F398721

General Info

Members Datasets Scaffolds Average Seq Length
306 172 612 134

Family's Representative Sequence

Representative Sequence 3300026116|Ga0207674_11655993|Ga0207674_116559932
Length 158
Sequence MQTLPTIITWQVDLQKTKKMKPRLVITILLVFLGALVLSFVTGFIPVKQKKPWPVSDADKSKVNPMKADASSIADGKALWAKHCQSCHGKTGKGDGSKAAQLKTEPGNFTVAATQSQTDGSLYYKTSVGRDDMPGFKKKIPENDDIWSIVNFIRTMKK

Samples

Sample ID Description Type Environment
1 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
115 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
116 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
117 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
118 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
119 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
120 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
121 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
122 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
123 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
124 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
125 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
126 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
127 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
128 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
133 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
134 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
135 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
136 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
137 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
138 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
139 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
140 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
141 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
142 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
143 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
144 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
145 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
146 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
147 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
148 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
149 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
150 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
151 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
152 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
153 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
154 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
157 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
158 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
159 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
170 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
172 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.94
Rhizosphere 97.06
Stem 0
Stem Tuber 0
Unclassified 16.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207674_11655993 3300026116 Bacteria 608
2 ARSoilOldRDRAFT_c026821 3300000044 Bacteria 524
3 Ga0065704_10487833 3300005289 Unclassified 676
4 Ga0065712_10583762 3300005290 Bacteria 599
5 Ga0070676_10615963 3300005328 Bacteria 784
6 Ga0070683_100106166 3300005329 Bacteria 2648
7 Ga0070690_100524877 3300005330 Unclassified 889
8 Ga0070690_100610342 3300005330 Bacteria 829
9 Ga0070670_100150816 3300005331 Bacteria 2012
10 Ga0070670_100353207 3300005331 Bacteria 1292
11 Ga0070677_10041902 3300005333 Bacteria 1810
12 Ga0068869_100925947 3300005334 Unclassified 755
