F396094

General Info

Members Datasets Scaffolds Average Seq Length
301 177 248 172

Family's Representative Sequence

Representative Sequence 3300046538|Ga0495609_0004229|Ga0495609_0004229_2384_2965
Length 193
Sequence MSHSLTQPGAPNDSLQQGAFKPLQQEAFVGLQHAPSLKGLLKPFKGKGGMELLAEQCGALEAGLNALAQESIHTQANRYPFTLLPVRMTLQRTGAGTVFLRWQDIGTRQMGVHVWARLVGDTKTPEHMIQDLHAMELQRIALNMQISLVHAIGRQAAECAEKMAQADAVYLERLDQITKSRGNEPQPSKEPRE

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
4 2511231004 Pseudomonas sp. GM102 Isolate Nodule
5 2511231022 Pseudomonas sp. GM79 Isolate Nodule
6 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
7 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
8 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
9 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
10 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
11 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
12 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
13 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
14 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
15 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
16 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
17 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
18 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
19 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
20 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
21 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
22 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
23 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
24 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
25 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
26 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
27 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
28 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
29 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
30 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
31 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
32 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
33 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
34 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
35 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
36 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
37 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
38 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
39 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
40 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
41 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
42 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
43 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
44 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
45 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
46 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
47 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
48 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
49 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
50 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
59 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
60 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
61 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
62 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
74 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
75 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
78 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
79 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
85 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
86 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
87 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
88 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
90 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
112 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
113 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
114 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
115 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
116 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
117 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
118 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
119 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
120 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
121 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
122 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
123 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
124 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
125 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
126 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
127 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
128 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
