F396397

General Info

Members Datasets Scaffolds Average Seq Length
302 181 604 358

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_100030837|Ga0068863_1000308371
Length 357
Sequence MNTNFFRMALLLIVVASGSQLMAQVQTDVPAAVPGAKPVPVERIKIHGKVLEGNLEGNAVDRDVLVFLPPSYGKDKSRHYPVVYALHGYSIGAEQWAHEIHLPQTIEGAFAQGGKEMIIVLPDSKTVHNGSMYSSSVTTGDFEQFIAHDLVTEIDNRYPTIPNRQGRGLVGHSMGGYGATRIGMKHSDIFGSLYIMSPCCLSPRTLPPDPEIARALEAVKTPADSAKLPFFTRAPLATAAAWSPDPKNPPLYLDLPTKDGVAQPDVLARWTANSPLAFMDQYIGELRMYHGISIDVGDQDGLRADASKLHDALDRYGIANSFQVYLGTHTSKVADRFQNNVLKFFSDNLCFQTKGCR

Samples

Sample ID Description Type Environment
1 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
118 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
120 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
121 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
122 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
123 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
124 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
125 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
126 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
127 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
128 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
133 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
134 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
135 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
136 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
137 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
138 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
139 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
140 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
141 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
142 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
143 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
144 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
145 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
146 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
147 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
148 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
149 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
150 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
151 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
152 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
153 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
154 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
155 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
156 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
157 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
158 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
159 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
160 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
161 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
162 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
163 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
164 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
175 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
178 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
179 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
180 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
181 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0.33
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.63
Rhizosphere 92.72
Stem 0
Stem Tuber 0
Unclassified 9.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068863_100030837 3300005841 Bacteria 5121