13 Ga0070666_10754317 3300005335 Unclassified 715
14 Ga0070682_100207567 3300005337 Bacteria 1386
15 Ga0068868_100079471 3300005338 Unclassified 2627
16 Ga0070660_101558604 3300005339 Bacteria 562
17 Ga0070661_100138837 3300005344 Bacteria 1830
18 Ga0070661_100431244 3300005344 Bacteria 1046
19 Ga0070668_101212715 3300005347 Bacteria 684
20 Ga0070669_100477562 3300005353 Bacteria 1031
21 Ga0070669_100495180 3300005353 Bacteria 1013
22 Ga0070669_100755459 3300005353 Bacteria 824
23 Ga0070669_101150405 3300005353 Bacteria 669
24 Ga0070675_100054200 3300005354 Bacteria 3299
25 Ga0070671_100095509 3300005355 Bacteria 2492
26 Ga0070674_100535505 3300005356 Bacteria 980
27 Ga0070674_100919215 3300005356 Bacteria 763
28 Ga0070673_100454502 3300005364 Bacteria 1152
29 Ga0070673_100555017 3300005364 Bacteria 1044
30 Ga0070673_100617033 3300005364 Unclassified 990
31 Ga0070673_100654078 3300005364 Bacteria 962
32 Ga0070673_102011318 3300005364 Bacteria 548
33 Ga0070688_100169615 3300005365 Bacteria 1505
34 Ga0070659_100032101 3300005366 Unclassified 4070
35 Ga0070659_100032483 3300005366 Bacteria 4049
36 Ga0070659_100513721 3300005366 Unclassified 1022
37 Ga0070667_100052477 3300005367 Unclassified 3441
38 Ga0070667_100371767 3300005367 Bacteria 1297
39 Ga0070667_100401764 3300005367 Bacteria 1247
40 Ga0070700_100627916 3300005441 Bacteria 845
41 Ga0070678_101209284 3300005456 Bacteria 701
42 Ga0070678_102403891 3300005456 Bacteria 500
43 Ga0070662_100214831 3300005457 Bacteria 1532
44 Ga0070662_100503573 3300005457 Bacteria 1010
45 Ga0068867_100044401 3300005459 Bacteria 3256
46 Ga0068867_100153342 3300005459 Unclassified 1811
47 Ga0068867_101043445 3300005459 Bacteria 743
48 Ga0070685_10046060 3300005466 Unclassified 2502
49 Ga0070685_10798665 3300005466 Bacteria 695
50 Ga0070679_100011316 3300005530 Bacteria 8506
51 Ga0070679_100451404 3300005530 Bacteria 1230
52 Ga0070684_100097074 3300005535 Bacteria 2628
53 Ga0070684_100570401 3300005535 Unclassified 1051
54 Ga0068853_100592147 3300005539 Bacteria 1053
55 Ga0068853_101790504 3300005539 Unclassified 595
56 Ga0068853_102269722 3300005539 Bacteria 526
57 Ga0070672_100202841 3300005543 Bacteria 1659
58 Ga0070672_100717719 3300005543 Bacteria 876
59 Ga0070672_101181664 3300005543 Unclassified 681
60 Ga0070686_100086178 3300005544 Bacteria 2091
61 Ga0070686_100236275 3300005544 Bacteria 1328
62 Ga0070696_100922832 3300005546 Bacteria 725
63 Ga0070665_101272072 3300005548 Bacteria 746
64 Ga0070704_100757948 3300005549 Bacteria 865
65 Ga0068855_100002223 3300005563 Bacteria 24009
66 Ga0068855_100134332 3300005563 Bacteria 2823
67 Ga0068855_100193452 3300005563 Unclassified 2293
68 Ga0070664_100006493 3300005564 Bacteria 9428
69 Ga0070664_100063548 3300005564 Unclassified 3147
70 Ga0068857_100035028 3300005577 Bacteria 4444
71 Ga0068857_100075400 3300005577 Unclassified 3007
72 Ga0068857_100690745 3300005577 Bacteria 969
73 Ga0068854_100333716 3300005578 Bacteria 1236
74 Ga0068854_101340641 3300005578 Bacteria 645
75 Ga0068856_100091435 3300005614 Bacteria 3027
76 Ga0070702_100721812 3300005615 Bacteria 762
77 Ga0068852_100018970 3300005616 Bacteria 5432
78 Ga0068852_100167842 3300005616 Unclassified 2055
79 Ga0068852_100598140 3300005616 Bacteria 1107
80 Ga0068852_100778341 3300005616 Bacteria 970
81 Ga0068852_102226932 3300005616 Bacteria 569
82 Ga0068859_100394052 3300005617 Bacteria 1480
83 Ga0068859_101538399 3300005617 Bacteria 734
84 Ga0068864_100048292 3300005618 Bacteria 3658
85 Ga0068864_100119504 3300005618 Bacteria 2355
