F396094
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 301 | 177 | 248 | 172 |
Family's Representative Sequence
| Representative Sequence | 3300046538|Ga0495609_0004229|Ga0495609_0004229_2384_2965 |
| Length | 193 |
| Sequence | MSHSLTQPGAPNDSLQQGAFKPLQQEAFVGLQHAPSLKGLLKPFKGKGGMELLAEQCGALEAGLNALAQESIHTQANRYPFTLLPVRMTLQRTGAGTVFLRWQDIGTRQMGVHVWARLVGDTKTPEHMIQDLHAMELQRIALNMQISLVHAIGRQAAECAEKMAQADAVYLERLDQITKSRGNEPQPSKEPRE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 4 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 5 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 6 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 7 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 8 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 9 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 10 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 11 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 12 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 13 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 14 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 15 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 16 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 17 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 18 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 19 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 20 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 21 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 22 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 23 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 24 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 25 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 26 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 27 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 28 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 29 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 30 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 31 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 32 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 33 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 34 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 35 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 36 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 37 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 38 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 39 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 40 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 41 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 42 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 43 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 44 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 45 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 46 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 47 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 48 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 58 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 59 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 60 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 74 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 75 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 76 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 78 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 87 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 88 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 90 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 106 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 108 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 109 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 110 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 111 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 112 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 113 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 114 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 115 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 116 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 117 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 118 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 119 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 160 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 161 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 162 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 163 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 164 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 165 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 166 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 167 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 168 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 171 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 172 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 173 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 174 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 175 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 176 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 177 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.39 |
| Metatranscriptomes | 0 |
| Isolates | 17.61 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.97 |