2 Ga0065712_10119056 3300005290 Bacteria 1693
3 Ga0070658_10052201 3300005327 Bacteria 3315
4 Ga0070658_10123762 3300005327 Bacteria 2151
5 Ga0070676_10050251 3300005328 Bacteria 2444
6 Ga0070683_100034712 3300005329 Bacteria 4609
7 Ga0070683_100061432 3300005329 Bacteria 3494
8 Ga0070683_100083670 3300005329 Bacteria 2989
9 Ga0068869_100002998 3300005334 Bacteria 10260
10 Ga0068869_100111030 3300005334 Bacteria 2086
11 Ga0070661_100010755 3300005344 Bacteria 6371
12 Ga0070661_100266400 3300005344 Bacteria 1326
13 Ga0070669_100058940 3300005353 Bacteria 2819
14 Ga0070671_100005636 3300005355 Bacteria 9964
15 Ga0070671_100016543 3300005355 Bacteria 5963
16 Ga0070671_100396882 3300005355 Bacteria 1180
17 Ga0070673_100078831 3300005364 Bacteria 2665
18 Ga0070659_100040192 3300005366 Bacteria 3654
19 Ga0070667_100268055 3300005367 Unclassified 1530
20 Ga0070710_10055126 3300005437 Unclassified 2245
21 Ga0070701_10148321 3300005438 Unclassified 1348
22 Ga0070711_100134745 3300005439 Unclassified 1844
23 Ga0070694_100150235 3300005444 Bacteria 1700
24 Ga0070662_100086550 3300005457 Bacteria 2344
25 Ga0070681_10011166 3300005458 Bacteria 8888
26 Ga0070681_10239921 3300005458 Unclassified 1726
27 Ga0068867_100237786 3300005459 Bacteria 1475
28 Ga0070707_100347839 3300005468 Unclassified 1440
29 Ga0070698_100262741 3300005471 Unclassified 1658
30 Ga0070699_100039112 3300005518 Bacteria 4107
31 Ga0070699_100348175 3300005518 Unclassified 1334
32 Ga0070679_100017965 3300005530 Bacteria 6854
33 Ga0070679_100057731 3300005530 Bacteria 3868
34 Ga0070679_100063479 3300005530 Bacteria 3681
35 Ga0070684_100061387 3300005535 Bacteria 3290
36 Ga0068853_100113482 3300005539 Bacteria 2409
37 Ga0068853_100203797 3300005539 Bacteria 1801
38 Ga0068853_100352122 3300005539 Bacteria 1370
39 Ga0070672_100004455 3300005543 Bacteria 9169
40 Ga0070695_100007938 3300005545 Bacteria 6284
41 Ga0070693_100013435 3300005547 Bacteria 4170
42 Ga0070693_100016040 3300005547 Bacteria 3870
43 Ga0070665_100006431 3300005548 Bacteria 11957
44 Ga0070665_100303022 3300005548 Bacteria 1601
45 Ga0068855_100000689 3300005563 Bacteria 41254
46 Ga0068855_100011520 3300005563 Bacteria 10687
47 Ga0068855_100039464 3300005563 Bacteria 5605
48 Ga0068855_100141408 3300005563 Bacteria 2743
49 Ga0070664_100044080 3300005564 Bacteria 3766
50 Ga0070664_100226034 3300005564 Bacteria 1676
51 Ga0068857_100027257 3300005577 Bacteria 5039
52 Ga0068857_100078786 3300005577 Bacteria 2941
53 Ga0068857_100141249 3300005577 Bacteria 2177
54 Ga0068854_100196315 3300005578 Bacteria 1584
55 Ga0068856_100000026 3300005614 Bacteria 135674
56 Ga0068856_100044799 3300005614 Bacteria 4354
57 Ga0070702_100294082 3300005615 Unclassified 1120
58 Ga0068852_100143048 3300005616 Bacteria 2215
59 Ga0068852_100204282 3300005616 Bacteria 1871
60 Ga0068859_100002046 3300005617 Bacteria 20602
61 Ga0068859_100166075 3300005617 Bacteria 2287
62 Ga0068864_100086633 3300005618 Bacteria 2756
63 Ga0068864_100151745 3300005618 Bacteria 2099
64 Ga0068861_100054845 3300005719 Bacteria 3038
65 Ga0068858_100001591 3300005842 Bacteria 23143
66 Ga0068858_100366840 3300005842 Bacteria 1380
67 Ga0068860_100002925 3300005843 Bacteria 17677
68 Ga0068860_100015780 3300005843 Bacteria 7375
69 Ga0068862_100349124 3300005844 Bacteria 1372
70 Ga0070717_10007957 3300006028 Bacteria 7896
71 Ga0070717_10008828 3300006028 Bacteria 7548
72 Ga0070716_100050043 3300006173 Unclassified 2370
73 Ga0070712_100071617 3300006175 Unclassified 2481
74 Ga0097621_100000088 3300006237 Bacteria 49698
75 Ga0097621_100000336 3300006237 Bacteria 32019
