F398693

General Info

Members Datasets Scaffolds Average Seq Length
306 154 306 499

Family's Representative Sequence

Representative Sequence 3300025885|Ga0207653_10018666|Ga0207653_100186662
Length 523
Sequence VAELSPPPDDAAGPSRDRPFPPGPYPVVVVGSGPGGIQLSYSLRQLGIDHALLSADPSPGGMFRRWPFFQRLLSWTKPYAPVERGGRAYERYDWNSLLADEPEHRAIMPTFMDGSSYFPSRPEMEQNIATFAERTGTIARYECRWTGTRREEGPDGESFVLETTDGEYRAPILVFAVGVAQPYSPPTPGIELTAHYADTRPAETYADRRVFIMGKQNSGFELATGLLPWARRIYVASPSPAKLSVNTRSLVGVRARYVQPFEDHVLGGGVSVLDASIGGIVRGEEGSGSPFLVTVRPSDGGEDLAIEIDEVISATGFVTPLLDLPALGVTTFGQARLPAQTAYWESATVPGIFFAGTIGQGSAGLKKHGLPANSGAVHGARYNARVLAAHIARRVGSERPAGPTIAAAGLVDRIIAEIATAPELWHQRAYLAKVISLDPSSGPRDEGIVPLAAFVDAAGDDGAGNAIALTLEADGSGAIYPVLYLRQAGKVEERPIDADALLRFDTPAARSQVAAILVEAGVG

