F396903

General Info

Members Datasets Scaffolds Average Seq Length
303 158 606 419

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100184494|Ga0070699_1001844941
Length 458
Sequence MLRRRCRSYPQEPKAHANFTPEMARSSSPLRWRLKSAAILVFLFIFVVQGSQGFSVLSHEAIIDSEWDPVIKPLLLQQFPNATPDELKEAHAYAYGGAIIQDVGYYPFGNKLFSDLTHYIRSADFVRALVRDSQDLDEYAFALGALAHYVADNDGHRLAVNHAVPMLYPKLRRKFGNIVVYDQDPAAHLKTEFGFDVLEVAKGHYASDDYHNAIGFQVSKPLLQRAFQDTYSLDLTSVITKYDLAIGTFRYSVSNVIPQMTRVAWQTKKDDIRKEIPGITRRKFIYNISRASYKKSWKDQYKKPGFGTRLLSFLLRIVPKIGPFRALSFRAPTPEAGQLFMASFNTTIKDYADAVHEKEQTGELQIQNDNFDTGTVTGPGDYPLADATYAQLVDRLAKNHFQQISPELRQDILAYYSNLDAPFATKKNKKEWPRVVSEIDELKAITPAAVSAAAPAQH

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
81 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
119 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
122 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
123 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
124 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
125 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
126 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
127 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
128 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
129 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
130 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
136 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
137 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
138 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
139 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
140 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
141 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
142 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
143 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
144 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
145 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
146 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
147 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
148 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
149 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
150 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
154 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
155 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
158 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.01
Metatranscriptomes 0.99
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.66
Rhizosphere 98.68
Stem 0
Stem Tuber 0
Unclassified 20.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_100184494 3300005518 Unclassified 1852
2 MRS1b_contig_3469666 2162886011 Bacteria 2153
3 JGI24751J29686_10002808 3300002459 Bacteria 3506
4 Ga0065712_10076546 3300005290 Bacteria 3641
5 Ga0065715_10010671 3300005293 Bacteria 2287
6 Ga0070676_10021379 3300005328 Bacteria 3623
7 Ga0070683_100000668 3300005329 Bacteria 24820
8 Ga0070683_100132639 3300005329 Bacteria 2358
9 Ga0070690_100065401 3300005330 Bacteria 2351
10 Ga0070670_100007431 3300005331 Bacteria 9305
11 Ga0068869_100043812 3300005334 Unclassified 3216
12 Ga0070666_10040296 3300005335 Bacteria 3117
13 Ga0070680_100028982 3300005336 Bacteria 4444
14 Ga0070680_100059713 3300005336 Bacteria 3121