86 Ga0068864_100142873 3300005618 Bacteria 2161
87 Ga0068864_100542384 3300005618 Bacteria 1123
88 Ga0068864_101782187 3300005618 Bacteria 621
89 Ga0068866_10193031 3300005718 Bacteria 1211
90 Ga0068861_100166252 3300005719 Bacteria 1824
91 Ga0068861_101226063 3300005719 Bacteria 726
92 Ga0068863_100183081 3300005841 Bacteria 2011
93 Ga0068863_100321592 3300005841 Bacteria 1503
94 Ga0068863_101527698 3300005841 Bacteria 676
95 Ga0068858_100055439 3300005842 Bacteria 3664
96 Ga0068858_100683579 3300005842 Bacteria 998
97 Ga0068858_101704114 3300005842 Bacteria 622
98 Ga0068860_100097843 3300005843 Bacteria 2798
99 Ga0068860_100553486 3300005843 Bacteria 1153
100 Ga0068862_100288930 3300005844 Bacteria 1505
101 Ga0068862_100375238 3300005844 Bacteria 1325
102 Ga0068862_100597475 3300005844 Unclassified 1059
103 Ga0070715_10458432 3300006163 Bacteria 721
104 Ga0070716_100303745 3300006173 Bacteria 1111
105 Ga0070716_101191036 3300006173 Bacteria 611
106 Ga0097621_100009787 3300006237 Bacteria 6978
107 Ga0097621_100070720 3300006237 Bacteria 2882
108 Ga0097621_100130388 3300006237 Unclassified 2140
109 Ga0097621_100236491 3300006237 Bacteria 1596
110 Ga0097621_100298719 3300006237 Bacteria 1422
111 Ga0097621_100340030 3300006237 Unclassified 1333
112 Ga0068871_100005446 3300006358 Bacteria 8925
113 Ga0068871_100011169 3300006358 Bacteria 6581
114 Ga0068871_100021983 3300006358 Bacteria 4914
115 Ga0068871_100026112 3300006358 Bacteria 4554
116 Ga0097620_100394023 3300006931 Bacteria 1480
117 Ga0097620_101538815 3300006931 Bacteria 734
118 Ga0105247_10400491 3300009101 Unclassified 978
119 Ga0105241_10145032 3300009174 Bacteria 1937
120 Ga0105242_10622363 3300009176 Bacteria 1046
121 Ga0105242_10676306 3300009176 Bacteria 1007
122 Ga0105237_10010358 3300009545 Bacteria 9928
123 Ga0105249_13148816 3300009553 Unclassified 530
124 Ga0105239_10528647 3300010375 Unclassified 1342
125 Ga0157373_10033620 3300013100 Bacteria 3687
126 Ga0157371_10036469 3300013102 Bacteria 3521
127 Ga0157371_10110968 3300013102 Bacteria 1947
128 Ga0157369_10331166 3300013105 Bacteria 1582
129 Ga0157374_10528406 3300013296 Bacteria 1186
130 Ga0157374_11445503 3300013296 Bacteria 711
131 Ga0157378_10055879 3300013297 Bacteria 3517
132 Ga0157378_10190349 3300013297 Bacteria 1935
133 Ga0157378_10417497 3300013297 Bacteria 1325
134 Ga0157378_10454296 3300013297 Bacteria 1272
135 Ga0163162_10078637 3300013306 Bacteria 3364
136 Ga0163162_10145352 3300013306 Bacteria 2487
137 Ga0163162_10201275 3300013306 Bacteria 2120
138 Ga0163162_10348511 3300013306 Bacteria 1614
139 Ga0163162_10735032 3300013306 Bacteria 1107
140 Ga0163162_12918682 3300013306 Bacteria 550
141 Ga0157372_10056173 3300013307 Unclassified 4399
142 Ga0157372_10098872 3300013307 Bacteria 3329
143 Ga0157372_10219196 3300013307 Bacteria 2205
144 Ga0157372_10539905 3300013307 Bacteria 1359
145 Ga0157372_11907525 3300013307 Bacteria 683
146 Ga0157375_10128090 3300013308 Bacteria 2656
147 Ga0157375_10696426 3300013308 Bacteria 1170
148 Ga0157375_10863119 3300013308 Bacteria 1051
149 Ga0157375_10871981 3300013308 Bacteria 1045
150 Ga0157375_11189605 3300013308 Unclassified 894
151 Ga0157375_11262937 3300013308 Bacteria 867
152 Ga0163163_12908177 3300014325 Bacteria 534
153 Ga0157380_10333910 3300014326 Bacteria 1411
154 Ga0157380_11108893 3300014326 Bacteria 831
155 Ga0157380_12740665 3300014326 Bacteria 559
156 Ga0157380_12779249 3300014326 Bacteria 556
157 Ga0157377_10177279 3300014745 Bacteria 1337
158 Ga0157379_10296454 3300014968 Unclassified 1473