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
92 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
93 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
96 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
97 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
98 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
101 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
102 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
103 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
104 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
105 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
106 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
107 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
108 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
109 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
110 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
111 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
112 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
113 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
114 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
115 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
116 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
117 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
118 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
119 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
120 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
131 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
132 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
133 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
134 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
135 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
136 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
137 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
138 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
139 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
140 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
141 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
142 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
145 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
146 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
147 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
148 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
149 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
150 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
151 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
152 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
153 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
154 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.82
Rhizosphere 91.18
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100019556 3300005329 Bacteria 6016
2 Ga0070690_100013298 3300005330 Bacteria 4861
3 Ga0070670_100041132 3300005331 Bacteria 3972
4 Ga0068868_100011413 3300005338 Bacteria 6470
5 Ga0070660_100016188 3300005339 Bacteria 5407
6 Ga0070689_100003676 3300005340 Bacteria 10239
7 Ga0070687_100022638 3300005343 Unclassified 2974
8 Ga0070661_100008512 3300005344 Bacteria 7096
9 Ga0070692_10023678 3300005345 Bacteria 3011
10 Ga0070669_100051994 3300005353 Bacteria 2996
11 Ga0070675_100029928 3300005354 Bacteria 4393
12 Ga0070674_100001714 3300005356 Bacteria 11880
13 Ga0070659_100041689 3300005366 Bacteria 3589
14 Ga0070659_100093957 3300005366 Unclassified 2407
15 Ga0070703_10005316 3300005406 Bacteria 3597
16 Ga0070703_10010102 3300005406 Unclassified 2663
17 Ga0070714_100005309 3300005435 Bacteria 9820
18 Ga0070714_100088241 3300005435 Bacteria 2713
19 Ga0070701_10011117 3300005438 Bacteria 4009
20 Ga0070705_100004536 3300005440 Bacteria 6756
21 Ga0070705_100011773 3300005440 Bacteria 4426
22 Ga0070700_100004371 3300005441 Bacteria 7375
23 Ga0070694_100049591 3300005444 Bacteria 2828
24 Ga0070694_100054010 3300005444 Bacteria 2720
25 Ga0070708_100000126 3300005445 Bacteria 52000
26 Ga0070708_100001734 3300005445 Bacteria 16749
27 Ga0070708_100001972 3300005445 Bacteria 15822
28 Ga0070708_100002459 3300005445 Bacteria 14344
29 Ga0070708_100004281 3300005445 Bacteria 11220
30 Ga0070708_100015187 3300005445 Bacteria 6350
31 Ga0070708_100020890 3300005445 Bacteria 5528
32 Ga0070708_100044565 3300005445 Unclassified 3901
33 Ga0070708_100085128 3300005445 Bacteria 2869
34 Ga0070708_100104356 3300005445 Unclassified 2599
35 Ga0070708_100124595 3300005445 Unclassified 2380
36 Ga0070663_100080348 3300005455 Unclassified 2394
37 Ga0070678_100024324 3300005456 Bacteria 4053
38 Ga0070662_100019735 3300005457 Bacteria 4581
39 Ga0070662_100045683 3300005457 Bacteria 3144
40 Ga0070662_100051175 3300005457 Bacteria 2982
41 Ga0068867_100048892 3300005459 Bacteria 3112
42 Ga0070685_10001588 3300005466 Bacteria 11992
43 Ga0070706_100000008 3300005467 Bacteria 225667
44 Ga0070706_100000041 3300005467 Bacteria 147263
45 Ga0070706_100000045 3300005467 Bacteria 145830
46 Ga0070706_100000277 3300005467 Bacteria 62380
47 Ga0070706_100001598 3300005467 Bacteria 23610
48 Ga0070706_100001809 3300005467 Bacteria 22151
49 Ga0070706_100006025 3300005467 Bacteria 11461
50 Ga0070706_100010368 3300005467 Bacteria 8655
51 Ga0070706_100027824 3300005467 Bacteria 5200
52 Ga0070706_100124371 3300005467 Bacteria 2404
53 Ga0070707_100000010 3300005468 Bacteria 165044
54 Ga0070707_100001047 3300005468 Bacteria 27389
55 Ga0070707_100001226 3300005468 Bacteria 25184
56 Ga0070707_100001798 3300005468 Bacteria 20598
57 Ga0070707_100004318 3300005468 Bacteria 13316
58 Ga0070707_100004813 3300005468 Bacteria 12648
59 Ga0070707_100008908 3300005468 Bacteria 9309
60 Ga0070707_100009705 3300005468 Bacteria 8946
61 Ga0070707_100012764 3300005468 Bacteria 7844
62 Ga0070707_100019931 3300005468 Bacteria 6322
63 Ga0070707_100024724 3300005468 Bacteria 5692