| Nodule | 1.33 |
| Rhizoplane | 0.66 |
| Rhizosphere | 74.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.95 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_1159 | 2124908027 | Bacteria | 1677 |
| 2 | MRS2a_Contig_6318 | 2124908027 | Bacteria | 6149 |
| 3 | MRS2a_Contig_8937 | 2124908027 | Bacteria | 1836 |
| 4 | SwRhRL2b_contig_3646279 | 2162886007 | Bacteria | 3769 |
| 5 | SwRhRL2b_contig_776283 | 2162886007 | Bacteria | 7717 |
| 6 | JGI25155J39150_1001593 | 3300002704 | Bacteria | 1497 |
| 7 | JGI25162J39368_1000013 | 3300002737 | Bacteria | 343384 |
| 8 | JGI25163J39215_1000076 | 3300002771 | Bacteria | 43942 |
| 9 | JGI25164J39214_1000005 | 3300002772 | Bacteria | 343384 |
| 10 | JGI25165J46597_1000128 | 3300003214 | Bacteria | 130710 |
| 11 | Ga0055535_1002846 | 3300003761 | Bacteria | 5445 |
| 12 | Ga0055535_1014845 | 3300003761 | Bacteria | 1107 |
| 13 | Ga0065714_10003450 | 3300005288 | Bacteria | 7096 |
| 14 | Ga0065714_10004408 | 3300005288 | Bacteria | 4961 |
| 15 | Ga0065714_10005254 | 3300005288 | Bacteria | 4038 |
| 16 | Ga0065714_10007507 | 3300005288 | Bacteria | 2861 |
| 17 | Ga0065714_10023497 | 3300005288 | Bacteria | 1756 |
| 18 | Ga0065714_10067982 | 3300005288 | Bacteria | 5041 |
| 19 | Ga0065714_10070275 | 3300005288 | Bacteria | 3915 |
| 20 | Ga0065714_10100229 | 3300005288 | Bacteria | 1668 |
| 21 | Ga0065714_10100473 | 3300005288 | Bacteria | 1663 |
| 22 | Ga0065714_10117528 | 3300005288 | Bacteria | 1390 |
| 23 | Ga0065714_10250372 | 3300005288 | Bacteria | 776 |
| 24 | Ga0065704_10001144 | 3300005289 | Bacteria | 10646 |
| 25 | Ga0065704_10001245 | 3300005289 | Bacteria | 16693 |
| 26 | Ga0065712_10067925 | 3300005290 | Bacteria | 20547 |
| 27 | Ga0070670_100000444 | 3300005331 | Bacteria | 33600 |
| 28 | Ga0070661_100000015 | 3300005344 | Bacteria | 156690 |
| 29 | Ga0070661_100905136 | 3300005344 | Bacteria | 728 |
| 30 | Ga0070669_100003537 | 3300005353 | Bacteria | 11270 |
| 31 | Ga0070663_100641375 | 3300005455 | Bacteria | 897 |
| 32 | Ga0070681_11385098 | 3300005458 | Bacteria | 627 |
| 33 | Ga0068853_100191054 | 3300005539 | Bacteria | 1860 |
| 34 | Ga0070665_100119196 | 3300005548 | Bacteria | 2641 |
| 35 | Ga0070664_100000015 | 3300005564 | Bacteria | 128718 |
| 36 | Ga0068854_100015529 | 3300005578 | Bacteria | 5047 |
| 37 | Ga0068851_10000789 | 3300005834 | Bacteria | 13649 |
| 38 | Ga0075432_10127030 | 3300006058 | Bacteria | 963 |
| 39 | Ga0075432_10182552 | 3300006058 | Bacteria | 822 |
| 40 | Ga0099823_1061700 | 3300006944 | Bacteria | 1923 |
| 41 | Ga0105251_10000099 | 3300009011 | Bacteria | 84974 |
| 42 | Ga0105251_10000287 | 3300009011 | Bacteria | 50861 |
| 43 | Ga0105251_10000398 | 3300009011 | Bacteria | 42492 |
| 44 | Ga0105251_10006027 | 3300009011 | Bacteria | 7816 |
| 45 | Ga0105251_10012826 | 3300009011 | Bacteria | 4720 |
| 46 | Ga0105251_10025277 | 3300009011 | Bacteria | 3040 |
| 47 | Ga0105244_10003275 | 3300009036 | Bacteria | 11661 |
| 48 | Ga0105244_10003704 | 3300009036 | Bacteria | 10791 |
| 49 | Ga0105244_10020600 | 3300009036 | Bacteria | 3660 |
| 50 | Ga0105250_10001169 | 3300009092 | Bacteria | 14755 |
| 51 | Ga0105243_10000045 | 3300009148 | Bacteria | 156620 |
| 52 | Ga0105243_10000426 | 3300009148 | Bacteria | 44238 |
| 53 | Ga0105242_10000003 | 3300009176 | Bacteria | 226797 |
| 54 | Ga0105237_10000009 | 3300009545 | Bacteria | 337615 |
| 55 | Ga0105246_10000001 | 3300011119 | Bacteria | 200946 |
| 56 | Ga0105246_10000005 | 3300011119 | Bacteria | 83893 |
| 57 | Ga0157373_10120667 | 3300013100 | Bacteria | 1842 |
| 58 | Ga0157373_10360751 | 3300013100 | Bacteria | 1037 |
| 59 | Ga0157371_10000692 | 3300013102 | Bacteria | 39748 |
| 60 | Ga0157371_10002623 | 3300013102 | Bacteria | 17075 |
| 61 | Ga0157371_10319907 | 3300013102 | Bacteria | 1126 |
| 62 | Ga0157370_10083355 | 3300013104 | Bacteria | 3006 |
| 63 | Ga0157370_10945219 | 3300013104 | Bacteria | 781 |
| 64 | Ga0157369_10002042 | 3300013105 | Bacteria | 24345 |
| 65 | Ga0157369_10025170 | 3300013105 | Bacteria | 6608 |
| 66 | Ga0157369_10026002 | 3300013105 | Bacteria | 6495 |
| 67 | Ga0163162_10000146 | 3300013306 | Bacteria | 64972 |
| 68 | Ga0163162_10000501 | 3300013306 | Bacteria | 36451 |
| 69 | Ga0163162_10427070 | 3300013306 | Bacteria | 1457 |
| 70 | Ga0163162_11261912 | 3300013306 | Bacteria | 839 |
| 71 | Ga0157375_10000689 | 3300013308 | Bacteria | 29918 |
| 72 | Ga0157375_10667593 | 3300013308 | Bacteria | 1195 |
| 73 | Ga0182008_10002586 | 3300014497 | Bacteria | 11238 |
| 74 | Ga0182008_10011358 | 3300014497 | Bacteria | 4741 |
| 75 | Ga0182008_10012090 | 3300014497 | Bacteria | 4566 |
| 76 | Ga0182006_1005275 | 3300015261 | Bacteria | 6184 |
| 77 | Ga0182006_1024537 | 3300015261 | Bacteria | 2486 |
| 78 | Ga0182007_10000261 | 3300015262 | Bacteria | 35265 |
| 79 | Ga0182007_10004570 | 3300015262 | Bacteria | 6253 |
| 80 | Ga0163161_10002142 | 3300017792 | Bacteria | 14240 |
| 81 | Ga0163161_10005628 | 3300017792 | Bacteria | 8690 |
| 82 | Ga0163161_10292237 | 3300017792 | Bacteria | 1281 |
| 83 | Ga0209435_101058 | 3300025206 | Bacteria | 3894 |
| 84 | Ga0209760_100007 | 3300025207 | Bacteria | 211381 |
| 85 | Ga0209784_100286 | 3300025224 | Bacteria | 28184 |
| 86 | Ga0209784_100372 | 3300025224 | Bacteria | 21158 |
| 87 | Ga0209566_100484 | 3300025225 | Bacteria | 28184 |
| 88 | Ga0209566_100645 | 3300025225 | Bacteria | 21084 |