76 Ga0097621_100122348 3300006237 Bacteria 2208
77 Ga0068871_100002067 3300006358 Bacteria 13609
78 Ga0068871_100012936 3300006358 Bacteria 6180
79 Ga0075433_10043282 3300006852 Bacteria 3907
80 Ga0075434_100299306 3300006871 Bacteria 1629
81 Ga0068865_100003246 3300006881 Bacteria 9738
82 Ga0075436_100012972 3300006914 Bacteria 5712
83 Ga0075436_100023813 3300006914 Bacteria 4207
84 Ga0097620_100002046 3300006931 Bacteria 20602
85 Ga0097620_100166078 3300006931 Bacteria 2287
86 Ga0105240_10000791 3300009093 Bacteria 57291
87 Ga0105240_10028221 3300009093 Bacteria 7334
88 Ga0105240_10119817 3300009093 Bacteria 3169
89 Ga0105240_10270594 3300009093 Bacteria 1956
90 Ga0105245_10091110 3300009098 Bacteria 2805
91 Ga0105243_10013016 3300009148 Bacteria 6285
92 Ga0105243_10046349 3300009148 Bacteria 3419
93 Ga0105241_10284671 3300009174 Bacteria 1413
94 Ga0105248_10019826 3300009177 Bacteria 7447
95 Ga0105248_10105119 3300009177 Bacteria 3183
96 Ga0105248_10122907 3300009177 Bacteria 2928
97 Ga0105248_10175290 3300009177 Bacteria 2417
98 Ga0105237_10010871 3300009545 Bacteria 9657
99 Ga0105237_10010975 3300009545 Bacteria 9613
100 Ga0105237_10089681 3300009545 Bacteria 3064
101 Ga0105237_10356216 3300009545 Bacteria 1468
102 Ga0105238_10000166 3300009551 Bacteria 71556
103 Ga0105238_10010421 3300009551 Bacteria 9331
104 Ga0105249_10051544 3300009553 Bacteria 3754
105 Ga0105249_10142303 3300009553 Bacteria 2301
106 Ga0105239_10197440 3300010375 Unclassified 2253
107 Ga0105246_10160953 3300011119 Bacteria 1710
108 Ga0157373_10037028 3300013100 Bacteria 3500
109 Ga0157373_10216945 3300013100 Bacteria 1349
110 Ga0157370_10023931 3300013104 Bacteria 6056
111 Ga0157369_10000448 3300013105 Bacteria 54647
112 Ga0157369_10038001 3300013105 Bacteria 5266
113 Ga0157374_10001658 3300013296 Bacteria 18633
114 Ga0157374_10007083 3300013296 Bacteria 9547
115 Ga0157374_10056920 3300013296 Bacteria 3651
116 Ga0157378_10004888 3300013297 Bacteria 11749
117 Ga0157378_10008207 3300013297 Bacteria 9103
118 Ga0157378_10019458 3300013297 Bacteria 5968
119 Ga0157378_10037802 3300013297 Bacteria 4277
120 Ga0157378_10056841 3300013297 Bacteria 3487
121 Ga0163162_10008213 3300013306 Bacteria 10186
122 Ga0163162_10042984 3300013306 Bacteria 4523
123 Ga0163162_10079775 3300013306 Bacteria 3339
124 Ga0163162_10479267 3300013306 Bacteria 1376
125 Ga0157372_10001992 3300013307 Bacteria 22184
126 Ga0157372_10005136 3300013307 Bacteria 13915
127 Ga0157372_10056132 3300013307 Bacteria 4401
128 Ga0157372_10125784 3300013307 Bacteria 2947
129 Ga0157372_10263542 3300013307 Bacteria 2001
130 Ga0157372_10338616 3300013307 Bacteria 1752
131 Ga0157372_10365094 3300013307 Bacteria 1682
132 Ga0157375_10114577 3300013308 Bacteria 2798
133 Ga0163163_10037795 3300014325 Bacteria 4698
134 Ga0163163_10117360 3300014325 Bacteria 2693
135 Ga0163163_10256809 3300014325 Bacteria 1798
136 Ga0163163_10282550 3300014325 Bacteria 1711
137 Ga0157379_10028475 3300014968 Plasmid 4968
138 Ga0157376_10000058 3300014969 Bacteria 97710
139 Ga0157376_10084236 3300014969 Bacteria 2737
140 Ga0157376_10331795 3300014969 Bacteria 1449
141 Ga0207647_10005190 3300025904 Bacteria 9583
142 Ga0207647_10027678 3300025904 Bacteria 3693
143 Ga0207699_10077342 3300025906 Bacteria 2053
144 Ga0207705_10028072 3300025909 Bacteria 4012
145 Ga0207705_10078797 3300025909 Bacteria 2398
146 Ga0207684_10133316 3300025910 Bacteria 2132
147 Ga0207654_10059329 3300025911 Bacteria 2231
148 Ga0207707_10000340 3300025912 Bacteria 49383
149 Ga0207707_10017223 3300025912 Bacteria 6297
150 Ga0207695_10009255 3300025913 Bacteria 12203