159 Ga0157379_10505795 3300014968 Bacteria 1120
160 Ga0157379_10941366 3300014968 Bacteria 821
161 Ga0157376_10179207 3300014969 Bacteria 1935
162 Ga0163161_10034877 3300017792 Bacteria 3599
163 Ga0163161_10224718 3300017792 Bacteria 1455
164 Ga0163161_10312948 3300017792 Bacteria 1239
165 Ga0163161_10522194 3300017792 Bacteria 970
166 Ga0207656_10412841 3300025321 Bacteria 679
167 Ga0207682_10083964 3300025893 Bacteria 1370
168 Ga0207682_10336832 3300025893 Bacteria 710
169 Ga0207705_10234685 3300025909 Bacteria 1396
170 Ga0207654_10679307 3300025911 Bacteria 739
171 Ga0207657_10263242 3300025919 Bacteria 1372
172 Ga0207649_10113880 3300025920 Bacteria 1812
173 Ga0207652_10023353 3300025921 Bacteria 5122
174 Ga0207652_10209160 3300025921 Unclassified 1756
175 Ga0207681_10523733 3300025923 Bacteria 973
176 Ga0207650_10352231 3300025925 Bacteria 1211
177 Ga0207650_10959857 3300025925 Unclassified 727
178 Ga0207650_11198182 3300025925 Bacteria 646
179 Ga0207650_11796338 3300025925 Bacteria 519
180 Ga0207659_10161443 3300025926 Bacteria 1760
181 Ga0207659_10590263 3300025926 Bacteria 946
182 Ga0207690_10072369 3300025932 Unclassified 2380
183 Ga0207690_11088036 3300025932 Bacteria 666
184 Ga0207706_10165778 3300025933 Bacteria 1942
185 Ga0207670_10004279 3300025936 Bacteria 7663
186 Ga0207665_10755578 3300025939 Bacteria 767
187 Ga0207691_10603134 3300025940 Bacteria 929
188 Ga0207691_10994116 3300025940 Archaea 700
189 Ga0207661_10097698 3300025944 Bacteria 2460
190 Ga0207661_10137475 3300025944 Bacteria 2100
191 Ga0207661_10238717 3300025944 Unclassified 1612
192 Ga0207679_10319019 3300025945 Unclassified 1345
193 Ga0207679_10593286 3300025945 Bacteria 997
194 Ga0207667_10036668 3300025949 Bacteria 5251
195 Ga0207667_10054650 3300025949 Bacteria 4200
196 Ga0207667_10334053 3300025949 Unclassified 1547
197 Ga0207651_10599277 3300025960 Bacteria 963
198 Ga0207651_10904741 3300025960 Unclassified 786
199 Ga0207651_10959739 3300025960 Bacteria 763
200 Ga0207651_11160653 3300025960 Bacteria 693
201 Ga0207651_11748083 3300025960 Bacteria 560
202 Ga0207712_10166495 3300025961 Bacteria 1718
203 Ga0207640_10285420 3300025981 Bacteria 1299
204 Ga0207640_10340262 3300025981 Bacteria 1201
205 Ga0207640_10653960 3300025981 Bacteria 896
206 Ga0207640_10997033 3300025981 Unclassified 737
207 Ga0207658_10096528 3300025986 Unclassified 2305
208 Ga0207658_10483370 3300025986 Bacteria 1101
209 Ga0207677_10043960 3300026023 Bacteria 2973
210 Ga0207703_10082124 3300026035 Bacteria 2688
211 Ga0207703_10992634 3300026035 Bacteria 805
212 Ga0207639_10955233 3300026041 Bacteria 802
213 Ga0207639_11499021 3300026041 Bacteria 633
214 Ga0207708_10439111 3300026075 Bacteria 1085
215 Ga0207708_10657335 3300026075 Bacteria 893
216 Ga0207702_10098157 3300026078 Bacteria 2580
217 Ga0207702_10115361 3300026078 Bacteria 2395
218 Ga0207702_11821605 3300026078 Bacteria 600
219 Ga0207641_10319734 3300026088 Bacteria 1471
220 Ga0207641_11344122 3300026088 Bacteria 715
221 Ga0207641_11755927 3300026088 Bacteria 622
222 Ga0207648_10129977 3300026089 Unclassified 2217
223 Ga0207648_10403713 3300026089 Unclassified 1239
224 Ga0207648_11065664 3300026089 Bacteria 758
225 Ga0207676_10110923 3300026095 Bacteria 2295
226 Ga0207676_10112020 3300026095 Bacteria 2285
227 Ga0207676_10146175 3300026095 Bacteria 2031
228 Ga0207676_10557889 3300026095 Bacteria 1095
229 Ga0207676_10675255 3300026095 Bacteria 999
230 Ga0207676_11256623 3300026095 Bacteria 735
231 Ga0207674_10011681 3300026116 Bacteria 9860
232 Ga0207674_10351972 3300026116 Bacteria 1424