| 89 | Ga0209674_100338 | 3300025226 | Bacteria | 28184 |
| 90 | Ga0209674_100411 | 3300025226 | Bacteria | 21158 |
| 91 | Ga0209147_100629 | 3300025229 | Bacteria | 19024 |
| 92 | Ga0209147_101026 | 3300025229 | Bacteria | 11898 |
| 93 | Ga0209563_100223 | 3300025230 | Bacteria | 28184 |
| 94 | Ga0209563_100285 | 3300025230 | Bacteria | 21158 |
| 95 | Ga0207427_100018 | 3300025231 | Bacteria | 530735 |
| 96 | Ga0209437_100031 | 3300025233 | Bacteria | 530871 |
| 97 | Ga0209437_102412 | 3300025233 | Bacteria | 3624 |
| 98 | Ga0209646_1000312 | 3300025246 | Bacteria | 38249 |
| 99 | Ga0209026_1039449 | 3300025250 | Bacteria | 686 |
| 100 | Ga0209677_100360 | 3300025253 | Bacteria | 28184 |
| 101 | Ga0209677_100836 | 3300025253 | Bacteria | 15255 |
| 102 | Ga0209759_1005357 | 3300025256 | Bacteria | 4518 |
| 103 | Ga0209233_1000012 | 3300025261 | Bacteria | 1019519 |
| 104 | Ga0207656_10000039 | 3300025321 | Bacteria | 55751 |
| 105 | Ga0207696_1000794 | 3300025711 | Bacteria | 20575 |
| 106 | Ga0207696_1007029 | 3300025711 | Bacteria | 4453 |
| 107 | Ga0207655_1000782 | 3300025728 | Bacteria | 34897 |
| 108 | Ga0207655_1001030 | 3300025728 | Bacteria | 28131 |
| 109 | Ga0207655_1003864 | 3300025728 | Bacteria | 10904 |
| 110 | Ga0207655_1004605 | 3300025728 | Bacteria | 9707 |
| 111 | Ga0207713_1000098 | 3300025735 | Bacteria | 143900 |
| 112 | Ga0207713_1000140 | 3300025735 | Bacteria | 108600 |
| 113 | Ga0207713_1000927 | 3300025735 | Bacteria | 26323 |
| 114 | Ga0207713_1025095 | 3300025735 | Bacteria | 2759 |
| 115 | Ga0207671_10000018 | 3300025914 | Bacteria | 318130 |
| 116 | Ga0207649_10000008 | 3300025920 | Bacteria | 315683 |
| 117 | Ga0207681_10002802 | 3300025923 | Bacteria | 11033 |
| 118 | Ga0207650_10000192 | 3300025925 | Bacteria | 70742 |
| 119 | Ga0207650_10000800 | 3300025925 | Bacteria | 24152 |
| 120 | Ga0207686_10000328 | 3300025934 | Bacteria | 34200 |
| 121 | Ga0207709_10000011 | 3300025935 | Bacteria | 552881 |
| 122 | Ga0207709_11683694 | 3300025935 | Bacteria | 527 |
| 123 | Ga0207679_10000008 | 3300025945 | Bacteria | 412057 |
| 124 | Ga0207640_10012796 | 3300025981 | Bacteria | 4791 |
| 125 | Ga0207639_10017173 | 3300026041 | Bacteria | 5129 |
| 126 | Ga0207678_10650129 | 3300026067 | Bacteria | 926 |
| 127 | Ga0207428_10196441 | 3300027907 | Bacteria | 1519 |
| 128 | Ga0268266_10113467 | 3300028379 | Bacteria | 2403 |
| 129 | Ga0307509_10485702 | 3300031507 | Bacteria | 922 |
| 130 | Ga0307408_100296967 | 3300031548 | Bacteria | 1351 |
| 131 | Ga0307405_10231879 | 3300031731 | Bacteria | 1361 |
| 132 | Ga0307412_10002220 | 3300031911 | Bacteria | 10778 |
| 133 | Ga0307412_10624820 | 3300031911 | Bacteria | 915 |
| 134 | Ga0307412_10735030 | 3300031911 | Bacteria | 850 |
| 135 | Ga0439438_000152 | 3300041405 | Bacteria | 31450 |
| 136 | Ga0439447_000773 | 3300041407 | Bacteria | 11770 |
| 137 | Ga0439466_0000573 | 3300041411 | Bacteria | 13821 |
| 138 | Ga0439451_001120 | 3300042009 | Bacteria | 5235 |
| 139 | Ga0439452_000528 | 3300042010 | Bacteria | 20425 |
| 140 | Ga0439456_005612 | 3300042013 | Bacteria | 2549 |
| 141 | Ga0450903_010941 | 3300042138 | Bacteria | 1464 |
| 142 | Ga0439446_0000647 | 3300042156 | Bacteria | 7221 |
| 143 | Ga0495627_002493 | 3300046453 | Bacteria | 8792 |
| 144 | Ga0495627_042205 | 3300046453 | Bacteria | 1399 |
| 145 | Ga0495591_000005 | 3300046458 | Bacteria | 394092 |
| 146 | Ga0495591_000365 | 3300046458 | Bacteria | 39027 |
| 147 | Ga0495638_0002158 | 3300046460 | Bacteria | 16515 |
| 148 | Ga0495638_0345933 | 3300046460 | Bacteria | 786 |
| 149 | Ga0495653_0025528 | 3300046463 | Bacteria | 4746 |
| 150 | Ga0495605_0000009 | 3300046474 | Bacteria | 324622 |
| 151 | Ga0495605_0000050 | 3300046474 | Bacteria | 165667 |
| 152 | Ga0495605_0000324 | 3300046474 | Bacteria | 49042 |
| 153 | Ga0495605_0000338 | 3300046474 | Bacteria | 46528 |
| 154 | Ga0495605_0001179 | 3300046474 | Bacteria | 17377 |
| 155 | Ga0495605_0018683 | 3300046474 | Bacteria | 3710 |
| 156 | Ga0495605_0048075 | 3300046474 | Bacteria | 2090 |
| 157 | Ga0495605_0129345 | 3300046474 | Bacteria | 1139 |
| 158 | Ga0495605_0243348 | 3300046474 | Bacteria | 771 |
| 159 | Ga0495584_0000929 | 3300046491 | Bacteria | 18539 |
| 160 | Ga0495594_0087949 | 3300046499 | Bacteria | 1739 |
| 161 | Ga0495607_0000079 | 3300046501 | Bacteria | 97679 |
| 162 | Ga0495607_0000135 | 3300046501 | Bacteria | 78019 |
| 163 | Ga0495607_0000167 | 3300046501 | Bacteria | 69947 |
| 164 | Ga0495607_0144992 | 3300046501 | Bacteria | 1221 |
| 165 | Ga0495583_0000019 | 3300046506 | Bacteria | 298512 |
| 166 | Ga0495606_0001025 | 3300046507 | Bacteria | 40534 |
| 167 | Ga0495610_0001731 | 3300046512 | Bacteria | 19136 |
| 168 | Ga0495610_0016934 | 3300046512 | Bacteria | 4174 |
| 169 | Ga0495616_0003811 | 3300046513 | Bacteria | 9611 |
| 170 | Ga0495620_0000017 | 3300046515 | Bacteria | 153019 |
| 171 | Ga0495620_0000029 | 3300046515 | Bacteria | 122326 |
| 172 | Ga0495631_0008672 | 3300046518 | Bacteria | 5116 |
| 173 | Ga0495632_0000428 | 3300046519 | Bacteria | 40001 |
| 174 | Ga0495632_0071056 | 3300046519 | Bacteria | 1673 |
| 175 | Ga0495632_0193586 | 3300046519 | Bacteria | 928 |
| 176 | Ga0495632_0203978 | 3300046519 | Bacteria | 899 |
| 177 | Ga0495637_0000112 | 3300046520 | Bacteria | 58999 |
| 178 | Ga0495648_0000545 | 3300046524 | Bacteria | 40564 |
| 179 | Ga0495648_0008023 | 3300046524 | Bacteria | 8365 |