15 Ga0070682_100049426 3300005337 Bacteria 2622
16 Ga0068868_100079752 3300005338 Bacteria 2623
17 Ga0070660_100015293 3300005339 Bacteria 5537
18 Ga0070660_100047400 3300005339 Bacteria 3298
19 Ga0070660_100079121 3300005339 Bacteria 2579
20 Ga0070689_100097290 3300005340 Bacteria 2327
21 Ga0070691_10002000 3300005341 Bacteria 8990
22 Ga0070661_100026511 3300005344 Bacteria 4168
23 Ga0070692_10050435 3300005345 Bacteria 2161
24 Ga0070671_100182215 3300005355 Bacteria 1778
25 Ga0070673_100016978 3300005364 Bacteria 5164
26 Ga0070709_10052878 3300005434 Unclassified 2555
27 Ga0070714_100103423 3300005435 Bacteria 2512
28 Ga0070713_100028744 3300005436 Bacteria 4393
29 Ga0070713_100046681 3300005436 Bacteria 3555
30 Ga0070708_100088318 3300005445 Unclassified 2819
31 Ga0070681_10001877 3300005458 Bacteria 18970
32 Ga0070681_10010272 3300005458 Bacteria 9239
33 Ga0070681_10059645 3300005458 Bacteria 3795
34 Ga0070681_10090404 3300005458 Unclassified 3012
35 Ga0068867_100107658 3300005459 Bacteria 2137
36 Ga0070706_100188291 3300005467 Bacteria 1929
37 Ga0070698_100007777 3300005471 Bacteria 11602
38 Ga0070679_100006935 3300005530 Bacteria 10568
39 Ga0070679_100015277 3300005530 Bacteria 7377
40 Ga0070684_100000386 3300005535 Bacteria 30619
41 Ga0070684_100031792 3300005535 Unclassified 4495
42 Ga0070684_100043688 3300005535 Unclassified 3872
43 Ga0070684_100222112 3300005535 Bacteria 1723
44 Ga0070697_100160799 3300005536 Bacteria 1897
45 Ga0068853_100200490 3300005539 Bacteria 1816
46 Ga0070665_100018594 3300005548 Bacteria 6964
47 Ga0070704_100095437 3300005549 Bacteria 2227
48 Ga0068855_100006699 3300005563 Bacteria 13980
49 Ga0068855_100007262 3300005563 Bacteria 13434
50 Ga0068855_100012755 3300005563 Bacteria 10134
51 Ga0068855_100067402 3300005563 Bacteria 4170
52 Ga0068855_100227196 3300005563 Bacteria 2091
53 Ga0068855_100268892 3300005563 Unclassified 1896
54 Ga0068857_100001338 3300005577 Bacteria 19407
55 Ga0068857_100057389 3300005577 Bacteria 3455
56 Ga0068857_100075168 3300005577 Bacteria 3012
57 Ga0068854_100062172 3300005578 Bacteria 2706
58 Ga0068856_100001575 3300005614 Bacteria 23874
59 Ga0068856_100033052 3300005614 Bacteria 5065
60 Ga0068856_100079280 3300005614 Bacteria 3256
61 Ga0068856_100117350 3300005614 Unclassified 2662
62 Ga0068856_100191099 3300005614 Bacteria 2061
63 Ga0068856_100246430 3300005614 Bacteria 1802
64 Ga0068852_100003894 3300005616 Bacteria 10488
65 Ga0068852_100053427 3300005616 Bacteria 3477
66 Ga0068859_100010046 3300005617 Bacteria 9547
67 Ga0068859_100035411 3300005617 Bacteria 5009
68 Ga0068864_100028992 3300005618 Unclassified 4682
69 Ga0068851_10097946 3300005834 Unclassified 1552
70 Ga0068858_100070452 3300005842 Unclassified 3241
71 Ga0068858_100119511 3300005842 Bacteria 2464
72 Ga0068860_100200660 3300005843 Unclassified 1933
73 Ga0070717_10020841 3300006028 Bacteria 5160
74 Ga0070712_100076499 3300006175 Bacteria 2410
75 Ga0097621_100013642 3300006237 Bacteria 6065
76 Ga0097621_100060637 3300006237 Bacteria 3101
77 Ga0097621_100282854 3300006237 Bacteria 1460
78 Ga0068871_100007567 3300006358 Bacteria 7771
79 Ga0068871_100044267 3300006358 Unclassified 3579
80 Ga0068871_100070732 3300006358 Bacteria 2868
81 Ga0068871_100282063 3300006358 Bacteria 1453