233 Ga0207674_10620886 3300026116 Bacteria 1044
234 Ga0207675_100461636 3300026118 Bacteria 1260
235 Ga0207683_10789136 3300026121 Bacteria 881
236 Ga0207683_11323371 3300026121 Bacteria 667
237 Ga0207698_10130483 3300026142 Unclassified 2146
238 Ga0207698_10340235 3300026142 Bacteria 1413
239 Ga0268266_10971300 3300028379 Bacteria 822
240 Ga0268265_10206237 3300028380 Bacteria 1709
241 Ga0268265_10559219 3300028380 Bacteria 1087
242 Ga0268264_10238542 3300028381 Bacteria 1683
243 Ga0265324_10031656 3300029957 Bacteria 1851
244 Ga0265332_10188784 3300031238 Unclassified 858
245 Ga0265314_10067977 3300031711 Bacteria 2397
246 Ga0265342_10292506 3300031712 Unclassified 860
247 Ga0307410_10145177 3300031852 Bacteria 1760
248 Ga0307406_10688593 3300031901 Unclassified 852
249 Ga0307407_10956987 3300031903 Unclassified 660
250 Ga0307416_100190460 3300032002 Unclassified 1934
251 Ga0307416_100206612 3300032002 Unclassified 1869
252 Ga0307411_10303771 3300032005 Unclassified 1281
253 Ga0373956_0078217 3300035119 Bacteria 1515
254 Ga0373955_0076931 3300035172 Bacteria 1878
255 Ga0373924_0207746 3300035410 Bacteria 864
256 Ga0373935_0280525 3300035692 Bacteria 1173
257 Ga0373933_0115936 3300035724 Bacteria 1674
258 Ga0373947_0490262 3300035725 Bacteria 834
259 Ga0373937_0029193 3300036401 Bacteria 4993
260 Ga0395898_1899234 3300037466 Unclassified 516
261 Ga0395905_0378780 3300037471 Bacteria 1309
262 Ga0451577_0910037 3300042876 Unclassified 792
263 Ga0495592_0035728 3300046454 Bacteria 3744
264 Ga0495653_0183006 3300046463 Bacteria 1436
265 Ga0495582_0106397 3300046473 Bacteria 1574
266 Ga0495608_0066331 3300046511 Bacteria 2363
267 Ga0495618_0021607 3300046514 Bacteria 3968
268 Ga0495628_0041815 3300046516 Bacteria 3658
269 Ga0495630_0119351 3300046517 Bacteria 2000
270 Ga0495652_0549086 3300046529 Bacteria 795
271 Ga0495586_0755830 3300046535 Bacteria 561
272 Ga0495598_0063814 3300046537 Bacteria 1143
273 Ga0495645_0320909 3300046543 Bacteria 1006
274 Ga0495667_0097362 3300046559 Bacteria 1905
275 Ga0495634_0100665 3300046642 Bacteria 1867
276 Ga0495635_0439594 3300046663 Bacteria 863
277 Ga0495657_0473298 3300046675 Bacteria 732
278 Ga0495646_0041864 3300046680 Bacteria 2813
279 Ga0495658_0170078 3300046683 Bacteria 1348
280 Ga0495658_0681400 3300046683 Bacteria 659
281 Ga0495613_0101430 3300046689 Bacteria 2079
282 Ga0495624_0746786 3300046690 Bacteria 580
283 Ga0495600_0609566 3300046809 Bacteria 663
284 Ga0495674_0435895 3300047319 Bacteria 1054
285 Ga0495684_0048981 3300047471 Bacteria 3230
286 Ga0496104_0689721 3300048907 Bacteria 929
287 Ga0496105_0565931 3300048908 Bacteria 886
288 Ga0496105_0793267 3300048908 Bacteria 721
289 Ga0496105_1007392 3300048908 Bacteria 623
290 Ga0496109_1596649 3300048912 Bacteria 587
291 Ga0496110_0033435 3300048913 Bacteria 4448
292 Ga0496110_1013413 3300048913 Bacteria 738
293 Ga0496111_0858745 3300048914 Bacteria 655
294 Ga0496114_1305292 3300048917 Bacteria 613
295 Ga0501031_0019296 3300049568 Unclassified 4440
296 Ga0501032_0047064 3300049569 Bacteria 2914
297 Ga0501034_0064561 3300049571 Unclassified 3674
298 Ga0501036_0371688 3300049572 Bacteria 1193
299 Ga0501037_0010978 3300049573 Bacteria 6660
300 Ga0501039_0014668 3300049575 Bacteria 5994
301 Ga0501043_0060033 3300049579 Unclassified 2984
302 Ga0501046_0061422 3300049580 Unclassified 2938
303 Ga0501073_0592380 3300049589 Bacteria 766
304 Ga0501035_0415390 3300049822 Bacteria 1117
305 Ga0501044_0140256 3300049823 Bacteria 2406
306 Ga0495619_0050660 3300053085 Bacteria 2742
307 Ga0207674_11655993