151 Ga0207695_10051591 3300025913 Bacteria 4317
152 Ga0207671_10026044 3300025914 Unclassified 4387
153 Ga0207671_10174992 3300025914 Unclassified 1668
154 Ga0207663_10172307 3300025916 Bacteria 1538
155 Ga0207660_10012136 3300025917 Bacteria 5631
156 Ga0207660_10081883 3300025917 Bacteria 2373
157 Ga0207657_10071774 3300025919 Bacteria 2931
158 Ga0207649_10068895 3300025920 Bacteria 2251
159 Ga0207652_10002962 3300025921 Bacteria 14198
160 Ga0207652_10011387 3300025921 Bacteria 7168
161 Ga0207652_10110201 3300025921 Bacteria 2441
162 Ga0207694_10000664 3300025924 Bacteria 30889
163 Ga0207650_10076131 3300025925 Bacteria 2534
164 Ga0207650_10215576 3300025925 Unclassified 1543
165 Ga0207659_10035297 3300025926 Bacteria 3455
166 Ga0207659_10209498 3300025926 Bacteria 1561
167 Ga0207700_10037849 3300025928 Bacteria 3497
168 Ga0207644_10020641 3300025931 Unclassified 4483
169 Ga0207644_10046758 3300025931 Bacteria 3085
170 Ga0207644_10107018 3300025931 Bacteria 2109
171 Ga0207686_10066544 3300025934 Bacteria 2301
172 Ga0207670_10230277 3300025936 Bacteria 1423
173 Ga0207669_10007337 3300025937 Bacteria 5091
174 Ga0207704_10150751 3300025938 Bacteria 1640
175 Ga0207691_10008018 3300025940 Bacteria 10151
176 Ga0207691_10024198 3300025940 Bacteria 5711
177 Ga0207691_10043514 3300025940 Bacteria 4138
178 Ga0207691_10288076 3300025940 Bacteria 1413
179 Ga0207689_10006560 3300025942 Bacteria 10263
180 Ga0207689_10014649 3300025942 Bacteria 6662
181 Ga0207689_10023301 3300025942 Bacteria 5198
182 Ga0207689_10026110 3300025942 Bacteria 4891
183 Ga0207689_10280951 3300025942 Bacteria 1379
184 Ga0207661_10017869 3300025944 Bacteria 5258
185 Ga0207661_10043863 3300025944 Bacteria 3531
186 Ga0207679_10064265 3300025945 Bacteria 2742
187 Ga0207667_10000875 3300025949 Bacteria 38471
188 Ga0207667_10128913 3300025949 Bacteria 2605
189 Ga0207667_10237366 3300025949 Bacteria 1866
190 Ga0207668_10103416 3300025972 Bacteria 2121
191 Ga0207658_10234809 3300025986 Unclassified 1550
192 Ga0207703_10158801 3300026035 Bacteria 1978
193 Ga0207639_10023791 3300026041 Bacteria 4425
194 Ga0207639_10283523 3300026041 Unclassified 1458
195 Ga0207708_10005771 3300026075 Bacteria 9149
196 Ga0207702_10002553 3300026078 Bacteria 17141
197 Ga0207702_10005015 3300026078 Bacteria 11633
198 Ga0207702_10054843 3300026078 Bacteria 3379
199 Ga0207641_10011712 3300026088 Bacteria 7203
200 Ga0207641_10051979 3300026088 Bacteria 3469
201 Ga0207641_10063417 3300026088 Bacteria 3157
202 Ga0207641_10100599 3300026088 Unclassified 2546
203 Ga0207641_10233905 3300026088 Bacteria 1709
204 Ga0207641_10253781 3300026088 Bacteria 1643
205 Ga0207648_10021759 3300026089 Bacteria 5761
206 Ga0207676_10086004 3300026095 Bacteria 2567
207 Ga0207674_10020292 3300026116 Bacteria 7183
208 Ga0207674_10039142 3300026116 Bacteria 4917
209 Ga0207674_10162736 3300026116 Bacteria 2186
210 Ga0207675_100005004 3300026118 Bacteria 12761
211 Ga0207675_100496504 3300026118 Bacteria 1214
212 Ga0207698_10056761 3300026142 Bacteria 3025
213 Ga0207698_10105746 3300026142 Bacteria 2346
214 Ga0265357_1000382 3300028023 Bacteria 2477
215 Ga0268266_10000141 3300028379 Bacteria 138510
216 Ga0268266_10106514 3300028379 Bacteria 2478
217 Ga0268266_10216361 3300028379 Bacteria 1759
218 Ga0268265_10492925 3300028380 Bacteria 1153
219 Ga0268264_10013999 3300028381 Bacteria 6595
220 Ga0265338_10021624 3300028800 Bacteria 6698
221 Ga0265770_1000068 3300030878 Bacteria 11296
222 Ga0265339_10039614 3300031249 Bacteria 2623
223 Ga0265316_10180905 3300031344 Bacteria 1570