64 Ga0070707_100028731 3300005468 Bacteria 5292
65 Ga0070707_100031000 3300005468 Bacteria 5092
66 Ga0070707_100041577 3300005468 Unclassified 4400
67 Ga0070707_100088693 3300005468 Unclassified 2992
68 Ga0070698_100000166 3300005471 Bacteria 60815
69 Ga0070698_100000971 3300005471 Bacteria 31459
70 Ga0070698_100001003 3300005471 Bacteria 31091
71 Ga0070698_100001234 3300005471 Bacteria 28463
72 Ga0070698_100002416 3300005471 Bacteria 20570
73 Ga0070698_100004653 3300005471 Bacteria 15088
74 Ga0070698_100007399 3300005471 Bacteria 11880
75 Ga0070698_100018121 3300005471 Bacteria 7412
76 Ga0070698_100058129 3300005471 Unclassified 3911
77 Ga0070698_100068914 3300005471 Bacteria 3554
78 Ga0070699_100000066 3300005518 Bacteria 99262
79 Ga0070699_100000072 3300005518 Bacteria 95475
80 Ga0070699_100000142 3300005518 Bacteria 67557
81 Ga0070699_100007812 3300005518 Bacteria 9298
82 Ga0070699_100013897 3300005518 Bacteria 6924
83 Ga0070684_100106458 3300005535 Bacteria 2510
84 Ga0070697_100003838 3300005536 Bacteria 11539
85 Ga0070697_100005371 3300005536 Bacteria 9858
86 Ga0070697_100005640 3300005536 Bacteria 9644
87 Ga0070697_100006001 3300005536 Bacteria 9394
88 Ga0070697_100009230 3300005536 Bacteria 7707
89 Ga0070697_100018829 3300005536 Bacteria 5448
90 Ga0070697_100031522 3300005536 Bacteria 4265
91 Ga0070697_100146900 3300005536 Unclassified 1985
92 Ga0070686_100002601 3300005544 Bacteria 9958
93 Ga0070695_100008515 3300005545 Bacteria 6088
94 Ga0070695_100016781 3300005545 Bacteria 4436
95 Ga0070695_100037211 3300005545 Unclassified 3066
96 Ga0070695_100039641 3300005545 Bacteria 2979
97 Ga0070696_100004490 3300005546 Bacteria 9314
98 Ga0070696_100012119 3300005546 Bacteria 5778
99 Ga0070696_100058887 3300005546 Bacteria 2683
100 Ga0070696_100076953 3300005546 Bacteria 2357
101 Ga0070704_100003991 3300005549 Bacteria 8509
102 Ga0070704_100011600 3300005549 Bacteria 5410
103 Ga0070704_100013694 3300005549 Bacteria 5043
104 Ga0070704_100063853 3300005549 Bacteria 2644
105 Ga0070664_100049411 3300005564 Bacteria 3557
106 Ga0068854_100028311 3300005578 Bacteria 3871
107 Ga0068852_100054166 3300005616 Bacteria 3457
108 Ga0068864_100081581 3300005618 Unclassified 2835
109 Ga0068861_100171184 3300005719 Bacteria 1800
110 Ga0068870_10024482 3300005840 Bacteria 2987
111 Ga0068858_100108785 3300005842 Unclassified 2588
112 Ga0068862_100053916 3300005844 Bacteria 3443
113 Ga0081539_10008103 3300005985 Bacteria 9288
114 Ga0070717_10000039 3300006028 Bacteria 114756
115 Ga0075428_100000325 3300006844 Bacteria 47369
116 Ga0075428_100115597 3300006844 Bacteria 2923
117 Ga0075431_100076142 3300006847 Bacteria 3463
118 Ga0075431_100132924 3300006847 Unclassified 2566
119 Ga0075433_10019819 3300006852 Bacteria 5613
120 Ga0075434_100091058 3300006871 Bacteria 3051
121 Ga0068865_100011259 3300006881 Bacteria 5592
122 Ga0075436_100014288 3300006914 Bacteria 5436
123 Ga0075436_100111917 3300006914 Bacteria 1906
124 Ga0075435_100012086 3300007076 Bacteria 6381
125 Ga0075435_100037652 3300007076 Bacteria 3853
126 Ga0075435_100130288 3300007076 Bacteria 2104
127 Ga0111539_10003073 3300009094 Bacteria 22122
128 Ga0111539_10059934 3300009094 Bacteria 4511
129 Ga0105245_10019670 3300009098 Bacteria 5916
130 Ga0105245_10058712 3300009098 Bacteria 3463
131 Ga0114129_10000230 3300009147 Bacteria 62383
132 Ga0114129_10033421 3300009147 Bacteria 7268
133 Ga0114129_10113318 3300009147 Unclassified 3740
134 Ga0114129_10311798 3300009147 Unclassified 2094
135 Ga0105243_10050253 3300009148 Bacteria 3293
136 Ga0105242_10009314 3300009176 Bacteria 7540
137 Ga0105248_10012366 3300009177 Bacteria 9417
138 Ga0105248_10057829 3300009177 Bacteria 4353
139 Ga0105249_10016312 3300009553 Bacteria 6589
140 Ga0105239_10006690 3300010375 Bacteria 13314
141 Ga0157378_10012919 3300013297 Bacteria 7308
142 Ga0157375_10015047 3300013308 Bacteria 6919
143 Ga0163163_10096179 3300014325 Bacteria 2982
144 Ga0157377_10001039 3300014745 Bacteria 11751
145 Ga0157379_10006362 3300014968 Bacteria 10169
146 Ga0157376_10098691 3300014969 Bacteria 2547
147 Ga0207653_10004868 3300025885 Bacteria 4193
148 Ga0207653_10018666 3300025885 Bacteria 2183
149 Ga0207688_10006910 3300025901 Bacteria 6177
150 Ga0207645_10052470 3300025907 Unclassified 2606
151 Ga0207643_10004754 3300025908 Bacteria 7282
152 Ga0207684_10000001 3300025910 Bacteria 1115726
153 Ga0207684_10000008 3300025910 Bacteria 601602
154 Ga0207684_10000020 3300025910 Bacteria 342787
155 Ga0207684_10000029 3300025910 Bacteria 305483
156 Ga0207684_10000051 3300025910 Bacteria 230737
157 Ga0207684_10000712 3300025910 Bacteria 39185
158 Ga0207684_10001505 3300025910 Bacteria 24984
159 Ga0207684_10012299 3300025910 Bacteria 7450
160 Ga0207684_10014594 3300025910 Bacteria 6769
161 Ga0207684_10019059 3300025910 Bacteria 5869
162 Ga0207684_10050006 3300025910 Bacteria 3546
163 Ga0207662_10001908 3300025918 Bacteria 10278
164 Ga0207657_10097337 3300025919 Unclassified 2447
165 Ga0207649_10035607 3300025920 Unclassified 2992
166 Ga0207646_10000041 3300025922 Bacteria 187336
167 Ga0207646_10000249 3300025922 Bacteria 73284
168 Ga0207646_10000454 3300025922 Bacteria 54695
169 Ga0207646_10000475 3300025922 Bacteria 53587
170 Ga0207646_10000724 3300025922 Bacteria 42735
171 Ga0207646_10000859 3300025922 Bacteria 39238
172 Ga0207646_10001626 3300025922 Bacteria 27430
173 Ga0207646_10001809 3300025922 Bacteria 25869
174 Ga0207646_10002231 3300025922 Bacteria 23070
175 Ga0207646_10002626 3300025922 Bacteria 21110
176 Ga0207646_10002898 3300025922 Bacteria 19916
177 Ga0207646_10004141 3300025922 Bacteria 15928
178 Ga0207646_10004234 3300025922 Bacteria 15690
179 Ga0207646_10006293 3300025922 Bacteria 12305
180 Ga0207646_10012715 3300025922 Bacteria 8077
181 Ga0207646_10080644 3300025922 Unclassified 2910
182 Ga0207646_10092402 3300025922 Bacteria 2709
183 Ga0207694_10023793 3300025924 Bacteria 4651
184 Ga0207659_10073215 3300025926 Unclassified 2508