308 ARSoilOldRDRAFT_c026821
309 Ga0065704_10487833
310 Ga0065712_10583762
311 Ga0070676_10615963
312 Ga0070683_100106166
313 Ga0070690_100524877
314 Ga0070690_100610342
315 Ga0070670_100150816
316 Ga0070670_100353207
317 Ga0070677_10041902
318 Ga0068869_100925947
319 Ga0070666_10754317
320 Ga0070682_100207567
321 Ga0068868_100079471
322 Ga0070660_101558604
323 Ga0070661_100138837
324 Ga0070661_100431244
325 Ga0070668_101212715
326 Ga0070669_100477562
327 Ga0070669_100495180
328 Ga0070669_100755459
329 Ga0070669_101150405
330 Ga0070675_100054200
331 Ga0070671_100095509
332 Ga0070674_100535505
333 Ga0070674_100919215
334 Ga0070673_100454502
335 Ga0070673_100555017
336 Ga0070673_100617033
337 Ga0070673_100654078
338 Ga0070673_102011318
339 Ga0070688_100169615
340 Ga0070659_100032101
341 Ga0070659_100032483
342 Ga0070659_100513721
343 Ga0070667_100052477
344 Ga0070667_100371767
345 Ga0070667_100401764
346 Ga0070700_100627916
347 Ga0070678_101209284
348 Ga0070678_102403891
349 Ga0070662_100214831
350 Ga0070662_100503573
351 Ga0068867_100044401
352 Ga0068867_100153342
353 Ga0068867_101043445
354 Ga0070685_10046060
355 Ga0070685_10798665
356 Ga0070679_100011316
357 Ga0070679_100451404
358 Ga0070684_100097074
359 Ga0070684_100570401
360 Ga0068853_100592147
361 Ga0068853_101790504
362 Ga0068853_102269722
363 Ga0070672_100202841
364 Ga0070672_100717719
365 Ga0070672_101181664
366 Ga0070686_100086178
367 Ga0070686_100236275
368 Ga0070696_100922832
369 Ga0070665_101272072
370 Ga0070704_100757948
371 Ga0068855_100002223
372 Ga0068855_100134332
373 Ga0068855_100193452
374 Ga0070664_100006493
375 Ga0070664_100063548
376 Ga0068857_100035028
377 Ga0068857_100075400
378 Ga0068857_100690745
379 Ga0068854_100333716
380 Ga0068854_101340641
381 Ga0068856_100091435
382 Ga0070702_100721812
383 Ga0068852_100018970
384 Ga0068852_100167842
385 Ga0068852_100598140
386 Ga0068852_100778341
387 Ga0068852_102226932
388 Ga0068859_100394052
389 Ga0068859_101538399
390 Ga0068864_100048292
391 Ga0068864_100119504
392 Ga0068864_100142873
393 Ga0068864_100542384
394 Ga0068864_101782187
395 Ga0068866_10193031
396 Ga0068861_100166252
397 Ga0068861_101226063
398 Ga0068863_100183081
399 Ga0068863_100321592
400 Ga0068863_101527698
401 Ga0068858_100055439
402 Ga0068858_100683579
403 Ga0068858_101704114
404 Ga0068860_100097843
405 Ga0068860_100553486
406 Ga0068862_100288930
407 Ga0068862_100375238
408 Ga0068862_100597475
409 Ga0070715_10458432
410 Ga0070716_100303745
411 Ga0070716_101191036
412 Ga0097621_100009787
413 Ga0097621_100070720
414 Ga0097621_100130388
415 Ga0097621_100236491
416 Ga0097621_100298719
417 Ga0097621_100340030
418 Ga0068871_100005446
419 Ga0068871_100011169
420 Ga0068871_100021983
421 Ga0068871_100026112
422 Ga0097620_100394023
423 Ga0097620_101538815
424 Ga0105247_10400491
425 Ga0105241_10145032
426 Ga0105242_10622363
427 Ga0105242_10676306
428 Ga0105237_10010358
429 Ga0105249_13148816
430 Ga0105239_10528647
431 Ga0157373_10033620
432 Ga0157371_10036469
433 Ga0157371_10110968
434 Ga0157369_10331166
435 Ga0157374_10528406
436 Ga0157374_11445503
437 Ga0157378_10055879
438 Ga0157378_10190349
439 Ga0157378_10417497
440 Ga0157378_10454296
441 Ga0163162_10078637
442 Ga0163162_10145352
443 Ga0163162_10201275
444 Ga0163162_10348511
445 Ga0163162_10735032
446 Ga0163162_12918682
447 Ga0157372_10056173
448 Ga0157372_10098872
449 Ga0157372_10219196
450 Ga0157372_10539905
451 Ga0157372_11907525
452 Ga0157375_10128090
453 Ga0157375_10696426
454 Ga0157375_10863119
455 Ga0157375_10871981
456 Ga0157375_11189605