| 180 | Ga0495648_0071795 | 3300046524 | Bacteria | 2005 |
| 181 | Ga0495648_0314876 | 3300046524 | Bacteria | 728 |
| 182 | Ga0495654_0000157 | 3300046530 | Bacteria | 67490 |
| 183 | Ga0495654_0005247 | 3300046530 | Bacteria | 7563 |
| 184 | Ga0495654_0039133 | 3300046530 | Bacteria | 2368 |
| 185 | Ga0495654_0040222 | 3300046530 | Bacteria | 2331 |
| 186 | Ga0495609_0000041 | 3300046538 | Bacteria | 171015 |
| 187 | Ga0495609_0004229 | 3300046538 | Bacteria | 7935 |
| 188 | Ga0495597_0014822 | 3300046542 | Bacteria | 3705 |
| 189 | Ga0495611_0008534 | 3300046648 | Bacteria | 4332 |
| 190 | Ga0495611_0027351 | 3300046648 | Bacteria | 2492 |
| 191 | Ga0495625_0082289 | 3300046660 | Bacteria | 2239 |
| 192 | Ga0495661_0000005 | 3300046665 | Bacteria | 433622 |
| 193 | Ga0495661_0000031 | 3300046665 | Bacteria | 171518 |
| 194 | Ga0495661_0041118 | 3300046665 | Bacteria | 2862 |
| 195 | Ga0495646_0010277 | 3300046680 | Bacteria | 5952 |
| 196 | Ga0495624_0000014 | 3300046690 | Bacteria | 111102 |
| 197 | Ga0495670_0006975 | 3300046691 | Bacteria | 5566 |
| 198 | Ga0495670_0011547 | 3300046691 | Bacteria | 4345 |
| 199 | Ga0495670_0316791 | 3300046691 | Bacteria | 837 |
| 200 | Ga0495671_0000193 | 3300046692 | Bacteria | 53391 |
| 201 | Ga0495671_0013129 | 3300046692 | Bacteria | 4499 |
| 202 | Ga0495671_0018670 | 3300046692 | Bacteria | 3677 |
| 203 | Ga0495671_0513580 | 3300046692 | Bacteria | 571 |
| 204 | Ga0495649_0000206 | 3300046694 | Bacteria | 51902 |
| 205 | Ga0495589_0001810 | 3300046794 | Bacteria | 12157 |
| 206 | Ga0495660_0000902 | 3300046810 | Bacteria | 21972 |
| 207 | Ga0495660_0213795 | 3300046810 | Bacteria | 913 |
| 208 | Ga0495604_0004755 | 3300047317 | Bacteria | 10755 |
| 209 | Ga0495672_0005954 | 3300047320 | Bacteria | 9555 |
| 210 | Ga0495672_0014492 | 3300047320 | Bacteria | 5397 |
| 211 | Ga0495680_0002577 | 3300047322 | Bacteria | 18461 |
| 212 | Ga0495683_0000004 | 3300047323 | Bacteria | 321136 |
| 213 | Ga0495683_0005814 | 3300047323 | Bacteria | 6788 |
| 214 | Ga0495679_000153 | 3300047446 | Bacteria | 61902 |
| 215 | Ga0495679_014495 | 3300047446 | Bacteria | 2918 |
| 216 | Ga0495679_020016 | 3300047446 | Bacteria | 2338 |
| 217 | Ga0495673_0000178 | 3300047469 | Bacteria | 102182 |
| 218 | Ga0495673_0003702 | 3300047469 | Bacteria | 9950 |
| 219 | Ga0495681_0000026 | 3300047470 | Bacteria | 144911 |
| 220 | Ga0495681_0272245 | 3300047470 | Bacteria | 662 |
| 221 | Ga0495593_0062472 | 3300047673 | Bacteria | 1946 |
| 222 | Ga0495602_0002410 | 3300048088 | Bacteria | 19003 |
| 223 | Ga0495626_0000132 | 3300048091 | Bacteria | 94157 |
| 224 | Ga0496117_0000309 | 3300048920 | Bacteria | 85072 |
| 225 | Ga0496117_0004022 | 3300048920 | Bacteria | 16579 |
| 226 | Ga0496118_0003289 | 3300048921 | Bacteria | 20561 |
| 227 | Ga0496118_0007466 | 3300048921 | Bacteria | 11571 |
| 228 | Ga0496118_0031835 | 3300048921 | Bacteria | 4362 |
| 229 | Ga0496118_0423615 | 3300048921 | Bacteria | 684 |
| 230 | Ga0496120_0049843 | 3300048923 | Bacteria | 2401 |
| 231 | Ga0496121_0149412 | 3300048924 | Bacteria | 1721 |
| 232 | Ga0496122_0029129 | 3300048925 | Bacteria | 4665 |
| 233 | Ga0496122_0039370 | 3300048925 | Bacteria | 3770 |
| 234 | Ga0496123_0007358 | 3300048926 | Bacteria | 10417 |
| 235 | Ga0496123_0008193 | 3300048926 | Bacteria | 9638 |
| 236 | Ga0496123_0252935 | 3300048926 | Bacteria | 868 |
| 237 | Ga0496124_0002737 | 3300048927 | Bacteria | 22480 |
| 238 | Ga0496124_0004708 | 3300048927 | Bacteria | 15749 |
| 239 | Ga0496124_0032568 | 3300048927 | Bacteria | 4600 |
| 240 | Ga0496125_0004549 | 3300048928 | Bacteria | 15915 |
| 241 | Ga0496125_0085322 | 3300048928 | Bacteria | 2393 |
| 242 | Ga0496126_0000456 | 3300048929 | Bacteria | 81301 |
| 243 | Ga0496126_0003217 | 3300048929 | Bacteria | 20930 |
| 244 | Ga0495678_000014 | 3300049459 | Bacteria | 313755 |
| 245 | Ga0495678_005241 | 3300049459 | Bacteria | 7225 |
| 246 | Ga0495682_0001701 | 3300049460 | Bacteria | 11189 |
| 247 | Ga0495682_0014337 | 3300049460 | Bacteria | 3007 |
| 248 | Ga0500634_0155574 | 3300053161 | Bacteria | 1062 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005289 | Ga0065704_10001144 | Ga0065704_100011442 | 145 |
| 2 | 3300025711 | Ga0207696_1000794 | Ga0207696_100079414 | 145 |
| 3 | 3300009036 | Ga0105244_10003704 | Ga0105244_100037048 | 150 |
| 4 | 3300025728 | Ga0207655_1003864 | Ga0207655_10038643 | 150 |
| 5 | 3300009011 | Ga0105251_10025277 | Ga0105251_100252772 | 151 |
| 6 | 3300006944 | Ga0099823_1061700 | Ga0099823_10617003 | 152 |
| 7 | 3300009092 | Ga0105250_10001169 | Ga0105250_100011697 | 152 |
| 8 | 3300017792 | Ga0163161_10005628 | Ga0163161_100056289 | 152 |
| 9 | 3300048921 | Ga0496118_0423615 | Ga0496118_0423615_110_658 | 152 |
| 10 | 3300048925 | Ga0496122_0029129 | Ga0496122_0029129_1537_2085 | 152 |
| 11 | 3300048926 | Ga0496123_0008193 | Ga0496123_0008193_4474_5022 | 152 |
| 12 | 3300048927 | Ga0496124_0004708 | Ga0496124_0004708_1080_1628 | 152 |
| 13 | 3300048928 | Ga0496125_0004549 | Ga0496125_0004549_1089_1637 | 152 |
| 14 | 3300048929 | Ga0496126_0003217 | Ga0496126_0003217_14187_14735 | 152 |
| 15 | 3300048923 | Ga0496120_0049843 | Ga0496120_0049843_744_1292 | 153 |
| 16 | 3300048927 | Ga0496124_0002737 | Ga0496124_0002737_4419_4955 | 154 |
| 17 | 3300009011 | Ga0105251_10006027 | Ga0105251_100060276 | 155 |
| 18 | 3300013105 | Ga0157369_10026002 | Ga0157369_100260022 | 155 |