82 Ga0075430_100104142 3300006846 Bacteria 2369
83 Ga0075431_100044966 3300006847 Bacteria 4552
84 Ga0075433_10089819 3300006852 Unclassified 2715
85 Ga0075433_10215500 3300006852 Unclassified 1706
86 Ga0075434_100130398 3300006871 Unclassified 2533
87 Ga0068865_100009187 3300006881 Bacteria 6119
88 Ga0068865_100037720 3300006881 Unclassified 3265
89 Ga0097620_100010046 3300006931 Bacteria 9547
90 Ga0097620_100035411 3300006931 Bacteria 5009
91 Ga0105240_10000429 3300009093 Bacteria 77882
92 Ga0105240_10000476 3300009093 Bacteria 74156
93 Ga0105240_10005652 3300009093 Bacteria 18562
94 Ga0105240_10006790 3300009093 Bacteria 16739
95 Ga0105240_10114711 3300009093 Unclassified 3254
96 Ga0105240_10126558 3300009093 Bacteria 3070
97 Ga0105240_10132506 3300009093 Bacteria 2988
98 Ga0111539_10033382 3300009094 Bacteria 6247
99 Ga0105245_10000396 3300009098 Bacteria 40404
100 Ga0105245_10082224 3300009098 Unclassified 2946
101 Ga0105245_10167526 3300009098 Unclassified 2090
102 Ga0105245_10199929 3300009098 Bacteria 1919
103 Ga0105247_10097355 3300009101 Unclassified 1877
104 Ga0114129_10025395 3300009147 Bacteria 8395
105 Ga0114129_10439486 3300009147 Bacteria 1713
106 Ga0105243_10008715 3300009148 Bacteria 7777
107 Ga0105241_10002480 3300009174 Bacteria 13867
108 Ga0105241_10012535 3300009174 Bacteria 6217
109 Ga0105241_10026845 3300009174 Bacteria 4286
110 Ga0105241_10046408 3300009174 Bacteria 3299
111 Ga0105241_10046960 3300009174 Unclassified 3281
112 Ga0105241_10104309 3300009174 Bacteria 2259
113 Ga0105241_10154050 3300009174 Bacteria 1883
114 Ga0105242_10005848 3300009176 Bacteria 9477
115 Ga0105242_10014751 3300009176 Bacteria 6052
116 Ga0105242_10016853 3300009176 Bacteria 5688
117 Ga0105248_10029459 3300009177 Bacteria 6123
118 Ga0105248_10144722 3300009177 Bacteria 2682
119 Ga0105248_10432216 3300009177 Unclassified 1483
120 Ga0105237_10002956 3300009545 Bacteria 20568
121 Ga0105237_10006497 3300009545 Bacteria 12956
122 Ga0105237_10008102 3300009545 Bacteria 11416
123 Ga0105237_10058142 3300009545 Bacteria 3870
124 Ga0105237_10069085 3300009545 Unclassified 3527
125 Ga0105237_10116022 3300009545 Bacteria 2671
126 Ga0105237_10329922 3300009545 Bacteria 1530
127 Ga0105238_10000444 3300009551 Bacteria 43442
128 Ga0105238_10001327 3300009551 Bacteria 24815
129 Ga0105238_10004104 3300009551 Bacteria 14450
130 Ga0105238_10028318 3300009551 Bacteria 5709
131 Ga0105238_10029192 3300009551 Bacteria 5620
132 Ga0105238_10031337 3300009551 Bacteria 5412
133 Ga0105249_10213454 3300009553 Unclassified 1895
134 Ga0105239_10001243 3300010375 Bacteria 34669
135 Ga0105239_10004799 3300010375 Bacteria 16045
136 Ga0105239_10006349 3300010375 Bacteria 13743
137 Ga0105239_10015800 3300010375 Bacteria 8355
138 Ga0105239_10054957 3300010375 Bacteria 4367
139 Ga0105246_10027790 3300011119 Bacteria 3711
140 Ga0105246_10029133 3300011119 Bacteria 3633
141 Ga0105246_10264573 3300011119 Unclassified 1372
142 Ga0157373_10223584 3300013100 Unclassified 1328
143 Ga0157370_10007329 3300013104 Bacteria 12040
144 Ga0157370_10008486 3300013104 Bacteria 11083
145 Ga0157370_10050928 3300013104 Bacteria 3956
146 Ga0157369_10000695 3300013105 Bacteria 43410
147 Ga0157369_10011842 3300013105 Bacteria 9909
148 Ga0157369_10092862 3300013105 Bacteria 3222