224 Ga0307411_10133098 3300032005 Bacteria 1821
225 Ga0373926_0010566 3300035083 Bacteria 3095
226 Ga0373944_0032542 3300035089 Bacteria 1576
227 Ga0373954_0141459 3300035118 Bacteria 1174
228 Ga0373943_0044072 3300035170 Unclassified 2170
229 Ga0373927_0019414 3300035695 Bacteria 4457
230 Ga0373927_0032025 3300035695 Unclassified 3425
231 Ga0373933_0200741 3300035724 Bacteria 1276
232 Ga0373947_0017713 3300035725 Bacteria 4098
233 Ga0373937_0010803 3300036401 Bacteria 7993
234 Ga0373937_0018164 3300036401 Bacteria 6275
235 Ga0373925_0002899 3300037068 Bacteria 13548
236 Ga0373925_0158330 3300037068 Bacteria 1782
237 Ga0395898_0291480 3300037466 Bacteria 1557
238 Ga0436364_0589402 3300037853 Bacteria 2122
239 Ga0436364_1326343 3300037853 Bacteria 1388
240 Ga0436363_0909847 3300039450 Bacteria 3503
241 Ga0436362_0469393 3300039453 Bacteria 2123
242 Ga0439458_0008679 3300042157 Bacteria 2265
243 Ga0466963_0004103 3300044694 Bacteria 8424
244 Ga0495603_0024974 3300046455 Bacteria 3614
245 Ga0495629_0027264 3300046459 Bacteria 4057
246 Ga0495580_0015803 3300046472 Bacteria 5685
247 Ga0495580_0102849 3300046472 Unclassified 1986
248 Ga0495582_0010015 3300046473 Bacteria 5217
249 Ga0495639_0048731 3300046475 Bacteria 1922
250 Ga0495594_0015209 3300046499 Bacteria 4041
251 Ga0495628_0151001 3300046516 Bacteria 1770
252 Ga0495630_0009762 3300046517 Bacteria 6906
253 Ga0495666_0021286 3300046526 Bacteria 3210
254 Ga0495586_0131135 3300046535 Bacteria 1403
255 Ga0495621_0019204 3300046539 Bacteria 2230
256 Ga0495634_0009810 3300046642 Bacteria 7047
257 Ga0495657_0040675 3300046675 Bacteria 3187
258 Ga0495599_0208677 3300046678 Bacteria 1198
259 Ga0495647_0004873 3300046681 Bacteria 4388
260 Ga0495658_0022565 3300046683 Bacteria 3329
261 Ga0495613_0036834 3300046689 Unclassified 3627
262 Ga0495624_0038254 3300046690 Unclassified 3083
263 Ga0495589_0065971 3300046794 Bacteria 1774
264 Ga0495581_0021579 3300047315 Bacteria 3731
265 Ga0495604_0267661 3300047317 Bacteria 1159
266 Ga0495674_0033097 3300047319 Bacteria 4685
267 Ga0495676_0056366 3300047321 Bacteria 3108
268 Ga0495680_0034129 3300047322 Bacteria 4114
269 Ga0495675_0027697 3300047444 Bacteria 3612
270 Ga0495675_0219133 3300047444 Bacteria 1152
271 Ga0495684_0075049 3300047471 Bacteria 2569
272 Ga0495602_0096048 3300048088 Bacteria 2445
273 Ga0495602_0114020 3300048088 Bacteria 2190
274 Ga0495614_0048834 3300048089 Bacteria 1814
275 Ga0496102_0167215 3300048905 Bacteria 2070
276 Ga0496102_0202503 3300048905 Bacteria 1871
277 Ga0496104_0077036 3300048907 Bacteria 3177
278 Ga0496104_0139482 3300048907 Bacteria 2330
279 Ga0496106_0119552 3300048909 Bacteria 2058
280 Ga0496107_0033736 3300048910 Unclassified 3664
281 Ga0496108_0135316 3300048911 Bacteria 2120
282 Ga0496108_0260279 3300048911 Bacteria 1510
283 Ga0496109_0197701 3300048912 Bacteria 1890
284 Ga0496112_0000573 3300048915 Bacteria 25312
285 Ga0496112_0004549 3300048915 Bacteria 11782
286 Ga0496112_0004563 3300048915 Bacteria 11771
287 Ga0496112_0045226 3300048915 Bacteria 4316
288 Ga0496112_0542068 3300048915 Bacteria 1098
289 Ga0496113_0022405 3300048916 Bacteria 4468
290 Ga0496115_0017697 3300048918 Bacteria 5455
291 Ga0496115_0053694 3300048918 Bacteria 3234
292 Ga0496126_0002267 3300048929 Bacteria 26510
293 Ga0496126_0030909 3300048929 Bacteria 5067
294 Ga0501036_0379384 3300049572 Unclassified 1180
295 nmdc:mga05p37_440981_c1 3300050507 Bacteria 1510
296 nmdc:mga06r32_161432_c1 3300050510 Bacteria 2223
297 nmdc:mga0n895_141866_c1 3300050512 Unclassified 2431
298 nmdc:mga0n895_303881_c1 3300050512 Bacteria 1617