185 Ga0207687_10073051 3300025927 Unclassified 2455
186 Ga0207706_10059730 3300025933 Bacteria 3358
187 Ga0207686_10030716 3300025934 Bacteria 3184
188 Ga0207709_10019024 3300025935 Bacteria 3854
189 Ga0207665_10056189 3300025939 Bacteria 2657
190 Ga0207679_10118406 3300025945 Unclassified 2103
191 Ga0207677_10050593 3300026023 Bacteria 2811
192 Ga0207678_10008048 3300026067 Bacteria 9295
193 Ga0207648_10020366 3300026089 Bacteria 5974
194 Ga0207674_10065474 3300026116 Bacteria 3663
195 Ga0207683_10017229 3300026121 Bacteria 6153
196 Ga0207683_10031054 3300026121 Bacteria 4635
197 Ga0207698_10031326 3300026142 Bacteria 3837
198 Ga0268264_10030105 3300028381 Bacteria 4450
199 Ga0268264_10087532 3300028381 Unclassified 2678
200 Ga0265319_1006791 3300028563 Bacteria 5239
201 Ga0265318_10005586 3300028577 Bacteria 5895
202 Ga0265318_10008012 3300028577 Bacteria 4736
203 Ga0265322_10011581 3300028654 Bacteria 2554
204 Ga0265338_10032786 3300028800 Bacteria 5056
205 Ga0265324_10019843 3300029957 Bacteria 2419
206 Ga0265320_10001598 3300031240 Bacteria 16251
207 Ga0265339_10084161 3300031249 Unclassified 1677
208 Ga0265316_10095133 3300031344 Bacteria 2269
209 Ga0307408_100042827 3300031548 Bacteria 3219
210 Ga0307408_100081240 3300031548 Unclassified 2423
211 Ga0265314_10003905 3300031711 Bacteria 14168
212 Ga0265342_10019573 3300031712 Bacteria 4360
213 Ga0307409_100037006 3300031995 Bacteria 3594
214 Ga0451576_0127670 3300045051 Unclassified 2650
215 Ga0495651_0043712 3300046462 Bacteria 3475
216 Ga0495653_0069600 3300046463 Unclassified 2636
217 Ga0495664_0089247 3300046477 Unclassified 1853
218 Ga0495628_0120134 3300046516 Bacteria 2017
219 Ga0496101_0008854 3300048904 Bacteria 6588
220 Ga0496102_0023933 3300048905 Bacteria 5428
221 Ga0496102_0048499 3300048905 Bacteria 3861
222 Ga0496102_0108247 3300048905 Bacteria 2589
223 Ga0496104_0031902 3300048907 Bacteria 4901
224 Ga0496104_0134603 3300048907 Bacteria 2374
225 Ga0496105_0005784 3300048908 Bacteria 9428
226 Ga0496105_0273527 3300048908 Unclassified 1363
227 Ga0496106_0023654 3300048909 Bacteria 4565
228 Ga0496108_0001348 3300048911 Bacteria 19302
229 Ga0496108_0018258 3300048911 Bacteria 5744
230 Ga0496108_0097656 3300048911 Bacteria 2503
231 Ga0496108_0103423 3300048911 Bacteria 2430
232 Ga0496108_0183256 3300048911 Bacteria 1814
233 Ga0496109_0047369 3300048912 Bacteria 3908
234 Ga0496109_0079477 3300048912 Unclassified 3021
235 Ga0496109_0082295 3300048912 Bacteria 2967
236 Ga0496110_0011104 3300048913 Bacteria 7357
237 Ga0496110_0016456 3300048913 Bacteria 6175
238 Ga0496110_0067847 3300048913 Bacteria 3156
239 Ga0496111_0006730 3300048914 Bacteria 7483
240 Ga0496111_0023477 3300048914 Bacteria 4331
241 Ga0496111_0162418 3300048914 Bacteria 1658
242 Ga0496112_0013174 3300048915 Bacteria 7630
243 Ga0496112_0178439 3300048915 Bacteria 2088
244 Ga0496113_0027064 3300048916 Bacteria 4107
245 Ga0496114_0004274 3300048917 Bacteria 11058
246 Ga0501031_0016459 3300049568 Bacteria 4803
247 Ga0501031_0038229 3300049568 Bacteria 3132
248 Ga0501031_0044976 3300049568 Bacteria 2881
249 Ga0501032_0066560 3300049569 Bacteria 2408
250 Ga0501036_0017099 3300049572 Bacteria 6062
251 Ga0501036_0073134 3300049572 Bacteria 2898
252 Ga0501037_0051997 3300049573 Bacteria 2996
253 Ga0501039_0023601 3300049575 Bacteria 4721
254 Ga0501039_0063113 3300049575 Bacteria 2870
255 Ga0501040_0013582 3300049576 Bacteria 5356
256 Ga0501040_0049256 3300049576 Unclassified 2880
257 Ga0501041_0009346 3300049577 Bacteria 5776
258 Ga0501041_0020989 3300049577 Bacteria 3911
259 Ga0501041_0060995 3300049577 Bacteria 2308
260 Ga0501042_0010379 3300049578 Bacteria 6241
261 Ga0501046_0041297 3300049580 Bacteria 3681
262 Ga0501048_0030919 3300049582 Bacteria 3875
263 Ga0501068_0037362 3300049584 Bacteria 2908
264 Ga0501070_0007348 3300049586 Bacteria 9355
265 Ga0501071_0016183 3300049587 Bacteria 5126
266 Ga0501071_0167938 3300049587 Unclassified 1642
267 Ga0501072_0010364 3300049588 Bacteria 7101
268 Ga0501072_0069036 3300049588 Bacteria 2790
269 Ga0501072_0128124 3300049588 Unclassified 2022
270 Ga0501073_0013147 3300049589 Bacteria 6033
271 Ga0501074_0014961 3300049590 Bacteria 5645
272 Ga0501074_0031927 3300049590 Bacteria 3817
273 Ga0501075_0012909 3300049591 Bacteria 5950
274 Ga0501075_0021507 3300049591 Bacteria 4705
275 Ga0501075_0062157 3300049591 Bacteria 2815
276 Ga0501075_0079145 3300049591 Bacteria 2488
277 Ga0501076_0001031 3300049592 Bacteria 18319
278 Ga0501076_0010863 3300049592 Bacteria 6772
279 Ga0501076_0030531 3300049592 Bacteria 4198
280 Ga0501076_0040745 3300049592 Bacteria 3650
281 Ga0501079_0002685 3300049741 Bacteria 12944
282 Ga0501079_0048017 3300049741 Bacteria 3293
283 Ga0501080_0037055 3300049742 Bacteria 4553
284 Ga0501080_0157886 3300049742 Bacteria 2095
285 Ga0501081_0005853 3300049743 Bacteria 7959
286 Ga0501083_0126928 3300049744 Bacteria 1672
287 Ga0501035_0067449 3300049822 Bacteria 3175
288 Ga0501044_0107876 3300049823 Bacteria 2795
289 Ga0501045_0001883 3300049824 Bacteria 14211
290 Ga0501045_0042935 3300049824 Bacteria 3291
291 nmdc:mga05p37_173844_c1 3300050507 Unclassified 2625
292 nmdc:mga05p37_560_c1 3300050507 Bacteria 40876
293 nmdc:mga06r32_151537_c1 3300050510 Unclassified 2297
294 nmdc:mga0n895_135319_c1 3300050512 Unclassified 2491
295 nmdc:mga08x19_17255_c1 3300050514 Bacteria 4415
296 nmdc:mga08x19_21522_c1 3300050514 Bacteria 3983
297 nmdc:mga08x19_95124_c1 3300050514 Bacteria 1970
298 nmdc:mga0a205_184546_c1 3300050515 Bacteria 1979
299 Ga0495601_0022257 3300053077 Bacteria 3890
300 Ga0495612_0000311 3300053078 Bacteria 19676
301 Ga0501084_0020099 3300054114 Bacteria 5568
302 Ga0501084_0113088 3300054114 Bacteria 2282
303 Ga0501082_0057469 3300060353 Bacteria 3352
304 Ga0530510_0002833 3300061734 Bacteria 11929
305 Ga0530510_0089555 3300061734 Bacteria 2243
306 Ga0530510_0131246 3300061734 Unclassified 1843