149 Ga0157369_10107604 3300013105 Bacteria 2966
150 Ga0157374_10013025 3300013296 Bacteria 7252
151 Ga0157374_10065024 3300013296 Bacteria 3424
152 Ga0157374_10112156 3300013296 Bacteria 2624
153 Ga0157374_10116315 3300013296 Unclassified 2576
154 Ga0157378_10001760 3300013297 Bacteria 19438
155 Ga0157372_10009180 3300013307 Bacteria 10511
156 Ga0157372_10036130 3300013307 Bacteria 5445
157 Ga0157372_10038963 3300013307 Bacteria 5246
158 Ga0157375_10005389 3300013308 Bacteria 11118
159 Ga0157375_10384153 3300013308 Unclassified 1571
160 Ga0163163_10012194 3300014325 Bacteria 7823
161 Ga0163163_10046201 3300014325 Bacteria 4277
162 Ga0163163_10088321 3300014325 Bacteria 3111
163 Ga0157379_10054910 3300014968 Unclassified 3559
164 Ga0224712_10021084 3300022467 Unclassified 2224
165 Ga0228598_1000060 3300024227 Bacteria 15974
166 Ga0207692_10032655 3300025898 Bacteria 2503
167 Ga0207654_10004899 3300025911 Bacteria 6775
168 Ga0207654_10016510 3300025911 Bacteria 3846
169 Ga0207654_10047818 3300025911 Bacteria 2445
170 Ga0207654_10088294 3300025911 Bacteria 1884
171 Ga0207707_10003820 3300025912 Bacteria 13341
172 Ga0207707_10011569 3300025912 Bacteria 7683
173 Ga0207707_10019217 3300025912 Bacteria 5963
174 Ga0207707_10042420 3300025912 Bacteria 3970
175 Ga0207695_10001123 3300025913 Bacteria 46509
176 Ga0207695_10009817 3300025913 Bacteria 11763
177 Ga0207695_10017849 3300025913 Bacteria 8226
178 Ga0207695_10031712 3300025913 Bacteria 5791
179 Ga0207695_10082555 3300025913 Unclassified 3248
180 Ga0207695_10130554 3300025913 Bacteria 2471
181 Ga0207695_10167751 3300025913 Unclassified 2123
182 Ga0207671_10006089 3300025914 Bacteria 10861
183 Ga0207671_10011092 3300025914 Bacteria 7371
184 Ga0207671_10011436 3300025914 Bacteria 7227
185 Ga0207693_10005034 3300025915 Bacteria 11094
186 Ga0207663_10091193 3300025916 Bacteria 2023
187 Ga0207663_10164621 3300025916 Bacteria 1569
188 Ga0207660_10081047 3300025917 Bacteria 2384
189 Ga0207660_10164813 3300025917 Unclassified 1712
190 Ga0207657_10014858 3300025919 Bacteria 7577
191 Ga0207657_10024702 3300025919 Bacteria 5556
192 Ga0207657_10056105 3300025919 Bacteria 3400
193 Ga0207652_10012831 3300025921 Bacteria 6775
194 Ga0207652_10014997 3300025921 Bacteria 6287
195 Ga0207694_10000170 3300025924 Bacteria 67254
196 Ga0207694_10010269 3300025924 Bacteria 7058
197 Ga0207694_10026394 3300025924 Bacteria 4418
198 Ga0207694_10027878 3300025924 Unclassified 4304
199 Ga0207694_10186664 3300025924 Bacteria 1683
200 Ga0207650_10015936 3300025925 Bacteria 5245
201 Ga0207687_10000292 3300025927 Bacteria 34405
202 Ga0207687_10000500 3300025927 Bacteria 26443
203 Ga0207687_10060531 3300025927 Bacteria 2671
204 Ga0207687_10113408 3300025927 Bacteria 2016
205 Ga0207700_10009685 3300025928 Bacteria 6034
206 Ga0207700_10036863 3300025928 Bacteria 3536
207 Ga0207700_10066330 3300025928 Unclassified 2759
208 Ga0207664_10024313 3300025929 Bacteria 4552
209 Ga0207690_10034745 3300025932 Bacteria 3250
210 Ga0207706_10012116 3300025933 Bacteria 7853
211 Ga0207686_10089117 3300025934 Bacteria 2033
212 Ga0207686_10139261 3300025934 Bacteria 1675
213 Ga0207709_10147543 3300025935 Unclassified 1625
214 Ga0207704_10041933 3300025938 Unclassified 2689
215 Ga0207704_10103875 3300025938 Bacteria 1902