129 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
130 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
131 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
132 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
133 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
134 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
135 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
136 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
137 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
138 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
139 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
140 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
141 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
142 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
143 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
144 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
145 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
146 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
147 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
148 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
149 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
150 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
151 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
152 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
153 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
154 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
155 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
156 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
157 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
158 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
159 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
160 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
161 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
162 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
163 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
164 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
165 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
166 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
167 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
168 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
169 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
170 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
171 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
172 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
173 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
174 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
175 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
176 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
177 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.39
Metatranscriptomes 0
Isolates 17.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.97
Nodule 1.33
Rhizoplane 0.66
Rhizosphere 74.09
Stem 0
Stem Tuber 0
Unclassified 15.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_1159 2124908027 Bacteria 1677
2 MRS2a_Contig_6318 2124908027 Bacteria 6149
3 MRS2a_Contig_8937 2124908027 Bacteria 1836
4 SwRhRL2b_contig_3646279 2162886007 Bacteria 3769
5 SwRhRL2b_contig_776283 2162886007 Bacteria 7717
6 JGI25155J39150_1001593 3300002704 Bacteria 1497
7 JGI25162J39368_1000013 3300002737 Bacteria 343384
8 JGI25163J39215_1000076 3300002771 Bacteria 43942
9 JGI25164J39214_1000005 3300002772 Bacteria 343384
10 JGI25165J46597_1000128 3300003214 Bacteria 130710
11 Ga0055535_1002846 3300003761 Bacteria 5445
12 Ga0055535_1014845 3300003761 Bacteria 1107
13 Ga0065714_10003450 3300005288 Bacteria 7096
14 Ga0065714_10004408 3300005288 Bacteria 4961
15 Ga0065714_10005254 3300005288 Bacteria 4038
16 Ga0065714_10007507 3300005288 Bacteria 2861
17 Ga0065714_10023497 3300005288 Bacteria 1756
18 Ga0065714_10067982 3300005288 Bacteria 5041
19 Ga0065714_10070275 3300005288 Bacteria 3915
20 Ga0065714_10100229 3300005288 Bacteria 1668
21 Ga0065714_10100473 3300005288 Bacteria 1663
22 Ga0065714_10117528 3300005288 Bacteria 1390
23 Ga0065714_10250372 3300005288 Bacteria 776
24 Ga0065704_10001144 3300005289 Bacteria 10646
25 Ga0065704_10001245 3300005289 Bacteria 16693
26 Ga0065712_10067925 3300005290 Bacteria 20547
27 Ga0070670_100000444 3300005331 Bacteria 33600
28 Ga0070661_100000015 3300005344 Bacteria 156690
29 Ga0070661_100905136 3300005344 Bacteria 728
30 Ga0070669_100003537 3300005353 Bacteria 11270
31 Ga0070663_100641375 3300005455 Bacteria 897
32 Ga0070681_11385098 3300005458 Bacteria 627
33 Ga0068853_100191054 3300005539 Bacteria 1860
34 Ga0070665_100119196 3300005548 Bacteria 2641
35 Ga0070664_100000015 3300005564 Bacteria 128718
36 Ga0068854_100015529 3300005578 Bacteria 5047
37 Ga0068851_10000789 3300005834 Bacteria 13649
38 Ga0075432_10127030 3300006058 Bacteria 963