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005471 Ga0070698_100007399 Ga0070698_10000739913 407
2 3300048908 Ga0496105_0273527 Ga0496105_0273527_26_1273 409
3 3300005545 Ga0070695_100008515 Ga0070695_1000085155 435
4 3300005546 Ga0070696_100076953 Ga0070696_1000769533 435
5 3300005468 Ga0070707_100012764 Ga0070707_1000127646 449
6 3300005536 Ga0070697_100031522 Ga0070697_1000315222 449
7 3300005578 Ga0068854_100028311 Ga0068854_1000283112 449
8 3300007076 Ga0075435_100037652 Ga0075435_1000376524 449
9 3300009147 Ga0114129_10033421 Ga0114129_100334214 449
10 3300025922 Ga0207646_10002898 Ga0207646_100028987 449
11 3300025922 Ga0207646_10004141 Ga0207646_100041413 449
12 3300025922 Ga0207646_10004234 Ga0207646_100042348 449
13 3300025922 Ga0207646_10000041 Ga0207646_10000041149 452
14 3300009094 Ga0111539_10003073 Ga0111539_1000307311 461
15 3300009098 Ga0105245_10019670 Ga0105245_100196702 461
16 3300009176 Ga0105242_10009314 Ga0105242_100093145 461
17 3300009177 Ga0105248_10012366 Ga0105248_100123669 461
18 3300009553 Ga0105249_10016312 Ga0105249_100163126 461
19 3300010375 Ga0105239_10006690 Ga0105239_1000669011 461
20 3300013297 Ga0157378_10012919 Ga0157378_100129195 461
21 3300013308 Ga0157375_10015047 Ga0157375_100150473 461
22 3300014325 Ga0163163_10096179 Ga0163163_100961793 461
23 3300014745 Ga0157377_10001039 Ga0157377_100010395 461
24 3300014969 Ga0157376_10098691 Ga0157376_100986912 461
25 3300049591 Ga0501075_0079145 Ga0501075_0079145_69_1454 461
26 3300050512 nmdc:mga0n895_135319_c1 nmdc:mga0n895_135319_c1_233_1618 461
27 3300005445 Ga0070708_100104356 Ga0070708_1001043562 463
28 3300005468 Ga0070707_100019931 Ga0070707_1000199313 463
29 3300005471 Ga0070698_100001234 Ga0070698_10000123414 463
30 3300005467 Ga0070706_100001809 Ga0070706_10000180910 471
31 3300005468 Ga0070707_100001047 Ga0070707_10000104725 471
32 3300025910 Ga0207684_10000712 Ga0207684_1000071221 471
33 3300025922 Ga0207646_10001626 Ga0207646_100016262 471
34 3300007076 Ga0075435_100130288 Ga0075435_1001302883 475
35 3300005406 Ga0070703_10005316 Ga0070703_100053164 477
36 3300005445 Ga0070708_100001972 Ga0070708_10000197213 477
37 3300005467 Ga0070706_100001598 Ga0070706_10000159814 477
38 3300005468 Ga0070707_100009705 Ga0070707_1000097057 477
39 3300005471 Ga0070698_100018121 Ga0070698_1000181211 477
40 3300005518 Ga0070699_100000142 Ga0070699_1000001424 477
41 3300005536 Ga0070697_100009230 Ga0070697_1000092303 477
42 3300025885 Ga0207653_10004868 Ga0207653_100048682 477
43 3300025910 Ga0207684_10000001 Ga0207684_10000001986 477
44 3300025922 Ga0207646_10012715 Ga0207646_100127152 477
45 3300005719 Ga0068861_100171184 Ga0068861_1001711842 481
46 3300009148 Ga0105243_10050253 Ga0105243_100502532 481
47 3300048914 Ga0496111_0162418 Ga0496111_0162418_47_1570 481
48 3300049575 Ga0501039_0023601 Ga0501039_0023601_2238_3746 481
49 3300049576 Ga0501040_0049256 Ga0501040_0049256_996_2504 481
50 3300049587 Ga0501071_0167938 Ga0501071_0167938_12_1520 481
51 3300049591 Ga0501075_0021507 Ga0501075_0021507_2667_4175 481
52 3300049741 Ga0501079_0002685 Ga0501079_0002685_181_1689 481
53 3300060353 Ga0501082_0057469 Ga0501082_0057469_1805_3313 481
54 3300061734 Ga0530510_0131246 Ga0530510_0131246_33_1541 481
55 3300005535 Ga0070684_100106458 Ga0070684_1001064582 482
56 3300005545 Ga0070695_100037211 Ga0070695_1000372113 482
57 3300005549 Ga0070704_100013694 Ga0070704_1000136943 482
58 3300009177 Ga0105248_10057829 Ga0105248_100578291 482
59 3300026121 Ga0207683_10031054 Ga0207683_100310542 482
60 3300048911 Ga0496108_0097656 Ga0496108_0097656_924_2453 482
61 3300048915 Ga0496112_0178439 Ga0496112_0178439_400_1929 482
62 3300005457 Ga0070662_100051175 Ga0070662_1000511752 483
63 3300049588 Ga0501072_0069036 Ga0501072_0069036_458_1966 483
64 3300049592 Ga0501076_0030531 Ga0501076_0030531_873_2381 483
65 3300049568 Ga0501031_0016459 Ga0501031_0016459_1324_2790 484
66 3300049573 Ga0501037_0051997 Ga0501037_0051997_85_1551 484
67 3300049575 Ga0501039_0063113 Ga0501039_0063113_471_1937 484
68 3300049577 Ga0501041_0020989 Ga0501041_0020989_168_1634 484
69 3300049580 Ga0501046_0041297 Ga0501046_0041297_1414_2880 484
70 3300049590 Ga0501074_0014961 Ga0501074_0014961_442_1908 484
71 3300049741 Ga0501079_0048017 Ga0501079_0048017_1795_3261 484
72 3300049742 Ga0501080_0037055 Ga0501080_0037055_667_2133 484
73 3300049743 Ga0501081_0005853 Ga0501081_0005853_2019_3485 484
74 3300049744 Ga0501083_0126928 Ga0501083_0126928_115_1581 484
75 3300049823 Ga0501044_0107876 Ga0501044_0107876_375_1841 484
76 3300049824 Ga0501045_0042935 Ga0501045_0042935_1776_3242 484
77 3300005468 Ga0070707_100008908 Ga0070707_1000089087 485
78 3300005518 Ga0070699_100000066 Ga0070699_10000006626 485
79 3300005406 Ga0070703_10010102 Ga0070703_100101022 486
80 3300025910 Ga0207684_10019059 Ga0207684_100190594 486
81 3300025922 Ga0207646_10006293 Ga0207646_100062932 486
82 3300005471 Ga0070698_100001003 Ga0070698_10000100320 487
83 3300005536 Ga0070697_100003838 Ga0070697_1000038387 487
84 3300025910 Ga0207684_10014594 Ga0207684_100145946 487
85 3300005440 Ga0070705_100004536 Ga0070705_1000045366 488
86 3300005536 Ga0070697_100005640 Ga0070697_1000056409 488
87 3300005545 Ga0070695_100016781 Ga0070695_1000167811 488
88 3300005546 Ga0070696_100004490 Ga0070696_1000044904 488
89 3300005549 Ga0070704_100003991 Ga0070704_1000039916 488
90 3300048905 Ga0496102_0023933 Ga0496102_0023933_1336_2892 488
91 3300005445 Ga0070708_100004281 Ga0070708_1000042818 489
92 3300005467 Ga0070706_100000041 Ga0070706_10000004164 489
93 3300005468 Ga0070707_100004813 Ga0070707_1000048137 489
94 3300005536 Ga0070697_100018829 Ga0070697_1000188295 489
95 3300025922 Ga0207646_10001809 Ga0207646_100018094 489
96 3300006844 Ga0075428_100000325 Ga0075428_1000003259 492
97 3300006847 Ga0075431_100076142 Ga0075431_1000761424 492
98 3300009147 Ga0114129_10000230 Ga0114129_1000023024 492
99 3300031995 Ga0307409_100037006 Ga0307409_1000370062 492
100 3300048907 Ga0496104_0134603 Ga0496104_0134603_129_1652 492
101 3300050507 nmdc:mga05p37_560_c1 nmdc:mga05p37_560_c1_8160_9698 492
102 3300050510 nmdc:mga06r32_151537_c1 nmdc:mga06r32_151537_c1_253_1791 492
103 3300005467 Ga0070706_100006025 Ga0070706_1000060258 493