216 Ga0207711_10301506 3300025941 Unclassified 1478
217 Ga0207689_10010186 3300025942 Bacteria 8100
218 Ga0207689_10115234 3300025942 Bacteria 2209
219 Ga0207661_10006618 3300025944 Bacteria 8187
220 Ga0207661_10019708 3300025944 Bacteria 5034
221 Ga0207679_10029259 3300025945 Bacteria 3834
222 Ga0207667_10000369 3300025949 Bacteria 60858
223 Ga0207667_10000650 3300025949 Bacteria 45011
224 Ga0207667_10010997 3300025949 Bacteria 10545
225 Ga0207667_10185542 3300025949 Unclassified 2135
226 Ga0207667_10221246 3300025949 Unclassified 1940
227 Ga0207651_10026969 3300025960 Bacteria 3600
228 Ga0207712_10005922 3300025961 Bacteria 7708
229 Ga0207658_10034575 3300025986 Bacteria 3613
230 Ga0207677_10030140 3300026023 Unclassified 3458
231 Ga0207639_10042488 3300026041 Unclassified 3407
232 Ga0207702_10053810 3300026078 Unclassified 3409
233 Ga0207702_10149097 3300026078 Bacteria 2126
234 Ga0207648_10010508 3300026089 Bacteria 8767
235 Ga0207648_10071049 3300026089 Bacteria 3034
236 Ga0207648_10130785 3300026089 Bacteria 2209
237 Ga0207648_10182459 3300026089 Unclassified 1858
238 Ga0207676_10010046 3300026095 Bacteria 6734
239 Ga0207674_10000484 3300026116 Bacteria 52530
240 Ga0207674_10017242 3300026116 Bacteria 7878
241 Ga0207674_10029935 3300026116 Bacteria 5728
242 Ga0207698_10016099 3300026142 Bacteria 5031
243 Ga0207428_10047275 3300027907 Bacteria 3455
244 Ga0268266_10010860 3300028379 Bacteria 7932
245 Ga0265338_10001894 3300028800 Bacteria 32749
246 Ga0265338_10028714 3300028800 Bacteria 5540
247 Ga0265770_1003769 3300030878 Bacteria 2061
248 Ga0265760_10001673 3300031090 Bacteria 6511
249 Ga0265325_10039004 3300031241 Bacteria 2504
250 Ga0265313_10007385 3300031595 Bacteria 7527
251 Ga0265314_10003911 3300031711 Bacteria 14153
252 Ga0265314_10012023 3300031711 Bacteria 7096
253 Ga0373934_0001839 3300035086 Bacteria 7803
254 Ga0373934_0020891 3300035086 Unclassified 2519
255 Ga0373953_0002652 3300035117 Bacteria 5423
256 Ga0373954_0001075 3300035118 Bacteria 10911
257 Ga0373954_0011397 3300035118 Bacteria 3940
258 Ga0373946_0017914 3300035171 Unclassified 2713
259 Ga0373927_0004508 3300035695 Bacteria 9741
260 Ga0373927_0056518 3300035695 Bacteria 2537
261 Ga0373927_0230100 3300035695 Unclassified 1218
262 Ga0373933_0004323 3300035724 Bacteria 7799
263 Ga0373933_0047862 3300035724 Bacteria 2544
264 Ga0373933_0052047 3300035724 Unclassified 2449
265 Ga0373947_0000290 3300035725 Bacteria 28281
266 Ga0373937_0006278 3300036401 Bacteria 10249
267 Ga0373937_0015160 3300036401 Bacteria 6810
268 Ga0373937_0025989 3300036401 Bacteria 5289
269 Ga0373937_0035885 3300036401 Bacteria 4516
270 Ga0373937_0075022 3300036401 Unclassified 3122
271 Ga0373937_0078293 3300036401 Bacteria 3055
272 Ga0373937_0101867 3300036401 Unclassified 2665
273 Ga0373925_0000289 3300037068 Bacteria 52497
274 Ga0373925_0010571 3300037068 Bacteria 6693
275 Ga0373925_0014683 3300037068 Bacteria 5658
276 Ga0436364_1370809 3300037853 Bacteria 5342
277 Ga0436365_0783990 3300039437 Bacteria 2268
278 Ga0495592_0085164 3300046454 Unclassified 2279
279 Ga0495651_0093787 3300046462 Unclassified 2247
280 Ga0495653_0070237 3300046463 Bacteria 2622
281 Ga0495580_0002288 3300046472 Bacteria 16711
282 Ga0495582_0008917 3300046473 Bacteria 5535
