_100125082 397
61 3300031344 Ga0265316_10023588 Ga0265316_100235885 397
62 3300031711 Ga0265314_10040685 Ga0265314_100406853 397
63 3300005434 Ga0070709_10003110 Ga0070709_100031105 399
64 3300005436 Ga0070713_100000561 Ga0070713_10000056116 399
65 3300006173 Ga0070716_100001403 Ga0070716_1000014035 399
66 3300006175 Ga0070712_100002903 Ga0070712_1000029035 399
67 3300025906 Ga0207699_10005666 Ga0207699_100056665 399
68 3300048913 Ga0496110_0245476 Ga0496110_0245476_352_1584 399
69 3300048915 Ga0496112_0009798 Ga0496112_0009798_6780_8012 399
70 3300005367 Ga0070667_100033097 Ga0070667_1000330975 400
71 3300005457 Ga0070662_100008569 Ga0070662_1000085697 400
72 3300005458 Ga0070681_10133408 Ga0070681_101334081 400
73 3300005544 Ga0070686_100014356 Ga0070686_1000143561 400
74 3300006028 Ga0070717_10045514 Ga0070717_100455145 400
75 3300006358 Ga0068871_100029562 Ga0068871_1000295624 400
76 3300009093 Ga0105240_10298665 Ga0105240_102986652 400
77 3300009148 Ga0105243_10309185 Ga0105243_103091851 400
78 3300009174 Ga0105241_10057553 Ga0105241_100575531 400
79 3300009176 Ga0105242_10021738 Ga0105242_100217387 400
80 3300011119 Ga0105246_10017179 Ga0105246_100171792 400
81 3300013105 Ga0157369_10077941 Ga0157369_100779415 400
82 3300025912 Ga0207707_10044133 Ga0207707_100441332 400
83 3300025913 Ga0207695_10010685 Ga0207695_100106852 400
84 3300025919 Ga0207657_10001005 Ga0207657_100010056 400
85 3300025933 Ga0207706_10001614 Ga0207706_100016149 400
86 3300025934 Ga0207686_10183837 Ga0207686_101838371 400
87 3300025939 Ga0207665_10029215 Ga0207665_100292152 400
88 3300025945 Ga0207679_10196845 Ga0207679_101968452 400
89 3300026121 Ga0207683_10009712 Ga0207683_100097127 400
90 3300048915 Ga0496112_0061875 Ga0496112_0061875_1702_2949 400
91 3300004799 Ga0058863_11935134 Ga0058863_119351342 401
92 3300005336 Ga0070680_100002185 Ga0070680_1000021852 401
93 3300005458 Ga0070681_10000179 Ga0070681_1000017937 401
94 3300005530 Ga0070679_100000089 Ga0070679_10000008960 401
95 3300025912 Ga0207707_10001177 Ga0207707_1000117730 401
96 3300025915 Ga0207693_10001860 Ga0207693_100018602 401
97 3300025917 Ga0207660_10000064 Ga0207660_1000006442 401
98 3300025921 Ga0207652_10042654 Ga0207652_100426544 401
99 3300046472 Ga0495580_0002155 Ga0495580_0002155_917_2167 401
100 3300005445 Ga0070708_100008028 Ga0070708_1000080283 402
101 3300005445 Ga0070708_100001308 Ga0070708_1000013089 403
102 3300005467 Ga0070706_100001063 Ga0070706_10000106318 403
103 3300005536 Ga0070697_100000374 Ga0070697_10000037419 403
104 3300006852 Ga0075433_10030955 Ga0075433_100309553 403
105 3300006871 Ga0075434_100003665 Ga0075434_10000366511 403
106 3300006914 Ga0075436_100003655 Ga0075436_1000036555 403
107 3300007076 Ga0075435_100018124 Ga0075435_1000181244 403
108 3300025910 Ga0207684_10001271 Ga0207684_1000127121 403
109 3300048914 Ga0496111_0009537 Ga0496111_0009537_2101_3570 403
110 3300050513 nmdc:mga0rr50_7939_c1 nmdc:mga0rr50_7939_c1_3017_4255 403
111 3300050515 nmdc:mga0a205_35472_c1 nmdc:mga0a205_35472_c1_1553_2791 403
112 3300037466 Ga0395898_0053749 Ga0395898_0053749_1235_2710 405
113 3300013105 Ga0157369_10133478 Ga0157369_101334783 406
114 3300025913 Ga0207695_10128352 Ga0207695_101283522 406
115 3300025949 Ga0207667_10005088 Ga0207667_1000508811 406
116 3300035116 Ga0373945_0015017 Ga0373945_0015017_66_1541 406