104 3300005467 Ga0070706_100027824 Ga0070706_1000278244 493
105 3300005468 Ga0070707_100001798 Ga0070707_10000179818 493
106 3300025910 Ga0207684_10001505 Ga0207684_100015056 493
107 3300031548 Ga0307408_100081240 Ga0307408_1000812403 493
108 3300005445 Ga0070708_100002459 Ga0070708_1000024595 494
109 3300005467 Ga0070706_100000008 Ga0070706_100000008189 494
110 3300005468 Ga0070707_100028731 Ga0070707_1000287314 494
111 3300005471 Ga0070698_100004653 Ga0070698_1000046534 494
112 3300009094 Ga0111539_10059934 Ga0111539_100599342 494
113 3300009147 Ga0114129_10113318 Ga0114129_101133182 494
114 3300025910 Ga0207684_10000029 Ga0207684_10000029190 494
115 3300050507 nmdc:mga05p37_173844_c1 nmdc:mga05p37_173844_c1_727_2259 494
116 3300050515 nmdc:mga0a205_184546_c1 nmdc:mga0a205_184546_c1_202_1734 494
117 3300014968 Ga0157379_10006362 Ga0157379_100063626 495
118 3300048912 Ga0496109_0079477 Ga0496109_0079477_968_2455 495
119 3300048913 Ga0496110_0067847 Ga0496110_0067847_934_2421 495
120 3300048914 Ga0496111_0023477 Ga0496111_0023477_339_1826 495
121 3300005445 Ga0070708_100020890 Ga0070708_1000208903 496
122 3300005518 Ga0070699_100013897 Ga0070699_1000138976 496
123 3300025922 Ga0207646_10000859 Ga0207646_1000085911 496
124 3300048907 Ga0496104_0031902 Ga0496104_0031902_395_1921 496
125 3300048908 Ga0496105_0005784 Ga0496105_0005784_1364_2890 496
126 3300048911 Ga0496108_0001348 Ga0496108_0001348_12879_14405 496
127 3300048913 Ga0496110_0016456 Ga0496110_0016456_166_1692 496
128 3300048914 Ga0496111_0006730 Ga0496111_0006730_1910_3436 496
129 3300048915 Ga0496112_0013174 Ga0496112_0013174_4701_6227 496
130 3300005435 Ga0070714_100088241 Ga0070714_1000882413 497
131 3300005445 Ga0070708_100000126 Ga0070708_10000012645 497
132 3300005467 Ga0070706_100000045 Ga0070706_100000045104 497
133 3300005468 Ga0070707_100000010 Ga0070707_10000001032 497
134 3300005471 Ga0070698_100068914 Ga0070698_1000689141 497
135 3300005518 Ga0070699_100000072 Ga0070699_10000007257 497
136 3300005549 Ga0070704_100063853 Ga0070704_1000638532 497
137 3300006028 Ga0070717_10000039 Ga0070717_10000039123 497
138 3300006914 Ga0075436_100014288 Ga0075436_1000142883 497
139 3300025910 Ga0207684_10000051 Ga0207684_10000051151 497
140 3300025910 Ga0207684_10050006 Ga0207684_100500065 497
141 3300025922 Ga0207646_10000724 Ga0207646_100007243 497
142 3300048905 Ga0496102_0108247 Ga0496102_0108247_141_1670 497
143 3300050514 nmdc:mga08x19_21522_c1 nmdc:mga08x19_21522_c1_1077_2612 497
144 3300005445 Ga0070708_100001734 Ga0070708_10000173410 498
145 3300005445 Ga0070708_100044565 Ga0070708_1000445652 498
146 3300005445 Ga0070708_100124595 Ga0070708_1001245952 498
147 3300005468 Ga0070707_100024724 Ga0070707_1000247242 498
148 3300005468 Ga0070707_100088693 Ga0070707_1000886932 498
149 3300005471 Ga0070698_100000971 Ga0070698_10000097126 498
150 3300005536 Ga0070697_100005371 Ga0070697_1000053715 498
151 3300005536 Ga0070697_100006001 Ga0070697_1000060018 498
152 3300005536 Ga0070697_100146900 Ga0070697_1001469002 498
153 3300025922 Ga0207646_10000249 Ga0207646_1000024921 498
154 3300025922 Ga0207646_10002231 Ga0207646_1000223118 498
155 3300025922 Ga0207646_10002626 Ga0207646_1000262620 498
156 3300049742 Ga0501080_0157886 Ga0501080_0157886_519_2027 498
157 3300050514 nmdc:mga08x19_17255_c1 nmdc:mga08x19_17255_c1_2853_4382 498
158 3300005435 Ga0070714_100005309 Ga0070714_1000053093 499
159 3300005444 Ga0070694_100054010 Ga0070694_1000540101 499
160 3300005467 Ga0070706_100000277 Ga0070706_10000027734 499
161 3300005468 Ga0070707_100001226 Ga0070707_10000122611 499
162 3300005471 Ga0070698_100000166 Ga0070698_10000016635 499
163 3300005546 Ga0070696_100012119 Ga0070696_1000121195 499
164 3300007076 Ga0075435_100012086 Ga0075435_1000120864 499
165 3300025910 Ga0207684_10000008 Ga0207684_10000008454 499
166 3300025922 Ga0207646_10000475 Ga0207646_1000047515 499
167 3300025922 Ga0207646_10080644 Ga0207646_100806442 499
168 3300025939 Ga0207665_10056189 Ga0207665_100561893 499
169 3300005445 Ga0070708_100085128 Ga0070708_1000851282 500
170 3300005468 Ga0070707_100031000 Ga0070707_1000310003 500
171 3300006871 Ga0075434_100091058 Ga0075434_1000910582 500
172 3300025910 Ga0207684_10000020 Ga0207684_10000020255 500
173 3300025922 Ga0207646_10000454 Ga0207646_1000045437 500
174 3300028563 Ga0265319_1006791 Ga0265319_10067912 500
175 3300028577 Ga0265318_10005586 Ga0265318_100055865 500
176 3300028577 Ga0265318_10008012 Ga0265318_100080124 500
177 3300028800 Ga0265338_10032786 Ga0265338_100327865 500
178 3300029957 Ga0265324_10019843 Ga0265324_100198432 500
179 3300031240 Ga0265320_10001598 Ga0265320_1000159812 500
180 3300031249 Ga0265339_10084161 Ga0265339_100841612 500
181 3300031344 Ga0265316_10095133 Ga0265316_100951333 500
182 3300031711 Ga0265314_10003905 Ga0265314_100039054 500
183 3300031712 Ga0265342_10019573 Ga0265342_100195734 500
184 3300005468 Ga0070707_100041577 Ga0070707_1000415772 501
185 3300046462 Ga0495651_0043712 Ga0495651_0043712_10_1524 501
186 3300046463 Ga0495653_0069600 Ga0495653_0069600_1093_2607 501
187 3300046477 Ga0495664_0089247 Ga0495664_0089247_255_1769 501
188 3300053077 Ga0495601_0022257 Ga0495601_0022257_1927_3441 501
189 3300054114 Ga0501084_0113088 Ga0501084_0113088_279_1793 501
190 3300009098 Ga0105245_10058712 Ga0105245_100587124 502
191 3300048911 Ga0496108_0183256 Ga0496108_0183256_155_1672 502
192 3300005345 Ga0070692_10023678 Ga0070692_100236783 503
193 3300005366 Ga0070659_100041689 Ga0070659_1000416891 503
194 3300005445 Ga0070708_100015187 Ga0070708_1000151871 503
195 3300005457 Ga0070662_100045683 Ga0070662_1000456832 503
196 3300005467 Ga0070706_100010368 Ga0070706_1000103685 503
197 3300005471 Ga0070698_100058129 Ga0070698_1000581293 503
198 3300005546 Ga0070696_100058887 Ga0070696_1000588873 503
199 3300005549 Ga0070704_100011600 Ga0070704_1000116005 503
200 3300006914 Ga0075436_100111917 Ga0075436_1001119172 503
201 3300025885 Ga0207653_10018666 Ga0207653_100186662 503
202 3300025910 Ga0207684_10012299 Ga0207684_100122994 503
203 3300025922 Ga0207646_10092402 Ga0207646_100924022 503
204 3300025927 Ga0207687_10073051 Ga0207687_100730512 503
205 3300025933 Ga0207706_10059730 Ga0207706_100597303 503