283 Ga0495639_0023807 3300046475 Bacteria 2693
284 Ga0495594_0022843 3300046499 Bacteria 3349
285 Ga0495665_0155398 3300046531 Unclassified 1193
286 Ga0495586_0068348 3300046535 Bacteria 1938
287 Ga0495587_0002147 3300046536 Bacteria 13187
288 Ga0495645_0123247 3300046543 Unclassified 1823
289 Ga0495634_0041408 3300046642 Bacteria 3128
290 Ga0495613_0024577 3300046689 Unclassified 4489
291 Ga0495613_0172370 3300046689 Unclassified 1535
292 Ga0495674_0036345 3300047319 Bacteria 4434
293 Ga0495684_0014429 3300047471 Bacteria 6079
294 Ga0495684_0117063 3300047471 Unclassified 2009
295 Ga0495602_0100728 3300048088 Unclassified 2371
296 Ga0496109_0173279 3300048912 Unclassified 2025
297 Ga0496112_0072808 3300048915 Bacteria 3397
298 nmdc:mga05p37_218992_c1 3300050507 Bacteria 2298
299 nmdc:mga0qj67_224127_c1 3300050509 Bacteria 1526
300 nmdc:mga06r32_22490_c1 3300050510 Bacteria 5829
301 nmdc:mga08y16_19213_c1 3300050511 Bacteria 7200
302 nmdc:mga0n895_102901_c1 3300050512 Unclassified 2867
303 nmdc:mga0a205_230774_c1 3300050515 Bacteria 1734
304 Ga0070699_100184494
305 MRS1b_contig_3469666
306 JGI24751J29686_10002808
307 Ga0065712_10076546
308 Ga0065715_10010671
309 Ga0070676_10021379
310 Ga0070683_100000668
311 Ga0070683_100132639
312 Ga0070690_100065401
313 Ga0070670_100007431
314 Ga0068869_100043812
315 Ga0070666_10040296
316 Ga0070680_100028982
317 Ga0070680_100059713
318 Ga0070682_100049426
319 Ga0068868_100079752
320 Ga0070660_100015293
321 Ga0070660_100047400
322 Ga0070660_100079121
323 Ga0070689_100097290
324 Ga0070691_10002000
325 Ga0070661_100026511
326 Ga0070692_10050435
327 Ga0070671_100182215
328 Ga0070673_100016978
329 Ga0070709_10052878
330 Ga0070714_100103423
331 Ga0070713_100028744
332 Ga0070713_100046681
333 Ga0070708_100088318
334 Ga0070681_10001877
335 Ga0070681_10010272
336 Ga0070681_10059645
337 Ga0070681_10090404
338 Ga0068867_100107658
339 Ga0070706_100188291
340 Ga0070698_100007777
341 Ga0070679_100006935
342 Ga0070679_100015277
343 Ga0070684_100000386
344 Ga0070684_100031792
345 Ga0070684_100043688
346 Ga0070684_100222112
347 Ga0070697_100160799
348 Ga0068853_100200490
349 Ga0070665_100018594
350 Ga0070704_100095437
351 Ga0068855_100006699
352 Ga0068855_100007262
353 Ga0068855_100012755
354 Ga0068855_100067402
355 Ga0068855_100227196
356 Ga0068855_100268892
357 Ga0068857_100001338
358 Ga0068857_100057389
359 Ga0068857_100075168
360 Ga0068854_100062172
361 Ga0068856_100001575
362 Ga0068856_100033052
363 Ga0068856_100079280
364 Ga0068856_100117350
365 Ga0068856_100191099
366 Ga0068856_100246430
367 Ga0068852_100003894
368 Ga0068852_100053427
369 Ga0068859_100010046
370 Ga0068859_100035411
371 Ga0068864_100028992
372 Ga0068851_10097946
373 Ga0068858_100070452
374 Ga0068858_100119511
375 Ga0068860_100200660
376 Ga0070717_10020841
377 Ga0070712_100076499
378 Ga0097621_100013642
379 Ga0097621_100060637
380 Ga0097621_100282854
381 Ga0068871_100007567
382 Ga0068871_100044267
383 Ga0068871_100070732
384 Ga0068871_100282063
385 Ga0075430_100104142
386 Ga0075431_100044966
387 Ga0075433_10089819
388 Ga0075433_10215500
389 Ga0075434_100130398
390 Ga0068865_100009187
391 Ga0068865_100037720
392 Ga0097620_100010046
393 Ga0097620_100035411
394 Ga0105240_10000429
395 Ga0105240_10000476