299 nmdc:mga0rr50_183739_c1 3300050513 Unclassified 1710
300 nmdc:mga08x19_11410_c1 3300050514 Bacteria 5349
301 nmdc:mga08x19_238_c1 3300050514 Bacteria 42057
302 Ga0495601_0046332 3300053077 Bacteria 2737
303 Ga0068863_100030837
304 Ga0065712_10119056
305 Ga0070658_10052201
306 Ga0070658_10123762
307 Ga0070676_10050251
308 Ga0070683_100034712
309 Ga0070683_100061432
310 Ga0070683_100083670
311 Ga0068869_100002998
312 Ga0068869_100111030
313 Ga0070661_100010755
314 Ga0070661_100266400
315 Ga0070669_100058940
316 Ga0070671_100005636
317 Ga0070671_100016543
318 Ga0070671_100396882
319 Ga0070673_100078831
320 Ga0070659_100040192
321 Ga0070667_100268055
322 Ga0070710_10055126
323 Ga0070701_10148321
324 Ga0070711_100134745
325 Ga0070694_100150235
326 Ga0070662_100086550
327 Ga0070681_10011166
328 Ga0070681_10239921
329 Ga0068867_100237786
330 Ga0070707_100347839
331 Ga0070698_100262741
332 Ga0070699_100039112
333 Ga0070699_100348175
334 Ga0070679_100017965
335 Ga0070679_100057731
336 Ga0070679_100063479
337 Ga0070684_100061387
338 Ga0068853_100113482
339 Ga0068853_100203797
340 Ga0068853_100352122
341 Ga0070672_100004455
342 Ga0070695_100007938
343 Ga0070693_100013435
344 Ga0070693_100016040
345 Ga0070665_100006431
346 Ga0070665_100303022
347 Ga0068855_100000689
348 Ga0068855_100011520
349 Ga0068855_100039464
350 Ga0068855_100141408
351 Ga0070664_100044080
352 Ga0070664_100226034
353 Ga0068857_100027257
354 Ga0068857_100078786
355 Ga0068857_100141249
356 Ga0068854_100196315
357 Ga0068856_100000026
358 Ga0068856_100044799
359 Ga0070702_100294082
360 Ga0068852_100143048
361 Ga0068852_100204282
362 Ga0068859_100002046
363 Ga0068859_100166075
364 Ga0068864_100086633
365 Ga0068864_100151745
366 Ga0068861_100054845
367 Ga0068858_100001591
368 Ga0068858_100366840
369 Ga0068860_100002925
370 Ga0068860_100015780
371 Ga0068862_100349124
372 Ga0070717_10007957
373 Ga0070717_10008828
374 Ga0070716_100050043
375 Ga0070712_100071617
376 Ga0097621_100000088
377 Ga0097621_100000336
378 Ga0097621_100122348
379 Ga0068871_100002067
380 Ga0068871_100012936
381 Ga0075433_10043282
382 Ga0075434_100299306
383 Ga0068865_100003246
384 Ga0075436_100012972
385 Ga0075436_100023813
386 Ga0097620_100002046
387 Ga0097620_100166078
388 Ga0105240_10000791
389 Ga0105240_10028221
390 Ga0105240_10119817
391 Ga0105240_10270594
392 Ga0105245_10091110
393 Ga0105243_10013016
394 Ga0105243_10046349
395 Ga0105241_10284671
396 Ga0105248_10019826
397 Ga0105248_10105119
398 Ga0105248_10122907
399 Ga0105248_10175290
400 Ga0105237_10010871
401 Ga0105237_10010975
402 Ga0105237_10089681
403 Ga0105237_10356216
404 Ga0105238_10000166
405 Ga0105238_10010421
406 Ga0105249_10051544
407 Ga0105249_10142303
408 Ga0105239_10197440
409 Ga0105246_10160953
410 Ga0157373_10037028
411 Ga0157373_10216945
412 Ga0157370_10023931
413 Ga0157369_10000448
414 Ga0157369_10038001
415 Ga0157374_10001658
416 Ga0157374_10007083
417 Ga0157374_10056920
418 Ga0157378_10004888
419 Ga0157378_10008207
420 Ga0157378_10019458
421 Ga0157378_10037802
422 Ga0157378_10056841
423 Ga0163162_10008213
424 Ga0163162_10042984
425 Ga0163162_10079775
426 Ga0163162_10479267
427 Ga0157372_10001992
428 Ga0157372_10005136
429 Ga0157372_10056132
430 Ga0157372_10125784
431 Ga0157372_10263542
432 Ga0157372_10338616
433 Ga0157372_10365094
434 Ga0157375_10114577
435 Ga0163163_10037795
436 Ga0163163_10117360
437 Ga0163163_10256809
438 Ga0163163_10282550
439 Ga0157379_10028475
440 Ga0157376_10000058
441 Ga0157376_10084236
442 Ga0157376_10331795
443 Ga0207647_10005190
444 Ga0207647_10027678
445 Ga0207699_10077342
446 Ga0207705_10028072