206 3300028381 Ga0268264_10030105 Ga0268264_100301054 503
207 3300028654 Ga0265322_10011581 Ga0265322_100115813 503
208 3300045051 Ga0451576_0127670 Ga0451576_0127670_733_2298 503
209 3300050514 nmdc:mga08x19_95124_c1 nmdc:mga08x19_95124_c1_262_1782 503
210 3300005985 Ga0081539_10008103 Ga0081539_100081032 504
211 3300049572 Ga0501036_0017099 Ga0501036_0017099_1172_2716 504
212 3300049578 Ga0501042_0010379 Ga0501042_0010379_2987_4531 504
213 3300049586 Ga0501070_0007348 Ga0501070_0007348_5764_7308 504
214 3300049587 Ga0501071_0016183 Ga0501071_0016183_1569_3113 504
215 3300049589 Ga0501073_0013147 Ga0501073_0013147_352_1896 504
216 3300049592 Ga0501076_0040745 Ga0501076_0040745_93_1637 504
217 3300053078 Ga0495612_0000311 Ga0495612_0000311_8657_10213 504
218 3300061734 Ga0530510_0089555 Ga0530510_0089555_298_1842 504
219 3300006844 Ga0075428_100115597 Ga0075428_1001155972 505
220 3300048904 Ga0496101_0008854 Ga0496101_0008854_3947_5491 505
221 3300048905 Ga0496102_0048499 Ga0496102_0048499_1946_3490 505
222 3300048911 Ga0496108_0103423 Ga0496108_0103423_739_2283 505
223 3300048912 Ga0496109_0082295 Ga0496109_0082295_838_2382 505
224 3300048913 Ga0496110_0011104 Ga0496110_0011104_3530_5074 505
225 3300048917 Ga0496114_0004274 Ga0496114_0004274_4532_6076 505
226 3300005467 Ga0070706_100124371 Ga0070706_1001243712 508
227 3300005468 Ga0070707_100004318 Ga0070707_1000043189 508
228 3300005518 Ga0070699_100007812 Ga0070699_1000078122 508
229 3300006852 Ga0075433_10019819 Ga0075433_100198192 508
230 3300046516 Ga0495628_0120134 Ga0495628_0120134_403_1965 508
231 3300048912 Ga0496109_0047369 Ga0496109_0047369_681_2243 508
232 3300048916 Ga0496113_0027064 Ga0496113_0027064_516_2078 508
233 3300049568 Ga0501031_0038229 Ga0501031_0038229_772_2319 509
234 3300049568 Ga0501031_0044976 Ga0501031_0044976_920_2452 509
235 3300049569 Ga0501032_0066560 Ga0501032_0066560_754_2301 509
236 3300049572 Ga0501036_0073134 Ga0501036_0073134_214_1761 509
237 3300049577 Ga0501041_0009346 Ga0501041_0009346_1149_2696 509
238 3300049577 Ga0501041_0060995 Ga0501041_0060995_67_1599 509
239 3300049582 Ga0501048_0030919 Ga0501048_0030919_1870_3417 509
240 3300049584 Ga0501068_0037362 Ga0501068_0037362_519_2066 509
241 3300049588 Ga0501072_0010364 Ga0501072_0010364_2178_3725 509
242 3300049590 Ga0501074_0031927 Ga0501074_0031927_1945_3492 509
243 3300049591 Ga0501075_0012909 Ga0501075_0012909_370_1917 509
244 3300049592 Ga0501076_0001031 Ga0501076_0001031_864_2411 509
245 3300049824 Ga0501045_0001883 Ga0501045_0001883_3888_5435 509
246 3300054114 Ga0501084_0020099 Ga0501084_0020099_3903_5450 509
247 3300005329 Ga0070683_100019556 Ga0070683_1000195566 510
248 3300005330 Ga0070690_100013298 Ga0070690_1000132984 510
249 3300005331 Ga0070670_100041132 Ga0070670_1000411323 510
250 3300005338 Ga0068868_100011413 Ga0068868_1000114135 510
251 3300005339 Ga0070660_100016188 Ga0070660_1000161883 510
252 3300005340 Ga0070689_100003676 Ga0070689_1000036767 510
253 3300005343 Ga0070687_100022638 Ga0070687_1000226382 510
254 3300005344 Ga0070661_100008512 Ga0070661_1000085125 510
255 3300005353 Ga0070669_100051994 Ga0070669_1000519943 510
256 3300005354 Ga0070675_100029928 Ga0070675_1000299282 510
257 3300005356 Ga0070674_100001714 Ga0070674_1000017144 510
258 3300005366 Ga0070659_100093957 Ga0070659_1000939572 510
259 3300005438 Ga0070701_10011117 Ga0070701_100111172 510
260 3300005440 Ga0070705_100011773 Ga0070705_1000117733 510
261 3300005441 Ga0070700_100004371 Ga0070700_1000043717 510
262 3300005444 Ga0070694_100049591 Ga0070694_1000495913 510
263 3300005455 Ga0070663_100080348 Ga0070663_1000803482 510
264 3300005456 Ga0070678_100024324 Ga0070678_1000243242 510
265 3300005457 Ga0070662_100019735 Ga0070662_1000197352 510
266 3300005459 Ga0068867_100048892 Ga0068867_1000488923 510
267 3300005466 Ga0070685_10001588 Ga0070685_1000158811 510
268 3300005471 Ga0070698_100002416 Ga0070698_10000241617 510
269 3300005544 Ga0070686_100002601 Ga0070686_1000026013 510
270 3300005545 Ga0070695_100039641 Ga0070695_1000396413 510
271 3300005564 Ga0070664_100049411 Ga0070664_1000494113 510
272 3300005616 Ga0068852_100054166 Ga0068852_1000541664 510
273 3300005618 Ga0068864_100081581 Ga0068864_1000815813 510
274 3300005840 Ga0068870_10024482 Ga0068870_100244823 510
275 3300005842 Ga0068858_100108785 Ga0068858_1001087852 510
276 3300005844 Ga0068862_100053916 Ga0068862_1000539162 510
277 3300006847 Ga0075431_100132924 Ga0075431_1001329242 510
278 3300006881 Ga0068865_100011259 Ga0068865_1000112592 510
279 3300009147 Ga0114129_10311798 Ga0114129_103117982 510
280 3300025901 Ga0207688_10006910 Ga0207688_100069103 510
281 3300025907 Ga0207645_10052470 Ga0207645_100524702 510
282 3300025908 Ga0207643_10004754 Ga0207643_100047544 510
283 3300025918 Ga0207662_10001908 Ga0207662_100019086 510
284 3300025919 Ga0207657_10097337 Ga0207657_100973372 510
285 3300025920 Ga0207649_10035607 Ga0207649_100356073 510
286 3300025924 Ga0207694_10023793 Ga0207694_100237933 510
287 3300025926 Ga0207659_10073215 Ga0207659_100732152 510
288 3300025934 Ga0207686_10030716 Ga0207686_100307164 510
289 3300025935 Ga0207709_10019024 Ga0207709_100190244 510
290 3300025945 Ga0207679_10118406 Ga0207679_101184062 510
291 3300026023 Ga0207677_10050593 Ga0207677_100505932 510
292 3300026067 Ga0207678_10008048 Ga0207678_100080484 510
293 3300026089 Ga0207648_10020366 Ga0207648_100203665 510
294 3300026116 Ga0207674_10065474 Ga0207674_100654743 510
295 3300026121 Ga0207683_10017229 Ga0207683_100172292 510
296 3300026142 Ga0207698_10031326 Ga0207698_100313263 510
297 3300028381 Ga0268264_10087532 Ga0268264_100875322 510
298 3300031548 Ga0307408_100042827 Ga0307408_1000428272 510
299 3300048909 Ga0496106_0023654 Ga0496106_0023654_2219_3751 510
300 3300048911 Ga0496108_0018258 Ga0496108_0018258_1879_3411 510
301 3300049576 Ga0501040_0013582 Ga0501040_0013582_1095_2636 510
302 3300049588 Ga0501072_0128124 Ga0501072_0128124_340_1875 510
303 3300049591 Ga0501075_0062157 Ga0501075_0062157_785_2320 510
304 3300049592 Ga0501076_0010863 Ga0501076_0010863_3814_5349 510
305 3300049822 Ga0501035_0067449 Ga0501035_0067449_468_2003 510
306 3300061734 Ga0530510_0002833 Ga0530510_0002833_1557_3092 510