117 3300035172 Ga0373955_0008819 Ga0373955_0008819_720_2177 406
118 3300035410 Ga0373924_0000072 Ga0373924_0000072_7898_9373 406
119 3300035692 Ga0373935_0045317 Ga0373935_0045317_234_1691 406
120 3300035724 Ga0373933_0069417 Ga0373933_0069417_204_1661 406
121 3300036401 Ga0373937_0000139 Ga0373937_0000139_45303_46775 406
122 3300045049 Ga0466959_0060725 Ga0466959_0060725_1202_2650 406
123 3300035083 Ga0373926_0028800 Ga0373926_0028800_59_1534 407
124 3300035170 Ga0373943_0017239 Ga0373943_0017239_44_1519 407
125 3300035692 Ga0373935_0139527 Ga0373935_0139527_111_1586 407
126 3300035695 Ga0373927_0006499 Ga0373927_0006499_43_1518 407
127 3300035724 Ga0373933_0061565 Ga0373933_0061565_601_2076 407
128 3300035725 Ga0373947_0097388 Ga0373947_0097388_296_1771 407
129 3300037068 Ga0373925_0010372 Ga0373925_0010372_1963_3438 407
130 3300037068 Ga0373925_0113975 Ga0373925_0113975_523_1998 407
131 3300037068 Ga0373925_0142717 Ga0373925_0142717_23_1498 407
132 3300045976 Ga0466967_0019543 Ga0466967_0019543_1080_2567 407
133 3300046463 Ga0495653_0137129 Ga0495653_0137129_170_1645 407
134 3300046472 Ga0495580_0061664 Ga0495580_0061664_579_2054 407
135 3300046663 Ga0495635_0034056 Ga0495635_0034056_1534_3009 407
136 3300048916 Ga0496113_0000536 Ga0496113_0000536_16134_17609 407
137 3300005329 Ga0070683_100045912 Ga0070683_1000459123 408
138 3300005434 Ga0070709_10085129 Ga0070709_100851292 408
139 3300005434 Ga0070709_10091091 Ga0070709_100910912 408
140 3300005435 Ga0070714_100055914 Ga0070714_1000559142 408
141 3300005436 Ga0070713_100006965 Ga0070713_1000069654 408
142 3300005436 Ga0070713_100072850 Ga0070713_1000728502 408
143 3300005436 Ga0070713_100122532 Ga0070713_1001225322 408
144 3300005437 Ga0070710_10024592 Ga0070710_100245923 408
145 3300005530 Ga0070679_100026145 Ga0070679_1000261455 408
146 3300005539 Ga0068853_100009297 Ga0068853_1000092977 408
147 3300005614 Ga0068856_100098457 Ga0068856_1000984573 408
148 3300006028 Ga0070717_10034560 Ga0070717_100345604 408
149 3300009098 Ga0105245_10000539 Ga0105245_1000053927 408
150 3300009551 Ga0105238_10092297 Ga0105238_100922972 408
151 3300013105 Ga0157369_10033834 Ga0157369_100338346 408
152 3300025906 Ga0207699_10024676 Ga0207699_100246762 408
153 3300025921 Ga0207652_10118874 Ga0207652_101188742 408
154 3300025927 Ga0207687_10016308 Ga0207687_100163085 408
155 3300025928 Ga0207700_10017040 Ga0207700_100170405 408
156 3300025928 Ga0207700_10023275 Ga0207700_100232755 408
157 3300025928 Ga0207700_10212522 Ga0207700_102125221 408
158 3300025929 Ga0207664_10017230 Ga0207664_100172304 408
159 3300025939 Ga0207665_10003206 Ga0207665_100032066 408
160 3300025944 Ga0207661_10007216 Ga0207661_100072162 408
161 3300026116 Ga0207674_10250859 Ga0207674_102508592 408
162 3300026142 Ga0207698_10147754 Ga0207698_101477542 408
163 3300035410 Ga0373924_0052237 Ga0373924_0052237_119_1594 408
164 3300044694 Ga0466963_0004580 Ga0466963_0004580_6062_7540 408
165 3300045976 Ga0466967_0002538 Ga0466967_0002538_3526_5004 408
166 3300046678 Ga0495599_0059461 Ga0495599_0059461_902_2374 408
167 3300048908 Ga0496105_0006729 Ga0496105_0006729_797_2269 408
168 3300053077 Ga0495601_0009440 Ga0495601_0009440_2751_4217 408
169 3300035113 Ga0373936_0002065 Ga0373936_0002065_1451_2725 409