447 Ga0207705_10078797
448 Ga0207684_10133316
449 Ga0207654_10059329
450 Ga0207707_10000340
451 Ga0207707_10017223
452 Ga0207695_10009255
453 Ga0207695_10051591
454 Ga0207671_10026044
455 Ga0207671_10174992
456 Ga0207663_10172307
457 Ga0207660_10012136
458 Ga0207660_10081883
459 Ga0207657_10071774
460 Ga0207649_10068895
461 Ga0207652_10002962
462 Ga0207652_10011387
463 Ga0207652_10110201
464 Ga0207694_10000664
465 Ga0207650_10076131
466 Ga0207650_10215576
467 Ga0207659_10035297
468 Ga0207659_10209498
469 Ga0207700_10037849
470 Ga0207644_10020641
471 Ga0207644_10046758
472 Ga0207644_10107018
473 Ga0207686_10066544
474 Ga0207670_10230277
475 Ga0207669_10007337
476 Ga0207704_10150751
477 Ga0207691_10008018
478 Ga0207691_10024198
479 Ga0207691_10043514
480 Ga0207691_10288076
481 Ga0207689_10006560
482 Ga0207689_10014649
483 Ga0207689_10023301
484 Ga0207689_10026110
485 Ga0207689_10280951
486 Ga0207661_10017869
487 Ga0207661_10043863
488 Ga0207679_10064265
489 Ga0207667_10000875
490 Ga0207667_10128913
491 Ga0207667_10237366
492 Ga0207668_10103416
493 Ga0207658_10234809
494 Ga0207703_10158801
495 Ga0207639_10023791
496 Ga0207639_10283523
497 Ga0207708_10005771
498 Ga0207702_10002553
499 Ga0207702_10005015
500 Ga0207702_10054843
501 Ga0207641_10011712
502 Ga0207641_10051979
503 Ga0207641_10063417
504 Ga0207641_10100599
505 Ga0207641_10233905
506 Ga0207641_10253781
507 Ga0207648_10021759
508 Ga0207676_10086004
509 Ga0207674_10020292
510 Ga0207674_10039142
511 Ga0207674_10162736
512 Ga0207675_100005004
513 Ga0207675_100496504
514 Ga0207698_10056761
515 Ga0207698_10105746
516 Ga0265357_1000382
517 Ga0268266_10000141
518 Ga0268266_10106514
519 Ga0268266_10216361
520 Ga0268265_10492925
521 Ga0268264_10013999
522 Ga0265338_10021624
523 Ga0265770_1000068
524 Ga0265339_10039614
525 Ga0265316_10180905
526 Ga0307411_10133098
527 Ga0373926_0010566
528 Ga0373944_0032542
529 Ga0373954_0141459
530 Ga0373943_0044072
531 Ga0373927_0019414
532 Ga0373927_0032025
533 Ga0373933_0200741
534 Ga0373947_0017713
535 Ga0373937_0010803
536 Ga0373937_0018164
537 Ga0373925_0002899
538 Ga0373925_0158330
539 Ga0395898_0291480
540 Ga0436364_0589402
541 Ga0436364_1326343
542 Ga0436363_0909847
543 Ga0436362_0469393
544 Ga0439458_0008679
545 Ga0466963_0004103
546 Ga0495603_0024974
547 Ga0495629_0027264
548 Ga0495580_0015803
549 Ga0495580_0102849
550 Ga0495582_0010015
551 Ga0495639_0048731
552 Ga0495594_0015209
553 Ga0495628_0151001
554 Ga0495630_0009762
555 Ga0495666_0021286
556 Ga0495586_0131135
557 Ga0495621_0019204
558 Ga0495634_0009810
559 Ga0495657_0040675
560 Ga0495599_0208677
561 Ga0495647_0004873
562 Ga0495658_0022565
563 Ga0495613_0036834
564 Ga0495624_0038254
565 Ga0495589_0065971
566 Ga0495581_0021579
567 Ga0495604_0267661
568 Ga0495674_0033097
569 Ga0495676_0056366
570 Ga0495680_0034129
571 Ga0495675_0027697
572 Ga0495675_0219133
573 Ga0495684_0075049
574 Ga0495602_0096048
575 Ga0495602_0114020
576 Ga0495614_0048834
577 Ga0496102_0167215
578 Ga0496102_0202503
579 Ga0496104_0077036
580 Ga0496104_0139482
581 Ga0496106_0119552
582 Ga0496107_0033736
583 Ga0496108_0135316
584 Ga0496108_0260279
585 Ga0496109_0197701
586 Ga0496112_0000573
587 Ga0496112_0004549
588 Ga0496112_0004563
589 Ga0496112_0045226
590 Ga0496112_0542068
591 Ga0496113_0022405
592 Ga0496115_0017697
593 Ga0496115_0053694
594 Ga0496126_0002267
595 Ga0496126_0030909
596 Ga0501036_0379384
597 nmdc:mga05p37_440981_c1
598 nmdc:mga06r32_161432_c1
599 nmdc:mga0n895_141866_c1
600 nmdc:mga0n895_303881_c1
601 nmdc:mga0rr50_183739_c1
602 nmdc:mga08x19_11410_c1
603 nmdc:mga08x19_238_c1
604 Ga0495601_0046332