457 Ga0157375_11262937
458 Ga0163163_12908177
459 Ga0157380_10333910
460 Ga0157380_11108893
461 Ga0157380_12740665
462 Ga0157380_12779249
463 Ga0157377_10177279
464 Ga0157379_10296454
465 Ga0157379_10505795
466 Ga0157379_10941366
467 Ga0157376_10179207
468 Ga0163161_10034877
469 Ga0163161_10224718
470 Ga0163161_10312948
471 Ga0163161_10522194
472 Ga0207656_10412841
473 Ga0207682_10083964
474 Ga0207682_10336832
475 Ga0207705_10234685
476 Ga0207654_10679307
477 Ga0207657_10263242
478 Ga0207649_10113880
479 Ga0207652_10023353
480 Ga0207652_10209160
481 Ga0207681_10523733
482 Ga0207650_10352231
483 Ga0207650_10959857
484 Ga0207650_11198182
485 Ga0207650_11796338
486 Ga0207659_10161443
487 Ga0207659_10590263
488 Ga0207690_10072369
489 Ga0207690_11088036
490 Ga0207706_10165778
491 Ga0207670_10004279
492 Ga0207665_10755578
493 Ga0207691_10603134
494 Ga0207691_10994116
495 Ga0207661_10097698
496 Ga0207661_10137475
497 Ga0207661_10238717
498 Ga0207679_10319019
499 Ga0207679_10593286
500 Ga0207667_10036668
501 Ga0207667_10054650
502 Ga0207667_10334053
503 Ga0207651_10599277
504 Ga0207651_10904741
505 Ga0207651_10959739
506 Ga0207651_11160653
507 Ga0207651_11748083
508 Ga0207712_10166495
509 Ga0207640_10285420
510 Ga0207640_10340262
511 Ga0207640_10653960
512 Ga0207640_10997033
513 Ga0207658_10096528
514 Ga0207658_10483370
515 Ga0207677_10043960
516 Ga0207703_10082124
517 Ga0207703_10992634
518 Ga0207639_10955233
519 Ga0207639_11499021
520 Ga0207708_10439111
521 Ga0207708_10657335
522 Ga0207702_10098157
523 Ga0207702_10115361
524 Ga0207702_11821605
525 Ga0207641_10319734
526 Ga0207641_11344122
527 Ga0207641_11755927
528 Ga0207648_10129977
529 Ga0207648_10403713
530 Ga0207648_11065664
531 Ga0207676_10110923
532 Ga0207676_10112020
533 Ga0207676_10146175
534 Ga0207676_10557889
535 Ga0207676_10675255
536 Ga0207676_11256623
537 Ga0207674_10011681
538 Ga0207674_10351972
539 Ga0207674_10620886
540 Ga0207675_100461636
541 Ga0207683_10789136
542 Ga0207683_11323371
543 Ga0207698_10130483
544 Ga0207698_10340235
545 Ga0268266_10971300
546 Ga0268265_10206237
547 Ga0268265_10559219
548 Ga0268264_10238542
549 Ga0265324_10031656
550 Ga0265332_10188784
551 Ga0265314_10067977
552 Ga0265342_10292506
553 Ga0307410_10145177
554 Ga0307406_10688593
555 Ga0307407_10956987
556 Ga0307416_100190460
557 Ga0307416_100206612
558 Ga0307411_10303771
559 Ga0373956_0078217
560 Ga0373955_0076931
561 Ga0373924_0207746
562 Ga0373935_0280525
563 Ga0373933_0115936
564 Ga0373947_0490262
565 Ga0373937_0029193
566 Ga0395898_1899234
567 Ga0395905_0378780
568 Ga0451577_0910037
569 Ga0495592_0035728
570 Ga0495653_0183006
571 Ga0495582_0106397
572 Ga0495608_0066331
573 Ga0495618_0021607
574 Ga0495628_0041815
575 Ga0495630_0119351
576 Ga0495652_0549086
577 Ga0495586_0755830
578 Ga0495598_0063814
579 Ga0495645_0320909
580 Ga0495667_0097362
581 Ga0495634_0100665
582 Ga0495635_0439594
583 Ga0495657_0473298
584 Ga0495646_0041864
585 Ga0495658_0170078
586 Ga0495658_0681400
587 Ga0495613_0101430
588 Ga0495624_0746786
589 Ga0495600_0609566
590 Ga0495674_0435895
591 Ga0495684_0048981
592 Ga0496104_0689721
593 Ga0496105_0565931
594 Ga0496105_0793267
595 Ga0496105_1007392
596 Ga0496109_1596649
597 Ga0496110_0033435
598 Ga0496110_1013413
599 Ga0496111_0858745
600 Ga0496114_1305292
601 Ga0501031_0019296
602 Ga0501032_0047064
603 Ga0501034_0064561
604 Ga0501036_0371688
605 Ga0501037_0010978
606 Ga0501039_0014668
607 Ga0501043_0060033
608 Ga0501046_0061422
609 Ga0501073_0592380
610 Ga0501035_0415390
611 Ga0501044_0140256
612 Ga0495619_0050660