170 3300035116 Ga0373945_0001146 Ga0373945_0001146_6447_7721 409
171 3300035170 Ga0373943_0000002 Ga0373943_0000002_11364_12638 409
172 3300035692 Ga0373935_0009140 Ga0373935_0009140_3634_4908 409
173 3300035695 Ga0373927_0000021 Ga0373927_0000021_12533_13807 409
174 3300035725 Ga0373947_0000800 Ga0373947_0000800_15478_16752 409
175 3300037068 Ga0373925_0000829 Ga0373925_0000829_18601_19875 409
176 3300046477 Ga0495664_0041163 Ga0495664_0041163_1348_2622 409
177 3300047319 Ga0495674_0133464 Ga0495674_0133464_668_1942 409
178 3300053078 Ga0495612_0026712 Ga0495612_0026712_383_1657 409
179 3300005536 Ga0070697_100025693 Ga0070697_1000256933 410
180 3300009093 Ga0105240_10019287 Ga0105240_100192873 410
181 3300009545 Ga0105237_10225901 Ga0105237_102259012 410
182 3300013105 Ga0157369_10156566 Ga0157369_101565662 410
183 3300025912 Ga0207707_10031615 Ga0207707_100316155 410
184 3300025913 Ga0207695_10092392 Ga0207695_100923923 410
185 3300006028 Ga0070717_10167262 Ga0070717_101672622 411
186 3300005445 Ga0070708_100008351 Ga0070708_1000083513 412
187 3300005445 Ga0070708_100059462 Ga0070708_1000594622 412
188 3300005467 Ga0070706_100009023 Ga0070706_1000090234 412
189 3300005468 Ga0070707_100008857 Ga0070707_1000088576 412
190 3300005471 Ga0070698_100004977 Ga0070698_1000049774 412
191 3300005518 Ga0070699_100001625 Ga0070699_1000016256 412
192 3300005518 Ga0070699_100116350 Ga0070699_1001163502 412
193 3300005536 Ga0070697_100001728 Ga0070697_10000172813 412
194 3300025910 Ga0207684_10002114 Ga0207684_1000211412 412
195 3300031090 Ga0265760_10006617 Ga0265760_100066173 412
196 3300006914 Ga0075436_100005040 Ga0075436_1000050406 413
197 3300009545 Ga0105237_10115369 Ga0105237_101153692 413
198 3300025913 Ga0207695_10188903 Ga0207695_101889031 413
199 3300050514 nmdc:mga08x19_27110_c1 nmdc:mga08x19_27110_c1_1049_2296 413
200 3300005467 Ga0070706_100038464 Ga0070706_1000384642 414
201 3300006028 Ga0070717_10003852 Ga0070717_100038522 414
202 3300025910 Ga0207684_10063886 Ga0207684_100638862 414
203 3300025939 Ga0207665_10030100 Ga0207665_100301002 414
204 3300035724 Ga0373933_0066081 Ga0373933_0066081_902_2167 414
205 3300014969 Ga0157376_10006505 Ga0157376_100065052 416
206 3300005436 Ga0070713_100107046 Ga0070713_1001070462 417
207 3300025915 Ga0207693_10127739 Ga0207693_101277391 417
208 3300025915 Ga0207693_10166073 Ga0207693_101660731 417
209 3300024227 Ga0228598_1000129 Ga0228598_10001294 418
210 3300005434 Ga0070709_10065238 Ga0070709_100652382 420
211 3300005439 Ga0070711_100040073 Ga0070711_1000400732 420
212 3300006173 Ga0070716_100000266 Ga0070716_10000026617 420
213 3300009098 Ga0105245_10271389 Ga0105245_102713892 420
214 3300013296 Ga0157374_10052938 Ga0157374_100529383 420
215 3300014325 Ga0163163_10047538 Ga0163163_100475384 420
216 3300015261 Ga0182006_1027225 Ga0182006_10272251 420
217 3300015262 Ga0182007_10003686 Ga0182007_100036865 420
218 3300025906 Ga0207699_10069861 Ga0207699_100698612 420
219 3300025915 Ga0207693_10006023 Ga0207693_1000602310 420
220 3300025939 Ga0207665_10006136 Ga0207665_100061362 420
221 3300026023 Ga0207677_10015780 Ga0207677_100157804 420
222 3300037068 Ga0373925_0046919 Ga0373925_0046919_989_2260 420
223 3300046472 Ga0495580_0006771 Ga0495580_0006771_1549_2817 420
224 3300002459 JGI24751J29686_10001676 JGI24751J29686_100016764 422