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00756

Esterase

Putative esterase

59

341

0.85

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

83

323

0.6

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wyd-assembly1.cif.gz_B c-terminal esterase domain of lc-est1 0.8711 52 336
5vol-assembly2.cif.gz_G bacint_04212 ferulic acid esterase 0.8594 27 336
5vol-assembly2.cif.gz_H bacint_04212 ferulic acid esterase 0.8585 25 336
5vol-assembly2.cif.gz_H bacint_04212 ferulic acid esterase 0.8553 25 336
5vol-assembly1.cif.gz_F bacint_04212 ferulic acid esterase 0.8541 27 337
ID Description Score Start End Superfamily
3wydB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8711 52 336 3.40.50.1820
3wydB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8541 52 336 3.40.50.1820
af_A4HYW0_6_197_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8259 27 186 3.40.50.1820
af_Q2FUY3_1_252_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8098 28 334 3.40.50.1820
af_Q2FUY3_1_252_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8038 28 334 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A147IJ81-F1-model_v4 Esterase 0.9885 22 182 GO:0016747
AF-A0A158S2R1-F1-model_v4 Putative esterase 0.9667 22 337 GO:0016747
AF-A0A7V9YLK5-F1-model_v4 deleted 0.9652 22 339
AF-T0J7P1-F1-model_v4 Esterase 0.9647 22 342
AF-A0A087NCQ5-F1-model_v4 Esterase 0.9627 34 338

Map