396 Ga0105240_10005652
397 Ga0105240_10006790
398 Ga0105240_10114711
399 Ga0105240_10126558
400 Ga0105240_10132506
401 Ga0111539_10033382
402 Ga0105245_10000396
403 Ga0105245_10082224
404 Ga0105245_10167526
405 Ga0105245_10199929
406 Ga0105247_10097355
407 Ga0114129_10025395
408 Ga0114129_10439486
409 Ga0105243_10008715
410 Ga0105241_10002480
411 Ga0105241_10012535
412 Ga0105241_10026845
413 Ga0105241_10046408
414 Ga0105241_10046960
415 Ga0105241_10104309
416 Ga0105241_10154050
417 Ga0105242_10005848
418 Ga0105242_10014751
419 Ga0105242_10016853
420 Ga0105248_10029459
421 Ga0105248_10144722
422 Ga0105248_10432216
423 Ga0105237_10002956
424 Ga0105237_10006497
425 Ga0105237_10008102
426 Ga0105237_10058142
427 Ga0105237_10069085
428 Ga0105237_10116022
429 Ga0105237_10329922
430 Ga0105238_10000444
431 Ga0105238_10001327
432 Ga0105238_10004104
433 Ga0105238_10028318
434 Ga0105238_10029192
435 Ga0105238_10031337
436 Ga0105249_10213454
437 Ga0105239_10001243
438 Ga0105239_10004799
439 Ga0105239_10006349
440 Ga0105239_10015800
441 Ga0105239_10054957
442 Ga0105246_10027790
443 Ga0105246_10029133
444 Ga0105246_10264573
445 Ga0157373_10223584
446 Ga0157370_10007329
447 Ga0157370_10008486
448 Ga0157370_10050928
449 Ga0157369_10000695
450 Ga0157369_10011842
451 Ga0157369_10092862
452 Ga0157369_10107604
453 Ga0157374_10013025
454 Ga0157374_10065024
455 Ga0157374_10112156
456 Ga0157374_10116315
457 Ga0157378_10001760
458 Ga0157372_10009180
459 Ga0157372_10036130
460 Ga0157372_10038963
461 Ga0157375_10005389
462 Ga0157375_10384153
463 Ga0163163_10012194
464 Ga0163163_10046201
465 Ga0163163_10088321
466 Ga0157379_10054910
467 Ga0224712_10021084
468 Ga0228598_1000060
469 Ga0207692_10032655
470 Ga0207654_10004899
471 Ga0207654_10016510
472 Ga0207654_10047818
473 Ga0207654_10088294
474 Ga0207707_10003820
475 Ga0207707_10011569
476 Ga0207707_10019217
477 Ga0207707_10042420
478 Ga0207695_10001123
479 Ga0207695_10009817
480 Ga0207695_10017849
481 Ga0207695_10031712
482 Ga0207695_10082555
483 Ga0207695_10130554
484 Ga0207695_10167751
485 Ga0207671_10006089
486 Ga0207671_10011092
487 Ga0207671_10011436
488 Ga0207693_10005034
489 Ga0207663_10091193
490 Ga0207663_10164621
491 Ga0207660_10081047
492 Ga0207660_10164813
493 Ga0207657_10014858
494 Ga0207657_10024702
495 Ga0207657_10056105
496 Ga0207652_10012831
497 Ga0207652_10014997
498 Ga0207694_10000170
499 Ga0207694_10010269
500 Ga0207694_10026394
501 Ga0207694_10027878
502 Ga0207694_10186664
503 Ga0207650_10015936
504 Ga0207687_10000292
505 Ga0207687_10000500
506 Ga0207687_10060531
507 Ga0207687_10113408
508 Ga0207700_10009685
509 Ga0207700_10036863
510 Ga0207700_10066330
511 Ga0207664_10024313
512 Ga0207690_10034745
513 Ga0207706_10012116
514 Ga0207686_10089117
515 Ga0207686_10139261
516 Ga0207709_10147543
517 Ga0207704_10041933
518 Ga0207704_10103875
519 Ga0207711_10301506
520 Ga0207689_10010186
521 Ga0207689_10115234
522 Ga0207661_10006618
523 Ga0207661_10019708
524 Ga0207679_10029259
525 Ga0207667_10000369
526 Ga0207667_10000650
527 Ga0207667_10010997
528 Ga0207667_10185542
529 Ga0207667_10221246
530 Ga0207651_10026969
531 Ga0207712_10005922
532 Ga0207658_10034575
533 Ga0207677_10030140
534 Ga0207639_10042488
535 Ga0207702_10053810
536 Ga0207702_10149097
537 Ga0207648_10010508