| 19 | 3300013306 | Ga0163162_10000501 | Ga0163162_100005013 | 155 |
| 20 | 3300025728 | Ga0207655_1000782 | Ga0207655_100078213 | 155 |
| 21 | 3300048920 | Ga0496117_0004022 | Ga0496117_0004022_3135_3674 | 155 |
| 22 | 3300048921 | Ga0496118_0007466 | Ga0496118_0007466_7828_8367 | 155 |
| 23 | 3300002704 | JGI25155J39150_1001593 | JGI25155J39150_10015932 | 156 |
| 24 | 3300003761 | Ga0055535_1002846 | Ga0055535_10028462 | 156 |
| 25 | 3300009148 | Ga0105243_10000426 | Ga0105243_1000042611 | 156 |
| 26 | 3300025206 | Ga0209435_101058 | Ga0209435_1010581 | 156 |
| 27 | 3300025224 | Ga0209784_100286 | Ga0209784_10028614 | 156 |
| 28 | 3300025225 | Ga0209566_100484 | Ga0209566_10048413 | 156 |
| 29 | 3300025226 | Ga0209674_100338 | Ga0209674_10033813 | 156 |
| 30 | 3300025229 | Ga0209147_100629 | Ga0209147_1006297 | 156 |
| 31 | 3300025230 | Ga0209563_100223 | Ga0209563_10022313 | 156 |
| 32 | 3300025253 | Ga0209677_100360 | Ga0209677_10036013 | 156 |
| 33 | 3300025256 | Ga0209759_1005357 | Ga0209759_10053572 | 156 |
| 34 | 3300046453 | Ga0495627_042205 | Ga0495627_042205_619_1158 | 156 |
| 35 | 3300048920 | Ga0496117_0000309 | Ga0496117_0000309_83444_83983 | 156 |
| 36 | 3300048921 | Ga0496118_0031835 | Ga0496118_0031835_956_1495 | 156 |
| 37 | 3300046458 | Ga0495591_000365 | Ga0495591_000365_31565_32134 | 157 |
| 38 | 3300046499 | Ga0495594_0087949 | Ga0495594_0087949_208_777 | 157 |
| 39 | 3300046691 | Ga0495670_0316791 | Ga0495670_0316791_62_616 | 157 |
| 40 | 3300003761 | Ga0055535_1014845 | Ga0055535_10148452 | 158 |
| 41 | 3300005344 | Ga0070661_100905136 | Ga0070661_1009051362 | 158 |
| 42 | 3300005578 | Ga0068854_100015529 | Ga0068854_1000155296 | 158 |
| 43 | 3300005834 | Ga0068851_10000789 | Ga0068851_100007893 | 158 |
| 44 | 3300009011 | Ga0105251_10000099 | Ga0105251_1000009965 | 158 |
| 45 | 3300014497 | Ga0182008_10011358 | Ga0182008_100113584 | 158 |
| 46 | 3300025224 | Ga0209784_100372 | Ga0209784_10037216 | 158 |
| 47 | 3300025225 | Ga0209566_100645 | Ga0209566_10064516 | 158 |
| 48 | 3300025226 | Ga0209674_100411 | Ga0209674_10041116 | 158 |
| 49 | 3300025229 | Ga0209147_101026 | Ga0209147_10102613 | 158 |
| 50 | 3300025230 | Ga0209563_100285 | Ga0209563_10028516 | 158 |
| 51 | 3300025233 | Ga0209437_102412 | Ga0209437_1024124 | 158 |
| 52 | 3300025246 | Ga0209646_1000312 | Ga0209646_100031224 | 158 |
| 53 | 3300025250 | Ga0209026_1039449 | Ga0209026_10394492 | 158 |
| 54 | 3300025253 | Ga0209677_100836 | Ga0209677_10083617 | 158 |
| 55 | 3300025321 | Ga0207656_10000039 | Ga0207656_100000393 | 158 |
| 56 | 3300025735 | Ga0207713_1000098 | Ga0207713_100009826 | 158 |
| 57 | 3300025981 | Ga0207640_10012796 | Ga0207640_100127964 | 158 |
| 58 | 3300042138 | Ga0450903_010941 | Ga0450903_010941_533_1078 | 158 |
| 59 | 3300046520 | Ga0495637_0000112 | Ga0495637_0000112_17051_17602 | 158 |
| 60 | 3300046530 | Ga0495654_0000157 | Ga0495654_0000157_1000_1551 | 158 |
| 61 | 3300046692 | Ga0495671_0000193 | Ga0495671_0000193_41734_42285 | 158 |
| 62 | 3300046692 | Ga0495671_0013129 | Ga0495671_0013129_810_1385 | 158 |
| 63 | 3300048921 | Ga0496118_0003289 | Ga0496118_0003289_987_1532 | 158 |
| 64 | 3300046694 | Ga0495649_0000206 | Ga0495649_0000206_28384_28950 | 159 |
| 65 | iso_pu_bacteria | 2919481497 | 2919483898 | 159 |
| 66 | iso_pu_bacteria | 2931396565 | 2931400623 | 159 |
| 67 | 3300046501 | Ga0495607_0000135 | Ga0495607_0000135_13919_14485 | 160 |
| 68 | 3300046474 | Ga0495605_0000009 | Ga0495605_0000009_166312_166893 | 161 |
| 69 | 3300046506 | Ga0495583_0000019 | Ga0495583_0000019_171795_172376 | 161 |
| 70 | 3300046512 | Ga0495610_0016934 | Ga0495610_0016934_1232_1813 | 161 |
| 71 | 3300046515 | Ga0495620_0000029 | Ga0495620_0000029_11217_11798 | 161 |
| 72 | 3300046518 | Ga0495631_0008672 | Ga0495631_0008672_3492_4073 | 161 |
| 73 | 3300046530 | Ga0495654_0005247 | Ga0495654_0005247_619_1200 | 161 |
| 74 | 3300046538 | Ga0495609_0000041 | Ga0495609_0000041_119152_119733 | 161 |
| 75 | 3300046665 | Ga0495661_0000031 | Ga0495661_0000031_96933_97514 | 161 |
| 76 | 3300046691 | Ga0495670_0006975 | Ga0495670_0006975_1982_2563 | 161 |
| 77 | 3300046692 | Ga0495671_0018670 | Ga0495671_0018670_1601_2182 | 161 |
| 78 | 3300046794 | Ga0495589_0001810 | Ga0495589_0001810_1928_2509 | 161 |
| 79 | 3300046810 | Ga0495660_0213795 | Ga0495660_0213795_107_688 | 161 |
| 80 | 3300047446 | Ga0495679_020016 | Ga0495679_020016_1202_1783 | 161 |
| 81 | 3300013306 | Ga0163162_10000146 | Ga0163162_1000014611 | 162 |
| 82 | 3300013306 | Ga0163162_10427070 | Ga0163162_104270703 | 162 |
| 83 | 3300046648 | Ga0495611_0008534 | Ga0495611_0008534_1034_1615 | 162 |
| 84 | 2162886007 | SwRhRL2b_contig_3646279 | SwRhRL2b_0398.00002380 | 163 |
| 85 | 3300013102 | Ga0157371_10002623 | Ga0157371_100026232 | 163 |
| 86 | 3300013102 | Ga0157371_10319907 | Ga0157371_103199072 | 163 |
| 87 | 3300013105 | Ga0157369_10002042 | Ga0157369_100020422 | 163 |
| 88 | 3300046474 | Ga0495605_0048075 | Ga0495605_0048075_493_984 | 163 |
| 89 | 3300048924 | Ga0496121_0149412 | Ga0496121_0149412_946_1437 | 163 |
| 90 | iso_pu_bacteria | 2554235231 | 2555248763 | 163 |
| 91 | 3300013100 | Ga0157373_10360751 | Ga0157373_103607512 | 165 |
| 92 | 2124908027 | MRS2a_Contig_8937 | MRS2a_00779670 | 166 |
| 93 | 3300013104 | Ga0157370_10945219 | Ga0157370_109452192 | 166 |
| 94 | 3300017792 | Ga0163161_10292237 | Ga0163161_102922372 | 166 |