225 3300005290 Ga0065712_10101789 Ga0065712_101017892 422
226 3300005328 Ga0070676_10018091 Ga0070676_100180914 422
227 3300005329 Ga0070683_100001090 Ga0070683_10000109014 422
228 3300005331 Ga0070670_100087776 Ga0070670_1000877762 422
229 3300005331 Ga0070670_100111807 Ga0070670_1001118072 422
230 3300005338 Ga0068868_100030130 Ga0068868_1000301305 422
231 3300005340 Ga0070689_100023175 Ga0070689_1000231753 422
232 3300005344 Ga0070661_100001447 Ga0070661_10000144713 422
233 3300005353 Ga0070669_100011011 Ga0070669_1000110116 422
234 3300005354 Ga0070675_100110660 Ga0070675_1001106602 422
235 3300005355 Ga0070671_100158913 Ga0070671_1001589132 422
236 3300005364 Ga0070673_100028152 Ga0070673_1000281523 422
237 3300005366 Ga0070659_100040187 Ga0070659_1000401872 422
238 3300005438 Ga0070701_10033951 Ga0070701_100339511 422
239 3300005455 Ga0070663_100085845 Ga0070663_1000858453 422
240 3300005457 Ga0070662_100106557 Ga0070662_1001065572 422
241 3300005459 Ga0068867_100024568 Ga0068867_1000245683 422
242 3300005466 Ga0070685_10005877 Ga0070685_100058775 422
243 3300005530 Ga0070679_100182281 Ga0070679_1001822812 422
244 3300005535 Ga0070684_100017052 Ga0070684_1000170524 422
245 3300005539 Ga0068853_100080308 Ga0068853_1000803081 422
246 3300005543 Ga0070672_100033033 Ga0070672_1000330332 422
247 3300005544 Ga0070686_100032576 Ga0070686_1000325763 422
248 3300005563 Ga0068855_100067881 Ga0068855_1000678813 422
249 3300005577 Ga0068857_100000303 Ga0068857_10000030322 422
250 3300005614 Ga0068856_100026395 Ga0068856_1000263955 422
251 3300005617 Ga0068859_100309071 Ga0068859_1003090712 422
252 3300005718 Ga0068866_10002981 Ga0068866_100029813 422
253 3300005719 Ga0068861_100040579 Ga0068861_1000405793 422
254 3300005841 Ga0068863_100160556 Ga0068863_1001605563 422
255 3300005842 Ga0068858_100023113 Ga0068858_1000231133 422
256 3300006931 Ga0097620_100309049 Ga0097620_1003090492 422
257 3300009092 Ga0105250_10010613 Ga0105250_100106133 422
258 3300009098 Ga0105245_10022181 Ga0105245_100221816 422
259 3300009101 Ga0105247_10010029 Ga0105247_100100295 422
260 3300009174 Ga0105241_10029352 Ga0105241_100293524 422
261 3300009176 Ga0105242_10021948 Ga0105242_100219484 422
262 3300010375 Ga0105239_10145568 Ga0105239_101455681 422
263 3300013100 Ga0157373_10060925 Ga0157373_100609251 422
264 3300013102 Ga0157371_10002229 Ga0157371_100022292 422
265 3300013105 Ga0157369_10016706 Ga0157369_1001670610 422
266 3300013306 Ga0163162_10074865 Ga0163162_100748654 422
267 3300013307 Ga0157372_10018033 Ga0157372_100180332 422
268 3300014325 Ga0163163_10005653 Ga0163163_100056538 422
269 3300014326 Ga0157380_10081636 Ga0157380_100816362 422
270 3300014745 Ga0157377_10005494 Ga0157377_100054945 422
271 3300017792 Ga0163161_10011286 Ga0163161_100112865 422
272 3300025315 Ga0207697_10001415 Ga0207697_100014158 422
273 3300025900 Ga0207710_10013168 Ga0207710_100131684 422
274 3300025901 Ga0207688_10012155 Ga0207688_100121555 422
275 3300025903 Ga0207680_10061450 Ga0207680_100614502 422
276 3300025904 Ga0207647_10015912 Ga0207647_100159125 422
277 3300025907 Ga0207645_10000073 Ga0207645_1000007330 422
278 3300025908 Ga0207643_10002582 Ga0207643_100025825 422
279 3300025909 Ga0207705_10061374 Ga0207705_100613742 422
280 3300025919 Ga0207657_10000379 Ga0207657_1000037929 422