538 Ga0207648_10071049
539 Ga0207648_10130785
540 Ga0207648_10182459
541 Ga0207676_10010046
542 Ga0207674_10000484
543 Ga0207674_10017242
544 Ga0207674_10029935
545 Ga0207698_10016099
546 Ga0207428_10047275
547 Ga0268266_10010860
548 Ga0265338_10001894
549 Ga0265338_10028714
550 Ga0265770_1003769
551 Ga0265760_10001673
552 Ga0265325_10039004
553 Ga0265313_10007385
554 Ga0265314_10003911
555 Ga0265314_10012023
556 Ga0373934_0001839
557 Ga0373934_0020891
558 Ga0373953_0002652
559 Ga0373954_0001075
560 Ga0373954_0011397
561 Ga0373946_0017914
562 Ga0373927_0004508
563 Ga0373927_0056518
564 Ga0373927_0230100
565 Ga0373933_0004323
566 Ga0373933_0047862
567 Ga0373933_0052047
568 Ga0373947_0000290
569 Ga0373937_0006278
570 Ga0373937_0015160
571 Ga0373937_0025989
572 Ga0373937_0035885
573 Ga0373937_0075022
574 Ga0373937_0078293
575 Ga0373937_0101867
576 Ga0373925_0000289
577 Ga0373925_0010571
578 Ga0373925_0014683
579 Ga0436364_1370809
580 Ga0436365_0783990
581 Ga0495592_0085164
582 Ga0495651_0093787
583 Ga0495653_0070237
584 Ga0495580_0002288
585 Ga0495582_0008917
586 Ga0495639_0023807
587 Ga0495594_0022843
588 Ga0495665_0155398
589 Ga0495586_0068348
590 Ga0495587_0002147
591 Ga0495645_0123247
592 Ga0495634_0041408
593 Ga0495613_0024577
594 Ga0495613_0172370
595 Ga0495674_0036345
596 Ga0495684_0014429
597 Ga0495684_0117063
598 Ga0495602_0100728
599 Ga0496109_0173279
600 Ga0496112_0072808
601 nmdc:mga05p37_218992_c1
602 nmdc:mga0qj67_224127_c1
603 nmdc:mga06r32_22490_c1
604 nmdc:mga08y16_19213_c1
605 nmdc:mga0n895_102901_c1
606 nmdc:mga0a205_230774_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00882

Zn_dep_PLPC

Zinc dependent phospholipase C

59

240

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5gou-assembly1.cif.gz_N structure of a 16-mer protein nanocage fabricated from its 24-mer analogue by subunit interface redesign 0.3726 271 370
2za8-assembly1.cif.gz_A recombinant horse l-chain apoferritin n-terminal deletion mutant (residues 1-8) 0.3288 271 367
4v6b-assembly6.cif.gz_Cl crystal structure of human ferritin phe167serfsx26 mutant. 0.3261 271 368
4v6b-assembly3.cif.gz_BC crystal structure of human ferritin phe167serfsx26 mutant. 0.3257 271 368
5hi7-assembly1.cif.gz_A co-crystal structure of human smyd3 with an aza-sah compound 0.2638 159 367
ID Description Score Start End Superfamily
5gouJ00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.3654 271 370 1.20.1260.10
af_D4A7Q9_149_349_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.3002 127 370 1.25.40.10
af_Q9BZJ0_633_812_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.2941 226 364 1.25.40.10
af_Q9HDV4_110_214_1.10.150.60 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;ARID DNA-binding domain 0.2755 283 367 1.10.150.60
af_D4A7Q9_149_349_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.2691 127 370 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A838TRU8-F1-model_v4 Zinc dependent phospholipase C family protein 0.9771 2 177
AF-A0A4Q5Y914-F1-model_v4 deleted 0.9617 2 200
AF-A0A2V9H952-F1-model_v4 Phospholipase C/D domain-containing protein 0.9463 2 165
AF-A0A2V8USC5-F1-model_v4 Phospholipase C/D domain-containing protein 0.946 2 162
AF-A0A2V8U9G8-F1-model_v4 Phospholipase C/D domain-containing protein 0.9453 2 146

Map