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13738

Pyr_redox_3

Pyridine nucleotide-disulphide oxidoreductase

150

356

0.86

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

25

367

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
1i8t-assembly1.cif.gz_B structure of udp-galactopyranose mutase from e.coli 0.9256 13 49
6l2z-assembly1.cif.gz_B ilvc, a ketol-acid reductoisomerase, from streptococcus pnuemoniae_d191g 0.925 14 42
6l2k-assembly1.cif.gz_B ilvc, a ketol-acid reductoisomerase, from streptococcus pneumoniae_r49e 0.9168 14 43
7o1g-assembly1.cif.gz_A-2 structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme alpha-e141a-h462a, beta-c92a mutant 0.9041 13 44
6jit-assembly2.cif.gz_C complex structure of an imine reductase at 2.05 angstrom resolution 0.8974 13 45
ID Description Score Start End Superfamily
af_A7YT47_359_542_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9474 15 43 3.40.50.720
af_Q4DB76_342_532_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9319 15 44 3.40.50.720
4oqyB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9267 13 42 3.40.50.720
5a9sB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9008 14 45 3.40.50.720
4xdyB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8887 13 42 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2V6WMP7-F1-model_v4 Uncharacterized protein 0.9761 391 502
AF-A0A538E752-F1-model_v4 FAD-binding domain-containing protein 0.9587 4 122 GO:0071949
AF-A0A2V6WMP7-F1-model_v4 Uncharacterized protein 0.9512 391 502
AF-A0A535TMH4-F1-model_v4 FAD-binding domain-containing protein 0.9491 4 153 GO:0071949
AF-A0A7C1KBN6-F1-model_v4 NAD(P)/FAD-dependent oxidoreductase 0.9457 4 140

Feature Viewer

pLDDT pTM Quality
85.55 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map