| 95 | iso_pu_bacteria | 2908446538 | 2908447483 | 166 |
| 96 | 3300025935 | Ga0207709_11683694 | Ga0207709_116836941 | 167 |
| 97 | 3300048925 | Ga0496122_0039370 | Ga0496122_0039370_1926_2429 | 167 |
| 98 | 3300048926 | Ga0496123_0007358 | Ga0496123_0007358_3406_3909 | 167 |
| 99 | iso_pu_bacteria | 2946027586 | 2946031739 | 167 |
| 100 | 3300046474 | Ga0495605_0243348 | Ga0495605_0243348_81_614 | 168 |
| 101 | 3300046501 | Ga0495607_0000079 | Ga0495607_0000079_22938_23471 | 168 |
| 102 | 3300046810 | Ga0495660_0000902 | Ga0495660_0000902_9061_9594 | 168 |
| 103 | iso_pu_bacteria | 2511231004 | 2511255478 | 168 |
| 104 | iso_pu_bacteria | 2511231022 | 2511365498 | 168 |
| 105 | iso_pu_bacteria | 2597489889 | 2597869153 | 168 |
| 106 | iso_pu_bacteria | 2599185179 | 2599451640 | 168 |
| 107 | iso_pu_bacteria | 2623620443 | 2624479854 | 168 |
| 108 | iso_pu_bacteria | 2738541294 | 2738806981 | 168 |
| 109 | iso_pu_bacteria | 2738541294 | 2738812372 | 168 |
| 110 | iso_pu_bacteria | 2738541294 | 2738812384 | 168 |
| 111 | iso_pu_bacteria | 2738541309 | 2738894341 | 168 |
| 112 | iso_pu_bacteria | 2738541309 | 2738899733 | 168 |
| 113 | iso_pu_bacteria | 2738541309 | 2738899745 | 168 |
| 114 | iso_pu_bacteria | 2808606385 | 2808979866 | 168 |
| 115 | iso_pu_bacteria | 2808606385 | 2808979906 | 168 |
| 116 | iso_pu_bacteria | 2808606388 | 2808995706 | 168 |
| 117 | iso_pu_bacteria | 2808606388 | 2808995746 | 168 |
| 118 | iso_pu_bacteria | 2816332298 | 2817490263 | 168 |
| 119 | iso_pu_bacteria | 2834028612 | 2834030648 | 168 |
| 120 | iso_pu_bacteria | 2842826826 | 2842827906 | 168 |
| 121 | iso_pu_bacteria | 2842837860 | 2842839611 | 168 |
| 122 | iso_pu_bacteria | 2852612431 | 2852617760 | 168 |
| 123 | iso_pu_bacteria | 2852667396 | 2852672876 | 168 |
| 124 | iso_pu_bacteria | 2860339153 | 2860339503 | 168 |
| 125 | iso_pu_bacteria | 2913036834 | 2913041259 | 168 |
| 126 | iso_pu_bacteria | 2929144301 | 2929146588 | 168 |
| 127 | iso_pu_bacteria | 2931369376 | 2931370102 | 168 |
| 128 | iso_pu_bacteria | 2945961074 | 2945963654 | 168 |
| 129 | iso_pu_bacteria | 2946006987 | 2946009890 | 168 |
| 130 | iso_pu_bacteria | 2947233263 | 2947236881 | 168 |
| 131 | iso_pu_bacteria | 8019775933 | 8019779797 | 168 |
| 132 | iso_pu_bacteria | 8054285046 | 8054289769 | 168 |
| 133 | iso_pu_bacteria | 8055817908 | 8055820881 | 168 |
| 134 | iso_pu_bacteria | 8056131705 | 8056133943 | 168 |
| 135 | iso_pu_bacteria | 8056155041 | 8056155886 | 168 |
| 136 | 3300009148 | Ga0105243_10000045 | Ga0105243_1000004592 | 169 |
| 137 | 3300046474 | Ga0495605_0000324 | Ga0495605_0000324_47668_48207 | 169 |
| 138 | 3300046474 | Ga0495605_0000338 | Ga0495605_0000338_44341_44853 | 169 |
| 139 | 3300046530 | Ga0495654_0040222 | Ga0495654_0040222_1631_2143 | 169 |
| 140 | 3300046660 | Ga0495625_0082289 | Ga0495625_0082289_355_894 | 169 |
| 141 | 3300047323 | Ga0495683_0005814 | Ga0495683_0005814_5761_6270 | 169 |
| 142 | iso_pu_bacteria | 2643221713 | 2644623711 | 169 |
| 143 | iso_pu_bacteria | 2643221713 | 2644624872 | 169 |
| 144 | iso_pu_bacteria | 2852612431 | 2852615797 | 169 |
| 145 | iso_pu_bacteria | 2852667396 | 2852670765 | 169 |
| 146 | iso_pu_bacteria | 2929189879 | 2929190743 | 169 |
| 147 | iso_pu_bacteria | 2945961074 | 2945966095 | 169 |
| 148 | iso_pu_bacteria | 637000220 | 637322007 | 169 |
| 149 | 3300005288 | Ga0065714_10070275 | Ga0065714_100702752 | 170 |
| 150 | 3300046453 | Ga0495627_002493 | Ga0495627_002493_298_867 | 170 |
| 151 | 3300046474 | Ga0495605_0000050 | Ga0495605_0000050_115059_115628 | 170 |
| 152 | 3300046512 | Ga0495610_0001731 | Ga0495610_0001731_7479_8051 | 170 |
| 153 | 3300046515 | Ga0495620_0000017 | Ga0495620_0000017_101410_101979 | 170 |
| 154 | 3300046524 | Ga0495648_0071795 | Ga0495648_0071795_360_929 | 170 |
| 155 | 3300046542 | Ga0495597_0014822 | Ga0495597_0014822_889_1458 | 170 |
| 156 | 3300046648 | Ga0495611_0027351 | Ga0495611_0027351_1115_1684 | 170 |
| 157 | 3300046665 | Ga0495661_0000005 | Ga0495661_0000005_365752_366321 | 170 |
| 158 | 3300046691 | Ga0495670_0011547 | Ga0495670_0011547_549_1118 | 170 |
| 159 | 3300047323 | Ga0495683_0000004 | Ga0495683_0000004_270527_271096 | 170 |
| 160 | 3300047446 | Ga0495679_000153 | Ga0495679_000153_50009_50578 | 170 |
| 161 | 3300048929 | Ga0496126_0000456 | Ga0496126_0000456_70861_71433 | 170 |
| 162 | 3300049459 | Ga0495678_000014 | Ga0495678_000014_50625_51194 | 170 |
| 163 | iso_pu_bacteria | 2510065058 | 2510309603 | 170 |
| 164 | iso_pu_bacteria | 2675903420 | 2677899775 | 170 |
| 165 | iso_pu_bacteria | 2826581358 | 2826584386 | 170 |
| 166 | iso_pu_bacteria | 2842849001 | 2842849427 | 170 |
| 167 | iso_pu_bacteria | 2917832318 | 2917834016 | 170 |
| 168 | iso_pu_bacteria | 3007419365 | 3007423660 | 170 |
| 169 | 3300005288 | Ga0065714_10100473 | Ga0065714_101004732 | 171 |
| 170 | 3300011119 | Ga0105246_10000005 | Ga0105246_1000000558 | 171 |
| 171 | 3300013308 | Ga0157375_10667593 | Ga0157375_106675932 | 171 |
| 172 | 3300042009 | Ga0439451_001120 | Ga0439451_001120_4123_4638 | 171 |
| 173 | 3300042156 | Ga0439446_0000647 | Ga0439446_0000647_2092_2610 | 171 |
| 174 | 2124908027 | MRS2a_Contig_1159 | MRS2a_00058230 | 172 |
| 175 | 2124908027 | MRS2a_Contig_6318 | MRS2a_00217590 | 172 |
| 176 | 2162886007 | SwRhRL2b_contig_776283 | SwRhRL2b_0841.00009170 | 172 |
| 177 | 3300002737 | JGI25162J39368_1000013 | JGI25162J39368_1000013120 | 172 |