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00034

Cytochrom_C

Cytochrome c

73

157

0.79

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

71

153

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
6loe-assembly1.cif.gz_E cryo-em structure of the dithionite-reduced photosynthetic alternative complex iii from roseiflexus castenholzii 0.914 39 131
6lod-assembly1.cif.gz_E cryo-em structure of the air-oxidized photosynthetic alternative complex iii from roseiflexus castenholzii 0.9088 39 132
5mxy-assembly1.cif.gz_A kustc0563 c-type cytochrome 0.8592 50 132
7o38-assembly1.cif.gz_A cytochrome c kustc0562 from kuenenia stuttgartiensis 0.8374 50 131
5mxz-assembly1.cif.gz_A kustc0563 y40f mutant 0.8354 49 131
ID Description Score Start End Superfamily
1hzuA01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8081 39 128 1.10.760.10
1h9yB01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8064 45 128 1.10.760.10
4eifA00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8053 49 129 1.10.760.10
1h9yA01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7971 43 128 1.10.760.10
1mg2H00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7969 43 131 1.10.760.10
ID Description Score Start End GO Terms
AF-A0A7Y2YHX4-F1-model_v4 Cytochrome c 0.9911 53 132 GO:0009055
GO:0020037
GO:0046872
AF-A0A7Y2MN56-F1-model_v4 Cytochrome c 0.9834 24 131 GO:0009055
GO:0020037
GO:0046872
AF-A0A117SG03-F1-model_v4 Cytochrome C 0.9825 36 129 GO:0009055
GO:0020037
GO:0046872
AF-A0A3S0E828-F1-model_v4 C-type cytochrome 0.9752 25 132 GO:0009055
GO:0020037
GO:0046872
AF-A0A7Y2MN56-F1-model_v4 Cytochrome c 0.9744 24 131 GO:0009055
GO:0020037
GO:0046872

Map