281 3300025920 Ga0207649_10001371 Ga0207649_1000137111 422
282 3300025925 Ga0207650_10000045 Ga0207650_1000004564 422
283 3300025933 Ga0207706_10000213 Ga0207706_1000021336 422
284 3300025936 Ga0207670_10100065 Ga0207670_101000652 422
285 3300025940 Ga0207691_10000556 Ga0207691_100005567 422
286 3300025941 Ga0207711_10015005 Ga0207711_100150053 422
287 3300025942 Ga0207689_10000780 Ga0207689_100007805 422
288 3300025944 Ga0207661_10003233 Ga0207661_100032334 422
289 3300025945 Ga0207679_10000096 Ga0207679_100000967 422
290 3300025960 Ga0207651_10011411 Ga0207651_100114114 422
291 3300026035 Ga0207703_10021954 Ga0207703_100219545 422
292 3300026041 Ga0207639_10052581 Ga0207639_100525814 422
293 3300026067 Ga0207678_10000026 Ga0207678_1000002684 422
294 3300026088 Ga0207641_10000075 Ga0207641_1000007564 422
295 3300026089 Ga0207648_10000679 Ga0207648_100006795 422
296 3300026095 Ga0207676_10000212 Ga0207676_1000021220 422
297 3300026116 Ga0207674_10000670 Ga0207674_100006704 422
298 3300026118 Ga0207675_100033917 Ga0207675_1000339174 422
299 3300026121 Ga0207683_10000438 Ga0207683_100004385 422
300 3300028379 Ga0268266_10001444 Ga0268266_100014442 422
301 3300028380 Ga0268265_10008138 Ga0268265_100081382 422
302 3300048911 Ga0496108_0000304 Ga0496108_0000304_26831_28099 422
303 3300048912 Ga0496109_0000164 Ga0496109_0000164_55828_57096 422
304 3300048913 Ga0496110_0002655 Ga0496110_0002655_10728_11996 422
305 3300048914 Ga0496111_0002195 Ga0496111_0002195_403_1671 422
306 3300048915 Ga0496112_0000078 Ga0496112_0000078_24752_26020 422
307 3300048916 Ga0496113_0000617 Ga0496113_0000617_5785_7053 422
308 3300048918 Ga0496115_0053907 Ga0496115_0053907_664_1932 422

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01244

Peptidase_M19

Membrane dipeptidase (Peptidase family M19)

34

383

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1itq-assembly1.cif.gz_A human renal dipeptidase 0.9081 33 410
3lu2-assembly1.cif.gz_A structure of lmo2462, a listeria monocytogenes amidohydrolase family putative dipeptidase 0.887 41 403
6vgo-assembly1.cif.gz_A crystal structure of human dipeptidase 3 0.8855 33 415
5lx7-assembly1.cif.gz_A-2 cys-gly dipeptidase glij mutant d38n 0.8846 33 416
5lwz-assembly2.cif.gz_C cys-gly dipeptidase glij (space group c2) 0.8823 28 416
ID Description Score Start End Superfamily
af_F1QFU9_23_390_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9123 33 415 3.20.20.140
af_E7FBC7_31_399_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8978 33 415 3.20.20.140
3b40A01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8884 30 409 3.20.20.140
5nruA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.881 33 416 3.20.20.140
3b40A01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8735 30 409 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A0C9R7I6-F1-model_v4 Dipeptidase (EC 3.4.13.19) 0.9679 84 173 GO:0006508
GO:0046872
GO:0070573
GO:0098552
AF-A0A7V0XFJ2-F1-model_v4 Membrane dipeptidase 0.9479 42 260 GO:0006508
GO:0070573
AF-A0A256WMH3-F1-model_v4 Membrane dipeptidase 0.9475 95 269 GO:0006508
GO:0070573
AF-A0A820JQI1-F1-model_v4 Dipeptidase (EC 3.4.13.19) 0.9473 111 264 GO:0006508
GO:0046872
GO:0070573
GO:0098552
AF-A0A3C1J1J8-F1-model_v4 deleted 0.9473 43 179

Feature Viewer

pLDDT pTM Quality
86.37 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map