39 Ga0075432_10182552 3300006058 Bacteria 822
40 Ga0099823_1061700 3300006944 Bacteria 1923
41 Ga0105251_10000099 3300009011 Bacteria 84974
42 Ga0105251_10000287 3300009011 Bacteria 50861
43 Ga0105251_10000398 3300009011 Bacteria 42492
44 Ga0105251_10006027 3300009011 Bacteria 7816
45 Ga0105251_10012826 3300009011 Bacteria 4720
46 Ga0105251_10025277 3300009011 Bacteria 3040
47 Ga0105244_10003275 3300009036 Bacteria 11661
48 Ga0105244_10003704 3300009036 Bacteria 10791
49 Ga0105244_10020600 3300009036 Bacteria 3660
50 Ga0105250_10001169 3300009092 Bacteria 14755
51 Ga0105243_10000045 3300009148 Bacteria 156620
52 Ga0105243_10000426 3300009148 Bacteria 44238
53 Ga0105242_10000003 3300009176 Bacteria 226797
54 Ga0105237_10000009 3300009545 Bacteria 337615
55 Ga0105246_10000001 3300011119 Bacteria 200946
56 Ga0105246_10000005 3300011119 Bacteria 83893
57 Ga0157373_10120667 3300013100 Bacteria 1842
58 Ga0157373_10360751 3300013100 Bacteria 1037
59 Ga0157371_10000692 3300013102 Bacteria 39748
60 Ga0157371_10002623 3300013102 Bacteria 17075
61 Ga0157371_10319907 3300013102 Bacteria 1126
62 Ga0157370_10083355 3300013104 Bacteria 3006
63 Ga0157370_10945219 3300013104 Bacteria 781
64 Ga0157369_10002042 3300013105 Bacteria 24345
65 Ga0157369_10025170 3300013105 Bacteria 6608
66 Ga0157369_10026002 3300013105 Bacteria 6495
67 Ga0163162_10000146 3300013306 Bacteria 64972
68 Ga0163162_10000501 3300013306 Bacteria 36451
69 Ga0163162_10427070 3300013306 Bacteria 1457
70 Ga0163162_11261912 3300013306 Bacteria 839
71 Ga0157375_10000689 3300013308 Bacteria 29918
72 Ga0157375_10667593 3300013308 Bacteria 1195
73 Ga0182008_10002586 3300014497 Bacteria 11238
74 Ga0182008_10011358 3300014497 Bacteria 4741
75 Ga0182008_10012090 3300014497 Bacteria 4566
76 Ga0182006_1005275 3300015261 Bacteria 6184
77 Ga0182006_1024537 3300015261 Bacteria 2486
78 Ga0182007_10000261 3300015262 Bacteria 35265
79 Ga0182007_10004570 3300015262 Bacteria 6253
80 Ga0163161_10002142 3300017792 Bacteria 14240
81 Ga0163161_10005628 3300017792 Bacteria 8690
82 Ga0163161_10292237 3300017792 Bacteria 1281
83 Ga0209435_101058 3300025206 Bacteria 3894
84 Ga0209760_100007 3300025207 Bacteria 211381
85 Ga0209784_100286 3300025224 Bacteria 28184
86 Ga0209784_100372 3300025224 Bacteria 21158
87 Ga0209566_100484 3300025225 Bacteria 28184
88 Ga0209566_100645 3300025225 Bacteria 21084
89 Ga0209674_100338 3300025226 Bacteria 28184
90 Ga0209674_100411 3300025226 Bacteria 21158
91 Ga0209147_100629 3300025229 Bacteria 19024
92 Ga0209147_101026 3300025229 Bacteria 11898
93 Ga0209563_100223 3300025230 Bacteria 28184
94 Ga0209563_100285 3300025230 Bacteria 21158
95 Ga0207427_100018 3300025231 Bacteria 530735
96 Ga0209437_100031 3300025233 Bacteria 530871
97 Ga0209437_102412 3300025233 Bacteria 3624
98 Ga0209646_1000312 3300025246 Bacteria 38249
99 Ga0209026_1039449 3300025250 Bacteria 686
100 Ga0209677_100360 3300025253 Bacteria 28184
101 Ga0209677_100836 3300025253 Bacteria 15255
102 Ga0209759_1005357 3300025256 Bacteria 4518
103 Ga0209233_1000012 3300025261 Bacteria 1019519
104 Ga0207656_10000039 3300025321 Bacteria 55751
105 Ga0207696_1000794 3300025711 Bacteria 20575
106 Ga0207696_1007029 3300025711 Bacteria 4453
107 Ga0207655_1000782 3300025728 Bacteria 34897
108 Ga0207655_1001030 3300025728 Bacteria 28131
109 Ga0207655_1003864 3300025728 Bacteria 10904
110 Ga0207655_1004605 3300025728 Bacteria 9707
111 Ga0207713_1000098 3300025735 Bacteria 143900
112 Ga0207713_1000140 3300025735 Bacteria 108600
113 Ga0207713_1000927 3300025735 Bacteria 26323
114 Ga0207713_1025095 3300025735 Bacteria 2759
115 Ga0207671_10000018 3300025914 Bacteria 318130
116 Ga0207649_10000008 3300025920 Bacteria 315683
117 Ga0207681_10002802 3300025923 Bacteria 11033
118 Ga0207650_10000192 3300025925 Bacteria 70742
119 Ga0207650_10000800 3300025925 Bacteria 24152
120 Ga0207686_10000328 3300025934 Bacteria 34200
121 Ga0207709_10000011 3300025935 Bacteria 552881
122 Ga0207709_11683694 3300025935 Bacteria 527
123 Ga0207679_10000008 3300025945 Bacteria 412057
124 Ga0207640_10012796 3300025981 Bacteria 4791
125 Ga0207639_10017173 3300026041 Bacteria 5129
126 Ga0207678_10650129 3300026067 Bacteria 926
127 Ga0207428_10196441 3300027907 Bacteria 1519
128 Ga0268266_10113467 3300028379 Bacteria 2403
129 Ga0307509_10485702 3300031507 Bacteria 922
130 Ga0307408_100296967 3300031548 Bacteria 1351
131 Ga0307405_10231879 3300031731 Bacteria 1361
132 Ga0307412_10002220 3300031911 Bacteria 10778
133 Ga0307412_10624820 3300031911 Bacteria 915
134 Ga0307412_10735030 3300031911 Bacteria 850
135 Ga0439438_000152 3300041405 Bacteria 31450
136 Ga0439447_000773 3300041407 Bacteria 11770
137 Ga0439466_0000573 3300041411 Bacteria 13821
138 Ga0439451_001120 3300042009 Bacteria 5235
139 Ga0439452_000528 3300042010 Bacteria 20425
140 Ga0439456_005612 3300042013 Bacteria 2549
141 Ga0450903_010941 3300042138 Bacteria 1464