| 178 | 3300002771 | JGI25163J39215_1000076 | JGI25163J39215_100007637 | 172 |
| 179 | 3300002772 | JGI25164J39214_1000005 | JGI25164J39214_1000005120 | 172 |
| 180 | 3300003214 | JGI25165J46597_1000128 | JGI25165J46597_100012870 | 172 |
| 181 | 3300005288 | Ga0065714_10003450 | Ga0065714_100034508 | 172 |
| 182 | 3300005288 | Ga0065714_10004408 | Ga0065714_100044084 | 172 |
| 183 | 3300005288 | Ga0065714_10005254 | Ga0065714_100052543 | 172 |
| 184 | 3300005288 | Ga0065714_10007507 | Ga0065714_100075073 | 172 |
| 185 | 3300005288 | Ga0065714_10023497 | Ga0065714_100234973 | 172 |
| 186 | 3300005288 | Ga0065714_10067982 | Ga0065714_100679822 | 172 |
| 187 | 3300005288 | Ga0065714_10100229 | Ga0065714_101002292 | 172 |
| 188 | 3300005288 | Ga0065714_10117528 | Ga0065714_101175282 | 172 |
| 189 | 3300005288 | Ga0065714_10250372 | Ga0065714_102503722 | 172 |
| 190 | 3300005289 | Ga0065704_10001245 | Ga0065704_100012452 | 172 |
| 191 | 3300005290 | Ga0065712_10067925 | Ga0065712_1006792518 | 172 |
| 192 | 3300005331 | Ga0070670_100000444 | Ga0070670_10000044423 | 172 |
| 193 | 3300005344 | Ga0070661_100000015 | Ga0070661_10000001596 | 172 |
| 194 | 3300005353 | Ga0070669_100003537 | Ga0070669_1000035373 | 172 |
| 195 | 3300005455 | Ga0070663_100641375 | Ga0070663_1006413752 | 172 |
| 196 | 3300005458 | Ga0070681_11385098 | Ga0070681_113850981 | 172 |
| 197 | 3300005539 | Ga0068853_100191054 | Ga0068853_1001910542 | 172 |
| 198 | 3300005548 | Ga0070665_100119196 | Ga0070665_1001191964 | 172 |
| 199 | 3300005564 | Ga0070664_100000015 | Ga0070664_1000000157 | 172 |
| 200 | 3300006058 | Ga0075432_10127030 | Ga0075432_101270302 | 172 |
| 201 | 3300006058 | Ga0075432_10182552 | Ga0075432_101825522 | 172 |
| 202 | 3300009011 | Ga0105251_10000287 | Ga0105251_1000028748 | 172 |
| 203 | 3300009011 | Ga0105251_10000398 | Ga0105251_1000039842 | 172 |
| 204 | 3300009011 | Ga0105251_10012826 | Ga0105251_100128263 | 172 |
| 205 | 3300009036 | Ga0105244_10003275 | Ga0105244_1000327512 | 172 |
| 206 | 3300009036 | Ga0105244_10020600 | Ga0105244_100206003 | 172 |
| 207 | 3300009176 | Ga0105242_10000003 | Ga0105242_1000000360 | 172 |
| 208 | 3300009545 | Ga0105237_10000009 | Ga0105237_1000000962 | 172 |
| 209 | 3300011119 | Ga0105246_10000001 | Ga0105246_1000000138 | 172 |
| 210 | 3300013100 | Ga0157373_10120667 | Ga0157373_101206672 | 172 |
| 211 | 3300013102 | Ga0157371_10000692 | Ga0157371_1000069244 | 172 |
| 212 | 3300013104 | Ga0157370_10083355 | Ga0157370_100833552 | 172 |
| 213 | 3300013105 | Ga0157369_10025170 | Ga0157369_100251708 | 172 |
| 214 | 3300013306 | Ga0163162_11261912 | Ga0163162_112619122 | 172 |
| 215 | 3300013308 | Ga0157375_10000689 | Ga0157375_1000068930 | 172 |
| 216 | 3300014497 | Ga0182008_10002586 | Ga0182008_1000258613 | 172 |
| 217 | 3300014497 | Ga0182008_10012090 | Ga0182008_100120902 | 172 |
| 218 | 3300015261 | Ga0182006_1005275 | Ga0182006_10052756 | 172 |
| 219 | 3300015261 | Ga0182006_1024537 | Ga0182006_10245373 | 172 |
| 220 | 3300015262 | Ga0182007_10000261 | Ga0182007_1000026111 | 172 |
| 221 | 3300015262 | Ga0182007_10004570 | Ga0182007_100045703 | 172 |
| 222 | 3300017792 | Ga0163161_10002142 | Ga0163161_100021422 | 172 |
| 223 | 3300025207 | Ga0209760_100007 | Ga0209760_100007112 | 172 |
| 224 | 3300025231 | Ga0207427_100018 | Ga0207427_100018289 | 172 |
| 225 | 3300025233 | Ga0209437_100031 | Ga0209437_100031289 | 172 |
| 226 | 3300025261 | Ga0209233_1000012 | Ga0209233_1000012287 | 172 |
| 227 | 3300025711 | Ga0207696_1007029 | Ga0207696_10070295 | 172 |
| 228 | 3300025728 | Ga0207655_1001030 | Ga0207655_100103014 | 172 |
| 229 | 3300025728 | Ga0207655_1004605 | Ga0207655_10046054 | 172 |
| 230 | 3300025735 | Ga0207713_1000140 | Ga0207713_100014073 | 172 |
| 231 | 3300025735 | Ga0207713_1000927 | Ga0207713_100092711 | 172 |
| 232 | 3300025735 | Ga0207713_1025095 | Ga0207713_10250954 | 172 |
| 233 | 3300025914 | Ga0207671_10000018 | Ga0207671_10000018180 | 172 |
| 234 | 3300025920 | Ga0207649_10000008 | Ga0207649_10000008172 | 172 |
| 235 | 3300025923 | Ga0207681_10002802 | Ga0207681_1000280211 | 172 |
| 236 | 3300025925 | Ga0207650_10000192 | Ga0207650_1000019216 | 172 |
| 237 | 3300025925 | Ga0207650_10000800 | Ga0207650_1000080015 | 172 |
| 238 | 3300025934 | Ga0207686_10000328 | Ga0207686_1000032823 | 172 |
| 239 | 3300025935 | Ga0207709_10000011 | Ga0207709_10000011425 | 172 |
| 240 | 3300025945 | Ga0207679_10000008 | Ga0207679_10000008217 | 172 |
| 241 | 3300026041 | Ga0207639_10017173 | Ga0207639_100171736 | 172 |
| 242 | 3300026067 | Ga0207678_10650129 | Ga0207678_106501292 | 172 |
| 243 | 3300027907 | Ga0207428_10196441 | Ga0207428_101964412 | 172 |
| 244 | 3300028379 | Ga0268266_10113467 | Ga0268266_101134672 | 172 |
| 245 | 3300031507 | Ga0307509_10485702 | Ga0307509_104857022 | 172 |
| 246 | 3300031548 | Ga0307408_100296967 | Ga0307408_1002969672 | 172 |
| 247 | 3300031731 | Ga0307405_10231879 | Ga0307405_102318792 | 172 |
| 248 | 3300031911 | Ga0307412_10002220 | Ga0307412_100022202 | 172 |
| 249 | 3300031911 | Ga0307412_10624820 | Ga0307412_106248202 | 172 |
| 250 | 3300031911 | Ga0307412_10735030 | Ga0307412_107350302 | 172 |
| 251 | 3300041405 | Ga0439438_000152 | Ga0439438_000152_20965_21483 | 172 |
| 252 | 3300041407 | Ga0439447_000773 | Ga0439447_000773_4115_4633 | 172 |
| 253 | 3300041411 | Ga0439466_0000573 | Ga0439466_0000573_8769_9287 | 172 |