142 Ga0439446_0000647 3300042156 Bacteria 7221
143 Ga0495627_002493 3300046453 Bacteria 8792
144 Ga0495627_042205 3300046453 Bacteria 1399
145 Ga0495591_000005 3300046458 Bacteria 394092
146 Ga0495591_000365 3300046458 Bacteria 39027
147 Ga0495638_0002158 3300046460 Bacteria 16515
148 Ga0495638_0345933 3300046460 Bacteria 786
149 Ga0495653_0025528 3300046463 Bacteria 4746
150 Ga0495605_0000009 3300046474 Bacteria 324622
151 Ga0495605_0000050 3300046474 Bacteria 165667
152 Ga0495605_0000324 3300046474 Bacteria 49042
153 Ga0495605_0000338 3300046474 Bacteria 46528
154 Ga0495605_0001179 3300046474 Bacteria 17377
155 Ga0495605_0018683 3300046474 Bacteria 3710
156 Ga0495605_0048075 3300046474 Bacteria 2090
157 Ga0495605_0129345 3300046474 Bacteria 1139
158 Ga0495605_0243348 3300046474 Bacteria 771
159 Ga0495584_0000929 3300046491 Bacteria 18539
160 Ga0495594_0087949 3300046499 Bacteria 1739
161 Ga0495607_0000079 3300046501 Bacteria 97679
162 Ga0495607_0000135 3300046501 Bacteria 78019
163 Ga0495607_0000167 3300046501 Bacteria 69947
164 Ga0495607_0144992 3300046501 Bacteria 1221
165 Ga0495583_0000019 3300046506 Bacteria 298512
166 Ga0495606_0001025 3300046507 Bacteria 40534
167 Ga0495610_0001731 3300046512 Bacteria 19136
168 Ga0495610_0016934 3300046512 Bacteria 4174
169 Ga0495616_0003811 3300046513 Bacteria 9611
170 Ga0495620_0000017 3300046515 Bacteria 153019
171 Ga0495620_0000029 3300046515 Bacteria 122326
172 Ga0495631_0008672 3300046518 Bacteria 5116
173 Ga0495632_0000428 3300046519 Bacteria 40001
174 Ga0495632_0071056 3300046519 Bacteria 1673
175 Ga0495632_0193586 3300046519 Bacteria 928
176 Ga0495632_0203978 3300046519 Bacteria 899
177 Ga0495637_0000112 3300046520 Bacteria 58999
178 Ga0495648_0000545 3300046524 Bacteria 40564
179 Ga0495648_0008023 3300046524 Bacteria 8365
180 Ga0495648_0071795 3300046524 Bacteria 2005
181 Ga0495648_0314876 3300046524 Bacteria 728
182 Ga0495654_0000157 3300046530 Bacteria 67490
183 Ga0495654_0005247 3300046530 Bacteria 7563
184 Ga0495654_0039133 3300046530 Bacteria 2368
185 Ga0495654_0040222 3300046530 Bacteria 2331
186 Ga0495609_0000041 3300046538 Bacteria 171015
187 Ga0495609_0004229 3300046538 Bacteria 7935
188 Ga0495597_0014822 3300046542 Bacteria 3705
189 Ga0495611_0008534 3300046648 Bacteria 4332
190 Ga0495611_0027351 3300046648 Bacteria 2492
191 Ga0495625_0082289 3300046660 Bacteria 2239
192 Ga0495661_0000005 3300046665 Bacteria 433622
193 Ga0495661_0000031 3300046665 Bacteria 171518
194 Ga0495661_0041118 3300046665 Bacteria 2862
195 Ga0495646_0010277 3300046680 Bacteria 5952
196 Ga0495624_0000014 3300046690 Bacteria 111102
197 Ga0495670_0006975 3300046691 Bacteria 5566
198 Ga0495670_0011547 3300046691 Bacteria 4345
199 Ga0495670_0316791 3300046691 Bacteria 837
200 Ga0495671_0000193 3300046692 Bacteria 53391
201 Ga0495671_0013129 3300046692 Bacteria 4499
202 Ga0495671_0018670 3300046692 Bacteria 3677
203 Ga0495671_0513580 3300046692 Bacteria 571
204 Ga0495649_0000206 3300046694 Bacteria 51902
205 Ga0495589_0001810 3300046794 Bacteria 12157
206 Ga0495660_0000902 3300046810 Bacteria 21972
207 Ga0495660_0213795 3300046810 Bacteria 913
208 Ga0495604_0004755 3300047317 Bacteria 10755
209 Ga0495672_0005954 3300047320 Bacteria 9555
210 Ga0495672_0014492 3300047320 Bacteria 5397
211 Ga0495680_0002577 3300047322 Bacteria 18461
212 Ga0495683_0000004 3300047323 Bacteria 321136
213 Ga0495683_0005814 3300047323 Bacteria 6788
214 Ga0495679_000153 3300047446 Bacteria 61902
215 Ga0495679_014495 3300047446 Bacteria 2918
216 Ga0495679_020016 3300047446 Bacteria 2338
217 Ga0495673_0000178 3300047469 Bacteria 102182
218 Ga0495673_0003702 3300047469 Bacteria 9950
219 Ga0495681_0000026 3300047470 Bacteria 144911
220 Ga0495681_0272245 3300047470 Bacteria 662
221 Ga0495593_0062472 3300047673 Bacteria 1946
222 Ga0495602_0002410 3300048088 Bacteria 19003
223 Ga0495626_0000132 3300048091 Bacteria 94157
224 Ga0496117_0000309 3300048920 Bacteria 85072
225 Ga0496117_0004022 3300048920 Bacteria 16579
226 Ga0496118_0003289 3300048921 Bacteria 20561
227 Ga0496118_0007466 3300048921 Bacteria 11571
228 Ga0496118_0031835 3300048921 Bacteria 4362
229 Ga0496118_0423615 3300048921 Bacteria 684
230 Ga0496120_0049843 3300048923 Bacteria 2401
231 Ga0496121_0149412 3300048924 Bacteria 1721
232 Ga0496122_0029129 3300048925 Bacteria 4665
233 Ga0496122_0039370 3300048925 Bacteria 3770
234 Ga0496123_0007358 3300048926 Bacteria 10417
235 Ga0496123_0008193 3300048926 Bacteria 9638
236 Ga0496123_0252935 3300048926 Bacteria 868
237 Ga0496124_0002737 3300048927 Bacteria 22480
238 Ga0496124_0004708 3300048927 Bacteria 15749
239 Ga0496124_0032568 3300048927 Bacteria 4600
240 Ga0496125_0004549 3300048928 Bacteria 15915
241 Ga0496125_0085322 3300048928 Bacteria 2393
242 Ga0496126_0000456 3300048929 Bacteria 81301
243 Ga0496126_0003217 3300048929 Bacteria 20930
244 Ga0495678_000014 3300049459 Bacteria 313755
245 Ga0495678_005241 3300049459 Bacteria 7225
246 Ga0495682_0001701 3300049460 Bacteria 11189
247 Ga0495682_0014337 3300049460 Bacteria 3007
248 Ga0500634_0155574 3300053161 Bacteria 1062

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005289 Ga0065704_10001144 Ga0065704_100011442 145
2 3300025711 Ga0207696_1000794 Ga0207696_100079414 145
3 3300009036 Ga0105244_10003704 Ga0105244_100037048 150
4 3300025728 Ga0207655_1003864 Ga0207655_10038643 150
5 3300009011 Ga0105251_10025277 Ga0105251_100252772 151
6 3300006944 Ga0099823_1061700 Ga0099823_10617003 152
7 3300009092 Ga0105250_10001169 Ga0105250_100011697 152
8 3300017792 Ga0163161_10005628 Ga0163161_100056289 152
9 3300048921 Ga0496118_0423615 Ga0496118_0423615_110_658 152
10 3300048925 Ga0496122_0029129 Ga0496122_0029129_1537_2085 152
11 3300048926 Ga0496123_0008193 Ga0496123_0008193_4474_5022 152
12 3300048927 Ga0496124_0004708 Ga0496124_0004708_1080_1628 152
13 3300048928 Ga0496125_0004549 Ga0496125_0004549_1089_1637 152
14 3300048929 Ga0496126_0003217 Ga0496126_0003217_14187_14735 152
15 3300048923 Ga0496120_0049843 Ga0496120_0049843_744_1292 153
16 3300048927 Ga0496124_0002737 Ga0496124_0002737_4419_4955 154
17 3300009011 Ga0105251_10006027 Ga0105251_100060276 155
18 3300013105 Ga0157369_10026002 Ga0157369_100260022 155
19 3300013306 Ga0163162_10000501 Ga0163162_100005013 155
20 3300025728 Ga0207655_1000782 Ga0207655_100078213 155
21 3300048920 Ga0496117_0004022 Ga0496117_0004022_3135_3674 155
22 3300048921 Ga0496118_0007466 Ga0496118_0007466_7828_8367 155
23 3300002704 JGI25155J39150_1001593 JGI25155J39150_10015932 156
24 3300003761 Ga0055535_1002846 Ga0055535_10028462 156
25 3300009148 Ga0105243_10000426 Ga0105243_1000042611 156
26 3300025206 Ga0209435_101058 Ga0209435_1010581 156
27 3300025224 Ga0209784_100286 Ga0209784_10028614 156
28 3300025225 Ga0209566_100484 Ga0209566_10048413 156
29 3300025226 Ga0209674_100338 Ga0209674_10033813 156
30 3300025229 Ga0209147_100629 Ga0209147_1006297 156
31 3300025230 Ga0209563_100223 Ga0209563_10022313 156
32 3300025253 Ga0209677_100360 Ga0209677_10036013 156
33 3300025256 Ga0209759_1005357 Ga0209759_10053572 156
34 3300046453 Ga0495627_042205 Ga0495627_042205_619_1158 156
35 3300048920 Ga0496117_0000309 Ga0496117_0000309_83444_83983 156
36 3300048921 Ga0496118_0031835 Ga0496118_0031835_956_1495 156
37 3300046458 Ga0495591_000365 Ga0495591_000365_31565_32134 157
38 3300046499 Ga0495594_0087949 Ga0495594_0087949_208_777 157
39 3300046691 Ga0495670_0316791 Ga0495670_0316791_62_616 157
40 3300003761 Ga0055535_1014845 Ga0055535_10148452 158
41 3300005344 Ga0070661_100905136 Ga0070661_1009051362 158
42 3300005578 Ga0068854_100015529 Ga0068854_1000155296 158
43 3300005834 Ga0068851_10000789 Ga0068851_100007893 158
44 3300009011 Ga0105251_10000099 Ga0105251_1000009965 158
45 3300014497 Ga0182008_10011358 Ga0182008_100113584 158
46 3300025224 Ga0209784_100372 Ga0209784_10037216 158
47 3300025225 Ga0209566_100645 Ga0209566_10064516 158
48 3300025226 Ga0209674_100411 Ga0209674_10041116 158
49 3300025229 Ga0209147_101026 Ga0209147_10102613 158
50 3300025230 Ga0209563_100285 Ga0209563_10028516 158
51 3300025233 Ga0209437_102412 Ga0209437_1024124 158
52 3300025246 Ga0209646_1000312 Ga0209646_100031224 158
53 3300025250 Ga0209026_1039449 Ga0209026_10394492 158
54 3300025253 Ga0209677_100836 Ga0209677_10083617 158
55 3300025321 Ga0207656_10000039 Ga0207656_100000393 158
56 3300025735 Ga0207713_1000098 Ga0207713_100009826 158
57 3300025981 Ga0207640_10012796 Ga0207640_100127964 158
58 3300042138 Ga0450903_010941 Ga0450903_010941_533_1078 158
59 3300046520 Ga0495637_0000112 Ga0495637_0000112_17051_17602 158
60 3300046530 Ga0495654_0000157 Ga0495654_0000157_1000_1551 158
61 3300046692 Ga0495671_0000193 Ga0495671_0000193_41734_42285 158
62 3300046692 Ga0495671_0013129 Ga0495671_0013129_810_1385 158
63 3300048921 Ga0496118_0003289 Ga0496118_0003289_987_1532 158
64 3300046694 Ga0495649_0000206 Ga0495649_0000206_28384_28950 159
65 iso_pu_bacteria 2919481497 2919483898 159
66 iso_pu_bacteria 2931396565 2931400623 159
67 3300046501 Ga0495607_0000135 Ga0495607_0000135_13919_14485 160
68 3300046474 Ga0495605_0000009 Ga0495605_0000009_166312_166893 161
69 3300046506 Ga0495583_0000019 Ga0495583_0000019_171795_172376 161
70 3300046512 Ga0495610_0016934 Ga0495610_0016934_1232_1813 161
71 3300046515 Ga0495620_0000029 Ga0495620_0000029_11217_11798 161
72 3300046518 Ga0495631_0008672 Ga0495631_0008672_3492_4073 161
73 3300046530 Ga0495654_0005247 Ga0495654_0005247_619_1200 161
74 3300046538 Ga0495609_0000041 Ga0495609_0000041_119152_119733 161
75 3300046665 Ga0495661_0000031 Ga0495661_0000031_96933_97514 161
76 3300046691 Ga0495670_0006975 Ga0495670_0006975_1982_2563 161
77 3300046692 Ga0495671_0018670 Ga0495671_0018670_1601_2182 161
78 3300046794 Ga0495589_0001810 Ga0495589_0001810_1928_2509 161
79 3300046810 Ga0495660_0213795 Ga0495660_0213795_107_688 161
80 3300047446 Ga0495679_020016 Ga0495679_020016_1202_1783 161
81 3300013306 Ga0163162_10000146 Ga0163162_1000014611 162
82 3300013306 Ga0163162_10427070 Ga0163162_104270703 162
83 3300046648 Ga0495611_0008534 Ga0495611_0008534_1034_1615 162
84 2162886007 SwRhRL2b_contig_3646279 SwRhRL2b_0398.00002380 163
85 3300013102 Ga0157371_10002623 Ga0157371_100026232 163
86 3300013102 Ga0157371_10319907 Ga0157371_103199072 163
87 3300013105 Ga0157369_10002042 Ga0157369_100020422 163
88 3300046474 Ga0495605_0048075 Ga0495605_0048075_493_984 163
89 3300048924 Ga0496121_0149412 Ga0496121_0149412_946_1437 163
90 iso_pu_bacteria 2554235231 2555248763 163
91 3300013100 Ga0157373_10360751 Ga0157373_103607512 165
92 2124908027 MRS2a_Contig_8937 MRS2a_00779670 166
93 3300013104 Ga0157370_10945219 Ga0157370_109452192 166
94 3300017792 Ga0163161_10292237 Ga0163161_102922372 166
95 iso_pu_bacteria 2908446538 2908447483 166
96 3300025935 Ga0207709_11683694 Ga0207709_116836941 167
97 3300048925 Ga0496122_0039370 Ga0496122_0039370_1926_2429 167
98 3300048926 Ga0496123_0007358 Ga0496123_0007358_3406_3909 167
99 iso_pu_bacteria 2946027586 2946031739 167
100 3300046474 Ga0495605_0243348 Ga0495605_0243348_81_614 168
101 3300046501 Ga0495607_0000079 Ga0495607_0000079_22938_23471 168
102 3300046810 Ga0495660_0000902 Ga0495660_0000902_9061_9594 168
103 iso_pu_bacteria 2511231004 2511255478 168
104 iso_pu_bacteria 2511231022 2511365498 168
105 iso_pu_bacteria 2597489889 2597869153 168
106 iso_pu_bacteria 2599185179 2599451640 168
107 iso_pu_bacteria 2623620443 2624479854 168
108 iso_pu_bacteria 2738541294 2738806981 168
109 iso_pu_bacteria 2738541294 2738812372 168
110 iso_pu_bacteria 2738541294 2738812384 168
111 iso_pu_bacteria 2738541309 2738894341 168
112 iso_pu_bacteria 2738541309 2738899733 168
113 iso_pu_bacteria 2738541309 2738899745 168
114 iso_pu_bacteria 2808606385 2808979866 168
115 iso_pu_bacteria 2808606385 2808979906 168
116 iso_pu_bacteria 2808606388 2808995706 168
117 iso_pu_bacteria 2808606388 2808995746 168
118 iso_pu_bacteria 2816332298 2817490263 168
119 iso_pu_bacteria 2834028612 2834030648 168
120 iso_pu_bacteria 2842826826 2842827906 168
121 iso_pu_bacteria 2842837860 2842839611 168
122 iso_pu_bacteria 2852612431 2852617760 168
123 iso_pu_bacteria 2852667396 2852672876 168
124 iso_pu_bacteria 2860339153 2860339503 168
125 iso_pu_bacteria 2913036834 2913041259 168
126 iso_pu_bacteria 2929144301 2929146588 168
127 iso_pu_bacteria 2931369376 2931370102 168
128 iso_pu_bacteria 2945961074 2945963654 168
129 iso_pu_bacteria 2946006987 2946009890 168
130 iso_pu_bacteria 2947233263 2947236881 168
131 iso_pu_bacteria 8019775933 8019779797 168
132 iso_pu_bacteria 8054285046 8054289769 168
133 iso_pu_bacteria 8055817908 8055820881 168
134 iso_pu_bacteria 8056131705 8056133943 168
135 iso_pu_bacteria 8056155041 8056155886 168
136 3300009148 Ga0105243_10000045 Ga0105243_1000004592 169
137 3300046474 Ga0495605_0000324 Ga0495605_0000324_47668_48207 169
138 3300046474 Ga0495605_0000338 Ga0495605_0000338_44341_44853 169
139 3300046530 Ga0495654_0040222 Ga0495654_0040222_1631_2143 169
140 3300046660 Ga0495625_0082289 Ga0495625_0082289_355_894 169
141 3300047323 Ga0495683_0005814 Ga0495683_0005814_5761_6270 169
142 iso_pu_bacteria 2643221713 2644623711 169
143 iso_pu_bacteria 2643221713 2644624872 169
144 iso_pu_bacteria 2852612431 2852615797 169
145 iso_pu_bacteria 2852667396 2852670765 169
146 iso_pu_bacteria 2929189879 2929190743 169
147 iso_pu_bacteria 2945961074 2945966095 169
148 iso_pu_bacteria 637000220 637322007 169
149 3300005288 Ga0065714_10070275 Ga0065714_100702752 170
150 3300046453 Ga0495627_002493 Ga0495627_002493_298_867 170
151 3300046474 Ga0495605_0000050 Ga0495605_0000050_115059_115628 170
152 3300046512 Ga0495610_0001731 Ga0495610_0001731_7479_8051 170
153 3300046515 Ga0495620_0000017 Ga0495620_0000017_101410_101979 170
154 3300046524 Ga0495648_0071795 Ga0495648_0071795_360_929 170
155 3300046542 Ga0495597_0014822 Ga0495597_0014822_889_1458 170
156 3300046648 Ga0495611_0027351 Ga0495611_0027351_1115_1684 170
157 3300046665 Ga0495661_0000005 Ga0495661_0000005_365752_366321 170
158 3300046691 Ga0495670_0011547 Ga0495670_0011547_549_1118 170
159 3300047323 Ga0495683_0000004 Ga0495683_0000004_270527_271096 170
160 3300047446 Ga0495679_000153 Ga0495679_000153_50009_50578 170
161 3300048929 Ga0496126_0000456 Ga0496126_0000456_70861_71433 170
162 3300049459 Ga0495678_000014 Ga0495678_000014_50625_51194 170
163 iso_pu_bacteria 2510065058 2510309603 170
164 iso_pu_bacteria 2675903420 2677899775 170
165 iso_pu_bacteria 2826581358 2826584386 170
166 iso_pu_bacteria 2842849001 2842849427 170
167 iso_pu_bacteria 2917832318 2917834016 170
168 iso_pu_bacteria 3007419365 3007423660 170
169 3300005288 Ga0065714_10100473 Ga0065714_101004732 171
170 3300011119 Ga0105246_10000005 Ga0105246_1000000558 171
171 3300013308 Ga0157375_10667593 Ga0157375_106675932 171
172 3300042009 Ga0439451_001120 Ga0439451_001120_4123_4638 171
173 3300042156 Ga0439446_0000647 Ga0439446_0000647_2092_2610 171
174 2124908027 MRS2a_Contig_1159 MRS2a_00058230 172
175 2124908027 MRS2a_Contig_6318 MRS2a_00217590 172
176 2162886007 SwRhRL2b_contig_776283 SwRhRL2b_0841.00009170 172
177 3300002737 JGI25162J39368_1000013 JGI25162J39368_1000013120 172
178 3300002771 JGI25163J39215_1000076 JGI25163J39215_100007637 172
179 3300002772 JGI25164J39214_1000005 JGI25164J39214_1000005120 172
180 3300003214 JGI25165J46597_1000128 JGI25165J46597_100012870 172
181 3300005288 Ga0065714_10003450 Ga0065714_100034508 172
182 3300005288 Ga0065714_10004408 Ga0065714_100044084 172
183 3300005288 Ga0065714_10005254 Ga0065714_100052543 172
184 3300005288 Ga0065714_10007507 Ga0065714_100075073 172
185 3300005288 Ga0065714_10023497 Ga0065714_100234973 172
186 3300005288 Ga0065714_10067982 Ga0065714_100679822 172
187 3300005288 Ga0065714_10100229 Ga0065714_101002292 172
188 3300005288 Ga0065714_10117528 Ga0065714_101175282 172
189 3300005288 Ga0065714_10250372 Ga0065714_102503722 172
190 3300005289 Ga0065704_10001245 Ga0065704_100012452 172
191 3300005290 Ga0065712_10067925 Ga0065712_1006792518 172
192 3300005331 Ga0070670_100000444 Ga0070670_10000044423 172
193 3300005344 Ga0070661_100000015 Ga0070661_10000001596 172
194 3300005353 Ga0070669_100003537 Ga0070669_1000035373 172
195 3300005455 Ga0070663_100641375 Ga0070663_1006413752 172
196 3300005458 Ga0070681_11385098 Ga0070681_113850981 172
197 3300005539 Ga0068853_100191054 Ga0068853_1001910542 172
198 3300005548 Ga0070665_100119196 Ga0070665_1001191964 172
199 3300005564 Ga0070664_100000015 Ga0070664_1000000157 172
200 3300006058 Ga0075432_10127030 Ga0075432_101270302 172
201 3300006058 Ga0075432_10182552 Ga0075432_101825522 172
202 3300009011 Ga0105251_10000287 Ga0105251_1000028748 172
203 3300009011 Ga0105251_10000398 Ga0105251_1000039842 172
204 3300009011 Ga0105251_10012826 Ga0105251_100128263 172
205 3300009036 Ga0105244_10003275 Ga0105244_1000327512 172
206 3300009036 Ga0105244_10020600 Ga0105244_100206003 172
207 3300009176 Ga0105242_10000003 Ga0105242_1000000360 172
208 3300009545 Ga0105237_10000009 Ga0105237_1000000962 172
209 3300011119 Ga0105246_10000001 Ga0105246_1000000138 172
210 3300013100 Ga0157373_10120667 Ga0157373_101206672 172
211 3300013102 Ga0157371_10000692 Ga0157371_1000069244 172
212 3300013104 Ga0157370_10083355 Ga0157370_100833552 172
213 3300013105 Ga0157369_10025170 Ga0157369_100251708 172
214 3300013306 Ga0163162_11261912 Ga0163162_112619122 172
215 3300013308 Ga0157375_10000689 Ga0157375_1000068930 172
216 3300014497 Ga0182008_10002586 Ga0182008_1000258613 172
217 3300014497 Ga0182008_10012090 Ga0182008_100120902 172
218 3300015261 Ga0182006_1005275 Ga0182006_10052756 172
219 3300015261 Ga0182006_1024537 Ga0182006_10245373 172
220 3300015262 Ga0182007_10000261 Ga0182007_1000026111 172
221 3300015262 Ga0182007_10004570 Ga0182007_100045703 172
222 3300017792 Ga0163161_10002142 Ga0163161_100021422 172
223 3300025207 Ga0209760_100007 Ga0209760_100007112 172
224 3300025231 Ga0207427_100018 Ga0207427_100018289 172
225 3300025233 Ga0209437_100031 Ga0209437_100031289 172
226 3300025261 Ga0209233_1000012 Ga0209233_1000012287 172
227 3300025711 Ga0207696_1007029 Ga0207696_10070295 172
228 3300025728 Ga0207655_1001030 Ga0207655_100103014 172
229 3300025728 Ga0207655_1004605 Ga0207655_10046054 172
230 3300025735 Ga0207713_1000140 Ga0207713_100014073 172
231 3300025735 Ga0207713_1000927 Ga0207713_100092711 172
232 3300025735 Ga0207713_1025095 Ga0207713_10250954 172
233 3300025914 Ga0207671_10000018 Ga0207671_10000018180 172
234 3300025920 Ga0207649_10000008 Ga0207649_10000008172 172
235 3300025923 Ga0207681_10002802 Ga0207681_1000280211 172
236 3300025925 Ga0207650_10000192 Ga0207650_1000019216 172
237 3300025925 Ga0207650_10000800 Ga0207650_1000080015 172
238 3300025934 Ga0207686_10000328 Ga0207686_1000032823 172
239 3300025935 Ga0207709_10000011 Ga0207709_10000011425 172
240 3300025945 Ga0207679_10000008 Ga0207679_10000008217 172
241 3300026041 Ga0207639_10017173 Ga0207639_100171736 172
242 3300026067 Ga0207678_10650129 Ga0207678_106501292 172
243 3300027907 Ga0207428_10196441 Ga0207428_101964412 172
244 3300028379 Ga0268266_10113467 Ga0268266_101134672 172
245 3300031507 Ga0307509_10485702 Ga0307509_104857022 172
246 3300031548 Ga0307408_100296967 Ga0307408_1002969672 172
247 3300031731 Ga0307405_10231879 Ga0307405_102318792 172
248 3300031911 Ga0307412_10002220 Ga0307412_100022202 172
249 3300031911 Ga0307412_10624820 Ga0307412_106248202 172
250 3300031911 Ga0307412_10735030 Ga0307412_107350302 172
251 3300041405 Ga0439438_000152 Ga0439438_000152_20965_21483 172
252 3300041407 Ga0439447_000773 Ga0439447_000773_4115_4633 172
253 3300041411 Ga0439466_0000573 Ga0439466_0000573_8769_9287 172
254 3300042010 Ga0439452_000528 Ga0439452_000528_9573_10091 172
255 3300042013 Ga0439456_005612 Ga0439456_005612_1375_1893 172
256 3300046458 Ga0495591_000005 Ga0495591_000005_94165_94683 172
257 3300046460 Ga0495638_0002158 Ga0495638_0002158_6385_6903 172
258 3300046460 Ga0495638_0345933 Ga0495638_0345933_172_690 172
259 3300046463 Ga0495653_0025528 Ga0495653_0025528_4125_4643 172
260 3300046474 Ga0495605_0001179 Ga0495605_0001179_561_1079 172
261 3300046474 Ga0495605_0018683 Ga0495605_0018683_3155_3673 172
262 3300046474 Ga0495605_0129345 Ga0495605_0129345_33_551 172
263 3300046491 Ga0495584_0000929 Ga0495584_0000929_17966_18484 172
264 3300046501 Ga0495607_0000167 Ga0495607_0000167_56923_57441 172
265 3300046501 Ga0495607_0144992 Ga0495607_0144992_202_771 172
266 3300046507 Ga0495606_0001025 Ga0495606_0001025_25310_25828 172
267 3300046513 Ga0495616_0003811 Ga0495616_0003811_4457_4975 172
268 3300046519 Ga0495632_0000428 Ga0495632_0000428_24811_25329 172
269 3300046519 Ga0495632_0071056 Ga0495632_0071056_256_774 172
270 3300046519 Ga0495632_0193586 Ga0495632_0193586_349_867 172
271 3300046519 Ga0495632_0203978 Ga0495632_0203978_287_805 172
272 3300046524 Ga0495648_0000545 Ga0495648_0000545_14706_15224 172
273 3300046524 Ga0495648_0008023 Ga0495648_0008023_25_543 172
274 3300046524 Ga0495648_0314876 Ga0495648_0314876_174_692 172
275 3300046530 Ga0495654_0039133 Ga0495654_0039133_1091_1609 172
276 3300046538 Ga0495609_0004229 Ga0495609_0004229_2384_2965 172
277 3300046665 Ga0495661_0041118 Ga0495661_0041118_1945_2463 172
278 3300046680 Ga0495646_0010277 Ga0495646_0010277_5348_5866 172
279 3300046690 Ga0495624_0000014 Ga0495624_0000014_110483_111001 172
280 3300046692 Ga0495671_0513580 Ga0495671_0513580_19_537 172
281 3300047317 Ga0495604_0004755 Ga0495604_0004755_68_586 172
282 3300047320 Ga0495672_0005954 Ga0495672_0005954_8911_9429 172
283 3300047320 Ga0495672_0014492 Ga0495672_0014492_4478_4996 172
284 3300047322 Ga0495680_0002577 Ga0495680_0002577_70_588 172
285 3300047446 Ga0495679_014495 Ga0495679_014495_412_930 172
286 3300047469 Ga0495673_0000178 Ga0495673_0000178_14459_14977 172
287 3300047469 Ga0495673_0003702 Ga0495673_0003702_47_565 172
288 3300047470 Ga0495681_0000026 Ga0495681_0000026_56444_56962 172
289 3300047470 Ga0495681_0272245 Ga0495681_0272245_76_594 172
290 3300047673 Ga0495593_0062472 Ga0495593_0062472_30_548 172
291 3300048088 Ga0495602_0002410 Ga0495602_0002410_10_528 172
292 3300048091 Ga0495626_0000132 Ga0495626_0000132_6340_6858 172
293 3300048926 Ga0496123_0252935 Ga0496123_0252935_142_660 172
294 3300048927 Ga0496124_0032568 Ga0496124_0032568_4044_4562 172
295 3300048928 Ga0496125_0085322 Ga0496125_0085322_1129_1647 172
296 3300049459 Ga0495678_005241 Ga0495678_005241_4628_5146 172
297 3300049460 Ga0495682_0001701 Ga0495682_0001701_1584_2102 172
298 3300049460 Ga0495682_0014337 Ga0495682_0014337_2169_2687 172
299 3300053161 Ga0500634_0155574 Ga0500634_0155574_406_924 172
300 iso_pu_bacteria 2554235132 2554817425 172
301 iso_pu_bacteria 8019769354 8019773830 172

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11358

DUF3158

Protein of unknown function (DUF3158)

20

175

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4j10-assembly1.cif.gz_A the crystal structure of a secreted protein esxb (semet-labeled) from bacillus anthracis str. sterne 0.752 34 158
3o9o-assembly1.cif.gz_B crystal structure of gbs1074, an esat-6 homologue from group b streptococcus 0.7377 31 171
4j41-assembly1.cif.gz_A the crystal structure of a secreted protein esxb (mutant p67a) from bacillus anthracis str. sterne 0.7377 30 156
4j7k-assembly2.cif.gz_C the crystal structure of a secreted protein esxb (mutant e54q) from bacillus anthracis str. sterne 0.7331 34 158
3o9o-assembly1.cif.gz_B crystal structure of gbs1074, an esat-6 homologue from group b streptococcus 0.7309 31 171
ID Description Score Start End Superfamily
3zbhG00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ESAT-6-like 0.762 35 161 1.10.287.1060
3zbhB00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ESAT-6-like 0.7607 35 162 1.10.287.1060
4j41A00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;HP0062-like domain 0.7377 30 156 1.10.287.850
3o9oB00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ESAT-6-like 0.7377 31 171 1.10.287.1060
4j11C00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;HP0062-like domain 0.7376 34 159 1.10.287.850
ID Description Score Start End GO Terms
AF-A0A0P9JNW3-F1-model_v4 deleted 0.9649 44 163
AF-A0A4P7YBS7-F1-model_v4 DUF3158 family protein 0.9542 43 172
AF-A0A3M5D3B4-F1-model_v4 deleted 0.9536 64 160
AF-A0A4P7YBS7-F1-model_v4 DUF3158 family protein 0.9399 43 172
AF-G8Q7T2-F1-model_v4 deleted 0.9318 65 170

Feature Viewer

pLDDT pTM Quality
84.92 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map