| 254 | 3300042010 | Ga0439452_000528 | Ga0439452_000528_9573_10091 | 172 |
| 255 | 3300042013 | Ga0439456_005612 | Ga0439456_005612_1375_1893 | 172 |
| 256 | 3300046458 | Ga0495591_000005 | Ga0495591_000005_94165_94683 | 172 |
| 257 | 3300046460 | Ga0495638_0002158 | Ga0495638_0002158_6385_6903 | 172 |
| 258 | 3300046460 | Ga0495638_0345933 | Ga0495638_0345933_172_690 | 172 |
| 259 | 3300046463 | Ga0495653_0025528 | Ga0495653_0025528_4125_4643 | 172 |
| 260 | 3300046474 | Ga0495605_0001179 | Ga0495605_0001179_561_1079 | 172 |
| 261 | 3300046474 | Ga0495605_0018683 | Ga0495605_0018683_3155_3673 | 172 |
| 262 | 3300046474 | Ga0495605_0129345 | Ga0495605_0129345_33_551 | 172 |
| 263 | 3300046491 | Ga0495584_0000929 | Ga0495584_0000929_17966_18484 | 172 |
| 264 | 3300046501 | Ga0495607_0000167 | Ga0495607_0000167_56923_57441 | 172 |
| 265 | 3300046501 | Ga0495607_0144992 | Ga0495607_0144992_202_771 | 172 |
| 266 | 3300046507 | Ga0495606_0001025 | Ga0495606_0001025_25310_25828 | 172 |
| 267 | 3300046513 | Ga0495616_0003811 | Ga0495616_0003811_4457_4975 | 172 |
| 268 | 3300046519 | Ga0495632_0000428 | Ga0495632_0000428_24811_25329 | 172 |
| 269 | 3300046519 | Ga0495632_0071056 | Ga0495632_0071056_256_774 | 172 |
| 270 | 3300046519 | Ga0495632_0193586 | Ga0495632_0193586_349_867 | 172 |
| 271 | 3300046519 | Ga0495632_0203978 | Ga0495632_0203978_287_805 | 172 |
| 272 | 3300046524 | Ga0495648_0000545 | Ga0495648_0000545_14706_15224 | 172 |
| 273 | 3300046524 | Ga0495648_0008023 | Ga0495648_0008023_25_543 | 172 |
| 274 | 3300046524 | Ga0495648_0314876 | Ga0495648_0314876_174_692 | 172 |
| 275 | 3300046530 | Ga0495654_0039133 | Ga0495654_0039133_1091_1609 | 172 |
| 276 | 3300046538 | Ga0495609_0004229 | Ga0495609_0004229_2384_2965 | 172 |
| 277 | 3300046665 | Ga0495661_0041118 | Ga0495661_0041118_1945_2463 | 172 |
| 278 | 3300046680 | Ga0495646_0010277 | Ga0495646_0010277_5348_5866 | 172 |
| 279 | 3300046690 | Ga0495624_0000014 | Ga0495624_0000014_110483_111001 | 172 |
| 280 | 3300046692 | Ga0495671_0513580 | Ga0495671_0513580_19_537 | 172 |
| 281 | 3300047317 | Ga0495604_0004755 | Ga0495604_0004755_68_586 | 172 |
| 282 | 3300047320 | Ga0495672_0005954 | Ga0495672_0005954_8911_9429 | 172 |
| 283 | 3300047320 | Ga0495672_0014492 | Ga0495672_0014492_4478_4996 | 172 |
| 284 | 3300047322 | Ga0495680_0002577 | Ga0495680_0002577_70_588 | 172 |
| 285 | 3300047446 | Ga0495679_014495 | Ga0495679_014495_412_930 | 172 |
| 286 | 3300047469 | Ga0495673_0000178 | Ga0495673_0000178_14459_14977 | 172 |
| 287 | 3300047469 | Ga0495673_0003702 | Ga0495673_0003702_47_565 | 172 |
| 288 | 3300047470 | Ga0495681_0000026 | Ga0495681_0000026_56444_56962 | 172 |
| 289 | 3300047470 | Ga0495681_0272245 | Ga0495681_0272245_76_594 | 172 |
| 290 | 3300047673 | Ga0495593_0062472 | Ga0495593_0062472_30_548 | 172 |
| 291 | 3300048088 | Ga0495602_0002410 | Ga0495602_0002410_10_528 | 172 |
| 292 | 3300048091 | Ga0495626_0000132 | Ga0495626_0000132_6340_6858 | 172 |
| 293 | 3300048926 | Ga0496123_0252935 | Ga0496123_0252935_142_660 | 172 |
| 294 | 3300048927 | Ga0496124_0032568 | Ga0496124_0032568_4044_4562 | 172 |
| 295 | 3300048928 | Ga0496125_0085322 | Ga0496125_0085322_1129_1647 | 172 |
| 296 | 3300049459 | Ga0495678_005241 | Ga0495678_005241_4628_5146 | 172 |
| 297 | 3300049460 | Ga0495682_0001701 | Ga0495682_0001701_1584_2102 | 172 |
| 298 | 3300049460 | Ga0495682_0014337 | Ga0495682_0014337_2169_2687 | 172 |
| 299 | 3300053161 | Ga0500634_0155574 | Ga0500634_0155574_406_924 | 172 |
| 300 | iso_pu_bacteria | 2554235132 | 2554817425 | 172 |
| 301 | iso_pu_bacteria | 8019769354 | 8019773830 | 172 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4j10-assembly1.cif.gz_A | the crystal structure of a secreted protein esxb (semet-labeled) from bacillus anthracis str. sterne | 0.752 | 34 | 158 |
| 3o9o-assembly1.cif.gz_B | crystal structure of gbs1074, an esat-6 homologue from group b streptococcus | 0.7377 | 31 | 171 |
| 4j41-assembly1.cif.gz_A | the crystal structure of a secreted protein esxb (mutant p67a) from bacillus anthracis str. sterne | 0.7377 | 30 | 156 |
| 4j7k-assembly2.cif.gz_C | the crystal structure of a secreted protein esxb (mutant e54q) from bacillus anthracis str. sterne | 0.7331 | 34 | 158 |
| 3o9o-assembly1.cif.gz_B | crystal structure of gbs1074, an esat-6 homologue from group b streptococcus | 0.7309 | 31 | 171 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3zbhG00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ESAT-6-like | 0.762 | 35 | 161 | 1.10.287.1060 |
| 3zbhB00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ESAT-6-like | 0.7607 | 35 | 162 | 1.10.287.1060 |
| 4j41A00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;HP0062-like domain | 0.7377 | 30 | 156 | 1.10.287.850 |
| 3o9oB00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ESAT-6-like | 0.7377 | 31 | 171 | 1.10.287.1060 |
| 4j11C00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;HP0062-like domain | 0.7376 | 34 | 159 | 1.10.287.850 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0P9JNW3-F1-model_v4 | deleted | 0.9649 | 44 | 163 |
|
| AF-A0A4P7YBS7-F1-model_v4 | DUF3158 family protein | 0.9542 | 43 | 172 |
|
| AF-A0A3M5D3B4-F1-model_v4 | deleted | 0.9536 | 64 | 160 |
|
| AF-A0A4P7YBS7-F1-model_v4 | DUF3158 family protein | 0.9399 | 43 | 172 |
|
| AF-G8Q7T2-F1-model_v4 | deleted | 0.9318 | 65 | 170 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar