F395050

General Info

Members Datasets Scaffolds Average Seq Length
299 177 598 310

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0000245|Ga0501034_0000245_41338_42426
Length 362
Sequence VILFCGIPDEPPLAMAIAEAERQEVPHVILNQHEATFCGMRLEAAAGVLAGELILQNRGWPLGAFTSVYSRLTDWQSLPDLQRADTRTRRRVQMFHQLLSEWLELGGMHVVNRLAPTTTNMSKPYQAQIITREGFLTPITLVTNDPEEAQRFVREHGRVIYKSASGVRSIVREVSTADLGRLEQVKCLPTQFQAFVSGTNIRVHVIGEEVFASQVETAAVDYRYAGRDSVEVSLAATELPEDVASRCRRLSQRLELPFCGIDLKRTEEGNYYCFEVNPSPAYSYYEQQTGQPIAAALVKYLASFDRRPGAGRGASDEPNCGKLVRTSRSGGGSDRGEPAGVGDGVAASEGEPCRAAVPQLDA

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
135 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
140 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
141 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
142 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
143 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
144 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
145 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
146 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
147 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
150 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
151 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
152 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
153 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
156 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
157 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
158 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
159 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
160 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
164 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
165 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
166 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
167 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
168 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
171 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
172 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
173 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
174 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
175 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
176 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
177 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1
Nodule 0
Rhizoplane 2.01
Rhizosphere 93.65
Stem 0
Stem Tuber 0
Unclassified 18.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0000245 3300049571 Bacteria 100221
2 JGI25406J46586_10001098 3300003203 Bacteria 12701
3 rootH2_10067786 3300003320 Bacteria 5120
4 rootH1_10190048 3300003323 Unclassified 4696
5 rootH1_10380352 3300003323 Bacteria 1291
6 JGI25404J52841_10013260 3300003659 Bacteria 1787
7 Ga0065712_10015116 3300005290 Bacteria 1529
8 Ga0065715_10267764 3300005293 Bacteria 1119
9 Ga0070658_10013907 3300005327 Bacteria 6460
10 Ga0070683_100087396 3300005329 Bacteria 2924
11 Ga0070690_100002579 3300005330 Bacteria 9754
12 Ga0070690_100084208 3300005330 Bacteria 2084
13 Ga0070670_100024791 3300005331 Bacteria 5160
14 Ga0070670_100211464 3300005331 Bacteria 1686
15 Ga0070670_100222313 3300005331 Unclassified 1643
16 Ga0070670_100323272 3300005331 Unclassified 1352
17 Ga0068869_100014867 3300005334 Bacteria 5204
18 Ga0068869_100019042 3300005334 Bacteria 4683
19 Ga0070666_10039982 3300005335 Bacteria 3128
20 Ga0068868_100082118 3300005338 Bacteria 2584
21 Ga0068868_100121120 3300005338 Bacteria 2134
22 Ga0070660_100108636 3300005339 Bacteria 2205
23 Ga0070689_100052648 3300005340 Bacteria 3149
24 Ga0070689_100063500 3300005340 Bacteria 2874
25 Ga0070689_100132480 3300005340 Bacteria 1999
26 Ga0070689_100586503 3300005340 Bacteria 964
27 Ga0070687_100004536 3300005343 Bacteria 5546
28 Ga0070687_100083544 3300005343 Bacteria 1749
29 Ga0070661_100009238 3300005344 Bacteria 6815
30 Ga0070692_10172320 3300005345 Unclassified 1248
31 Ga0070669_100006852 3300005353 Bacteria 8195
32 Ga0070669_100247615 3300005353 Bacteria 1418
33 Ga0070675_100173770 3300005354 Unclassified 1859
34 Ga0070675_100305715 3300005354 Unclassified 1402
35 Ga0070671_100020774 3300005355 Bacteria 5355
36 Ga0070671_100132431 3300005355 Bacteria 2100
37 Ga0070671_100137158 3300005355 Bacteria 2063
38 Ga0070674_100025162 3300005356 Bacteria 3871
39 Ga0070673_100007972 3300005364 Bacteria 7017
40 Ga0070673_100014632 3300005364 Bacteria 5475
41 Ga0070673_100101694 3300005364 Bacteria 2368
42 Ga0070673_100485313 3300005364 Unclassified 1116
43 Ga0070688_100011540 3300005365 Bacteria 4912
44 Ga0070688_100021162 3300005365 Unclassified 3795
45 Ga0070659_100029704 3300005366 Bacteria 4225
46 Ga0070659_100108254 3300005366 Bacteria 2242
47 Ga0070714_100432477 3300005435 Bacteria 1248
48 Ga0070701_10095047 3300005438 Bacteria 1640
49 Ga0070701_10148155 3300005438 Unclassified 1349
50 Ga0070711_100115189 3300005439 Bacteria 1979
51 Ga0070705_100015504 3300005440 Bacteria 3943
52 Ga0070700_100199048 3300005441 Bacteria 1406
53 Ga0070708_100355641 3300005445 Bacteria 1380
54 Ga0070678_100116321 3300005456 Bacteria 2101
55 Ga0070681_10027094 3300005458 Bacteria 5762
56 Ga0068867_100056884 3300005459 Bacteria 2895
57 Ga0070698_100131028 3300005471 Bacteria 2463
58 Ga0070679_100012632 3300005530 Bacteria 8077
59 Ga0070697_100005474 3300005536 Bacteria 9785
60 Ga0068853_100182290 3300005539 Bacteria 1905
61 Ga0070672_100002628 3300005543 Bacteria 11486
62 Ga0070672_100011911 3300005543 Bacteria 6080
63 Ga0070686_100076906 3300005544 Bacteria 2199
64 Ga0070664_100058580 3300005564 Bacteria 3276
65 Ga0070664_100130954 3300005564 Bacteria 2203
66 Ga0068857_100000277 3300005577 Bacteria 35101
67 Ga0068857_100256502 3300005577 Bacteria 1604
68 Ga0068854_100022682 3300005578 Bacteria 4282
69 Ga0068856_100003936 3300005614 Bacteria 14882
70 Ga0070702_100056744 3300005615 Bacteria 2263
71 Ga0070702_100145283 3300005615 Bacteria 1516
72 Ga0068852_100244902 3300005616 Bacteria 1715
73 Ga0068852_100413394 3300005616 Unclassified 1329
74 Ga0068859_100023308 3300005617 Bacteria 6212
75 Ga0068859_100029045 3300005617 Bacteria 5548
76 Ga0068859_100029259 3300005617 Bacteria 5527
77 Ga0068859_100109976 3300005617 Bacteria 2817
78 Ga0068859_100128164 3300005617 Bacteria 2608
79 Ga0068859_100190465 3300005617 Bacteria 2135
80 Ga0068859_100268590 3300005617 Bacteria 1798
81 Ga0068864_100016064 3300005618 Bacteria 6228
82 Ga0068864_100073099 3300005618 Bacteria 2989
83 Ga0068864_100160801 3300005618 Bacteria 2041
84 Ga0068866_10005509 3300005718 Bacteria 5229
85 Ga0068866_10107716 3300005718 Bacteria 1549
86 Ga0068861_100054416 3300005719 Bacteria 3048
87 Ga0068861_100069971 3300005719 Bacteria 2716
88 Ga0068861_100429767 3300005719 Bacteria 1178
89 Ga0068870_10005508 3300005840 Bacteria 5530
90 Ga0068870_10100277 3300005840 Unclassified 1635
91 Ga0068863_100028110 3300005841 Bacteria 5369
92 Ga0068863_100250798 3300005841 Unclassified 1710
93 Ga0068858_100044170 3300005842 Bacteria 4132
94 Ga0068858_100139955 3300005842 Bacteria 2271
95 Ga0068858_100308696 3300005842 Bacteria 1510
96 Ga0068860_100035161 3300005843 Bacteria 4807
97 Ga0068860_100114766 3300005843 Bacteria 2575
98 Ga0068860_100201722 3300005843 Bacteria 1928
99 Ga0068860_100288955 3300005843 Bacteria 1604
100 Ga0068862_100030941 3300005844 Bacteria 4513
101 Ga0068862_100109353 3300005844 Bacteria 2425
102 Ga0068862_100294467 3300005844 Bacteria 1491
103 Ga0081540_1000126 3300005983 Bacteria 81203
104 Ga0081539_10000145 3300005985 Bacteria 165008
105 Ga0081539_10002759 3300005985 Bacteria 23642
106 Ga0081539_10039738 3300005985 Bacteria 2772
107 Ga0097621_100255987 3300006237 Unclassified 1534
108 Ga0068871_100004995 3300006358 Bacteria 9269
109 Ga0075430_100010831 3300006846 Bacteria 7724
110 Ga0075430_100045109 3300006846 Unclassified 3725
111 Ga0075430_100125650 3300006846 Bacteria 2138
112 Ga0075431_100015060 3300006847 Bacteria 7831
113 Ga0075434_100350058 3300006871 Unclassified 1498
114 Ga0068865_100005912 3300006881 Bacteria 7445
115 Ga0097620_100023308 3300006931 Bacteria 6212
116 Ga0097620_100029045 3300006931 Bacteria 5548
117 Ga0097620_100029258 3300006931 Bacteria 5527
118 Ga0097620_100109975 3300006931 Bacteria 2817
119 Ga0097620_100128167 3300006931 Bacteria 2608
120 Ga0097620_100190466 3300006931 Bacteria 2135
121 Ga0097620_100268581 3300006931 Bacteria 1798
122 Ga0105250_10070143 3300009092 Unclassified 1415
123 Ga0111539_10060980 3300009094 Bacteria 4469
124 Ga0111539_10198970 3300009094 Unclassified 2337
125 Ga0105245_10011313 3300009098 Bacteria 7769
126 Ga0105245_10133405 3300009098 Bacteria 2331
127 Ga0105245_10479345 3300009098 Bacteria 1257
128 Ga0114129_10178107 3300009147 Bacteria 2894
129 Ga0105243_10035937 3300009148 Bacteria 3842
130 Ga0105243_10083803 3300009148 Bacteria 2609
131 Ga0105241_10050052 3300009174 Bacteria 3183
132 Ga0105242_10001276 3300009176 Bacteria 19908
133 Ga0105242_10094300 3300009176 Unclassified 2525
134 Ga0105248_10016382 3300009177 Bacteria 8157
135 Ga0105248_10146516 3300009177 Bacteria 2664
136 Ga0105249_10115009 3300009553 Unclassified 2548
137 Ga0105249_10330976 3300009553 Bacteria 1537
138 Ga0105239_10565106 3300010375 Unclassified 1296
139 Ga0157374_10031562 3300013296 Bacteria 4817
140 Ga0157378_10051973 3300013297 Bacteria 3646
141 Ga0157378_10202893 3300013297 Bacteria 1876
142 Ga0163162_10024061 3300013306 Bacteria 6011
143 Ga0163162_10394820 3300013306 Unclassified 1516
144 Ga0163162_10531136 3300013306 Bacteria 1306
145 Ga0157372_10195558 3300013307 Bacteria 2343
146 Ga0157372_10499986 3300013307 Bacteria 1418
147 Ga0157372_10576672 3300013307 Bacteria 1311
148 Ga0157375_10220154 3300013308 Bacteria 2056
149 Ga0163163_10021468 3300014325 Bacteria 6094
150 Ga0163163_10072997 3300014325 Bacteria 3421
151 Ga0157380_10029942 3300014326 Bacteria 4165
152 Ga0157380_10287180 3300014326 Bacteria 1508
153 Ga0157380_10648841 3300014326 Bacteria 1052
154 Ga0157379_10053979 3300014968 Bacteria 3591
155 Ga0157379_10374504 3300014968 Unclassified 1306
156 Ga0157376_10011021 3300014969 Bacteria 6644
157 Ga0157376_10020979 3300014969 Bacteria 5067
158 Ga0157376_10145461 3300014969 Bacteria 2131
159 Ga0163161_10038614 3300017792 Bacteria 3425
160 Ga0213876_10000383 3300021384 Bacteria 37442
161 Ga0213876_10017634 3300021384 Bacteria 3767
162 Ga0207697_10020217 3300025315 Bacteria 2726
163 Ga0207642_10003018 3300025899 Bacteria 5276
164 Ga0207680_10025303 3300025903 Bacteria 3273
165 Ga0207645_10033282 3300025907 Bacteria 3313
166 Ga0207643_10005146 3300025908 Bacteria 6995
167 Ga0207643_10022629 3300025908 Bacteria 3462
168 Ga0207705_10013046 3300025909 Bacteria 5996
169 Ga0207707_10010442 3300025912 Bacteria 8058
170 Ga0207663_10088212 3300025916 Bacteria 2051
171 Ga0207662_10003535 3300025918 Bacteria 8056
172 Ga0207662_10103551 3300025918 Bacteria 1766
173 Ga0207657_10115800 3300025919 Bacteria 2209
174 Ga0207649_10114068 3300025920 Bacteria 1811
175 Ga0207652_10053725 3300025921 Bacteria 3461
176 Ga0207681_10030905 3300025923 Unclassified 3495
177 Ga0207650_10016534 3300025925 Bacteria 5159
178 Ga0207650_10035578 3300025925 Unclassified 3618
179 Ga0207650_10234436 3300025925 Unclassified 1481
180 Ga0207659_10001719 3300025926 Bacteria 12986
181 Ga0207659_10110283 3300025926 Bacteria 2091
182 Ga0207687_10019461 3300025927 Bacteria 4498
183 Ga0207687_10323194 3300025927 Bacteria 1250
184 Ga0207664_10365540 3300025929 Bacteria 1279
185 Ga0207644_10116859 3300025931 Bacteria 2025
186 Ga0207690_10032025 3300025932 Bacteria 3370
187 Ga0207686_10000160 3300025934 Bacteria 51361
188 Ga0207686_10080300 3300025934 Bacteria 2126
189 Ga0207686_10283847 3300025934 Unclassified 1223
190 Ga0207709_10077046 3300025935 Bacteria 2136
191 Ga0207669_10061688 3300025937 Bacteria 2306
192 Ga0207691_10002142 3300025940 Bacteria 19328
193 Ga0207691_10026471 3300025940 Bacteria 5440
194 Ga0207711_10125664 3300025941 Bacteria 2294
195 Ga0207711_10176233 3300025941 Bacteria 1942
196 Ga0207689_10001617 3300025942 Bacteria 21344
197 Ga0207689_10010119 3300025942 Bacteria 8132
198 Ga0207689_10027922 3300025942 Bacteria 4721
199 Ga0207689_10031021 3300025942 Bacteria 4452
200 Ga0207689_10126751 3300025942 Bacteria 2100
201 Ga0207661_10064058 3300025944 Bacteria 2979
202 Ga0207679_10031153 3300025945 Bacteria 3731
203 Ga0207679_10122731 3300025945 Bacteria 2071
204 Ga0207651_10014700 3300025960 Bacteria 4528
205 Ga0207651_10152847 3300025960 Unclassified 1799
206 Ga0207651_10318559 3300025960 Bacteria 1299
207 Ga0207712_10410119 3300025961 Bacteria 1141
208 Ga0207640_10029260 3300025981 Bacteria 3379
209 Ga0207658_10228650 3300025986 Bacteria 1569
210 Ga0207703_10456156 3300026035 Bacteria 1195
211 Ga0207639_10056648 3300026041 Bacteria 3005
212 Ga0207708_10036972 3300026075 Bacteria 3719
213 Ga0207708_10191271 3300026075 Unclassified 1629
214 Ga0207702_10002545 3300026078 Bacteria 17163
215 Ga0207641_10053096 3300026088 Unclassified 3434
216 Ga0207641_10474362 3300026088 Bacteria 1212
217 Ga0207648_10013939 3300026089 Bacteria 7452
218 Ga0207648_10039522 3300026089 Bacteria 4148
219 Ga0207648_10077186 3300026089 Bacteria 2903
220 Ga0207676_10015962 3300026095 Bacteria 5432
221 Ga0207676_10018034 3300026095 Bacteria 5125
222 Ga0207676_10145095 3300026095 Bacteria 2037
223 Ga0207676_10317944 3300026095 Bacteria 1428
224 Ga0207674_10001205 3300026116 Bacteria 33690
225 Ga0207674_10547809 3300026116 Unclassified 1117
226 Ga0207675_100002042 3300026118 Bacteria 20142
227 Ga0207675_100031332 3300026118 Bacteria 4954
228 Ga0207675_100247987 3300026118 Bacteria 1723
229 Ga0207675_100449811 3300026118 Unclassified 1276
230 Ga0207683_10006309 3300026121 Bacteria 10158
231 Ga0207683_10042782 3300026121 Bacteria 3957
232 Ga0207683_10096501 3300026121 Bacteria 2636
233 Ga0207698_10380873 3300026142 Unclassified 1342
234 Ga0207428_10036919 3300027907 Bacteria 3980
235 Ga0207428_10134459 3300027907 Unclassified 1891
236 Ga0268265_10082803 3300028380 Bacteria 2538
237 Ga0268265_10106674 3300028380 Unclassified 2276
238 Ga0268264_10331617 3300028381 Unclassified 1442
239 Ga0268264_10389740 3300028381 Unclassified 1336
240 Ga0268264_10433208 3300028381 Unclassified 1270
241 Ga0307515_10048777 3300028794 Bacteria 6394
242 Ga0307416_100299395 3300032002 Bacteria 1598
243 Ga0373945_0099880 3300035116 Bacteria 1134
244 Ga0373947_0050164 3300035725 Bacteria 2509
245 Ga0395899_0149626 3300037312 Unclassified 1655
246 Ga0395900_0004203 3300037418 Bacteria 15280
247 Ga0395900_0071401 3300037418 Bacteria 3569
248 Ga0395898_0358403 3300037466 Unclassified 1391
249 Ga0436365_1663022 3300039437 Bacteria 2513
250 Ga0436365_1820314 3300039437 Bacteria 36693
251 Ga0439453_0030706 3300041408 Unclassified 1017
252 Ga0466969_0020073 3300044656 Unclassified 3463
253 Ga0466965_0015210 3300044683 Bacteria 3655
254 Ga0466966_0001802 3300044684 Bacteria 13882
255 Ga0466966_0011558 3300044684 Bacteria 5855
256 Ga0466966_0044977 3300044684 Unclassified 2824
257 Ga0466961_0095277 3300044693 Bacteria 1877
258 Ga0466970_0159024 3300044765 Bacteria 1249
259 Ga0451576_0015297 3300045051 Bacteria 8505
260 Ga0451576_0540106 3300045051 Unclassified 1225
261 Ga0466958_0200619 3300045836 Bacteria 1269
262 Ga0466967_0000002 3300045976 Bacteria 219994
263 Ga0466967_0008695 3300045976 Bacteria 7472
264 Ga0495603_0087591 3300046455 Unclassified 1822
265 Ga0495653_0117937 3300046463 Bacteria 1896
266 Ga0495594_0002659 3300046499 Bacteria 9297
267 Ga0495632_0032492 3300046519 Bacteria 2687
268 Ga0495665_0227268 3300046531 Unclassified 964
269 Ga0496102_0110079 3300048905 Unclassified 2567
270 Ga0496102_0181225 3300048905 Bacteria 1985
271 Ga0496107_0031904 3300048910 Unclassified 3762
272 Ga0496113_0170651 3300048916 Bacteria 1723
273 Ga0496113_0265691 3300048916 Unclassified 1371
274 Ga0496114_0253933 3300048917 Bacteria 1547
275 Ga0496118_0121946 3300048921 Bacteria 1697
276 Ga0496124_0063815 3300048927 Bacteria 3076
277 Ga0501040_0035257 3300049576 Unclassified 3393
278 Ga0501042_0172530 3300049578 Unclassified 1560
279 Ga0501046_0171407 3300049580 Unclassified 1628
280 Ga0501075_0037855 3300049591 Bacteria 3606
281 Ga0501076_0172739 3300049592 Bacteria 1762
282 Ga0501079_0064340 3300049741 Unclassified 2829
283 Ga0501079_0222764 3300049741 Bacteria 1474
284 Ga0501045_0025882 3300049824 Bacteria 4218
285 nmdc:mga0qj67_49314_c1 3300050509 Unclassified 3328
286 nmdc:mga0qj67_57207_c1 3300050509 Bacteria 3091
287 nmdc:mga06r32_38281_c1 3300050510 Bacteria 4542
288 nmdc:mga08y16_38325_c1 3300050511 Bacteria 5034
289 nmdc:mga08y16_71096_c1 3300050511 Bacteria 3627
290 nmdc:mga0n895_222402_c1 3300050512 Bacteria 1916
291 Ga0500555_000128 3300053103 Bacteria 35985
292 Ga0500658_0076906 3300053134 Bacteria 1420
293 Ga0500645_000272 3300053730 Bacteria 37020
294 Ga0501084_0028176 3300054114 Unclassified 4694
295 Ga0501084_0448260 3300054114 Bacteria 1091
296 Ga0501082_0035773 3300060353 Bacteria 4280
297 Ga0501082_0159817 3300060353 Unclassified 1958
298 Ga0530510_0078191 3300061734 Unclassified 2405
299 2809147706 2808606418 Bacteria 6724496
300 Ga0501034_0000245
301 JGI25406J46586_10001098
302 rootH2_10067786
303 rootH1_10190048
304 rootH1_10380352
305 JGI25404J52841_10013260
306 Ga0065712_10015116
307 Ga0065715_10267764
308 Ga0070658_10013907
309 Ga0070683_100087396
310 Ga0070690_100002579
311 Ga0070690_100084208
312 Ga0070670_100024791
313 Ga0070670_100211464
314 Ga0070670_100222313
315 Ga0070670_100323272
316 Ga0068869_100014867
317 Ga0068869_100019042
318 Ga0070666_10039982
319 Ga0068868_100082118
320 Ga0068868_100121120
321 Ga0070660_100108636
322 Ga0070689_100052648
323 Ga0070689_100063500
324 Ga0070689_100132480
325 Ga0070689_100586503
326 Ga0070687_100004536
327 Ga0070687_100083544
328 Ga0070661_100009238
329 Ga0070692_10172320
330 Ga0070669_100006852
331 Ga0070669_100247615
332 Ga0070675_100173770
333 Ga0070675_100305715
334 Ga0070671_100020774
335 Ga0070671_100132431
336 Ga0070671_100137158
337 Ga0070674_100025162
338 Ga0070673_100007972
339 Ga0070673_100014632
340 Ga0070673_100101694
341 Ga0070673_100485313
342 Ga0070688_100011540
343 Ga0070688_100021162
344 Ga0070659_100029704
345 Ga0070659_100108254
346 Ga0070714_100432477
347 Ga0070701_10095047
348 Ga0070701_10148155
349 Ga0070711_100115189
350 Ga0070705_100015504
351 Ga0070700_100199048
352 Ga0070708_100355641
353 Ga0070678_100116321
354 Ga0070681_10027094
355 Ga0068867_100056884
356 Ga0070698_100131028
357 Ga0070679_100012632
358 Ga0070697_100005474
359 Ga0068853_100182290
360 Ga0070672_100002628
361 Ga0070672_100011911
362 Ga0070686_100076906
363 Ga0070664_100058580
364 Ga0070664_100130954
365 Ga0068857_100000277
366 Ga0068857_100256502
367 Ga0068854_100022682
368 Ga0068856_100003936
369 Ga0070702_100056744
370 Ga0070702_100145283
371 Ga0068852_100244902
372 Ga0068852_100413394
373 Ga0068859_100023308
374 Ga0068859_100029045
375 Ga0068859_100029259
376 Ga0068859_100109976
377 Ga0068859_100128164
378 Ga0068859_100190465
379 Ga0068859_100268590
380 Ga0068864_100016064
381 Ga0068864_100073099
382 Ga0068864_100160801
383 Ga0068866_10005509
384 Ga0068866_10107716
385 Ga0068861_100054416
386 Ga0068861_100069971
387 Ga0068861_100429767
388 Ga0068870_10005508
389 Ga0068870_10100277
390 Ga0068863_100028110
391 Ga0068863_100250798
392 Ga0068858_100044170
393 Ga0068858_100139955
394 Ga0068858_100308696
395 Ga0068860_100035161
396 Ga0068860_100114766
397 Ga0068860_100201722
398 Ga0068860_100288955
399 Ga0068862_100030941
400 Ga0068862_100109353
401 Ga0068862_100294467
402 Ga0081540_1000126
403 Ga0081539_10000145
404 Ga0081539_10002759
405 Ga0081539_10039738
406 Ga0097621_100255987
407 Ga0068871_100004995
408 Ga0075430_100010831
409 Ga0075430_100045109
410 Ga0075430_100125650
411 Ga0075431_100015060
412 Ga0075434_100350058
413 Ga0068865_100005912
414 Ga0097620_100023308
415 Ga0097620_100029045
416 Ga0097620_100029258
417 Ga0097620_100109975
418 Ga0097620_100128167
419 Ga0097620_100190466
420 Ga0097620_100268581
421 Ga0105250_10070143
422 Ga0111539_10060980
423 Ga0111539_10198970
424 Ga0105245_10011313
425 Ga0105245_10133405
426 Ga0105245_10479345
427 Ga0114129_10178107
428 Ga0105243_10035937
429 Ga0105243_10083803
430 Ga0105241_10050052
431 Ga0105242_10001276
432 Ga0105242_10094300
433 Ga0105248_10016382
434 Ga0105248_10146516
435 Ga0105249_10115009
436 Ga0105249_10330976
437 Ga0105239_10565106
438 Ga0157374_10031562
439 Ga0157378_10051973
440 Ga0157378_10202893
441 Ga0163162_10024061
442 Ga0163162_10394820
443 Ga0163162_10531136
444 Ga0157372_10195558
445 Ga0157372_10499986
446 Ga0157372_10576672
447 Ga0157375_10220154
448 Ga0163163_10021468
449 Ga0163163_10072997
450 Ga0157380_10029942
451 Ga0157380_10287180
452 Ga0157380_10648841
453 Ga0157379_10053979
454 Ga0157379_10374504
455 Ga0157376_10011021
456 Ga0157376_10020979
457 Ga0157376_10145461
458 Ga0163161_10038614
459 Ga0213876_10000383
460 Ga0213876_10017634
461 Ga0207697_10020217
462 Ga0207642_10003018
463 Ga0207680_10025303
464 Ga0207645_10033282
465 Ga0207643_10005146
466 Ga0207643_10022629
467 Ga0207705_10013046
468 Ga0207707_10010442
469 Ga0207663_10088212
470 Ga0207662_10003535
471 Ga0207662_10103551
472 Ga0207657_10115800
473 Ga0207649_10114068
474 Ga0207652_10053725
475 Ga0207681_10030905
476 Ga0207650_10016534
477 Ga0207650_10035578
478 Ga0207650_10234436
479 Ga0207659_10001719
480 Ga0207659_10110283
481 Ga0207687_10019461
482 Ga0207687_10323194
483 Ga0207664_10365540
484 Ga0207644_10116859
485 Ga0207690_10032025
486 Ga0207686_10000160
487 Ga0207686_10080300
488 Ga0207686_10283847
489 Ga0207709_10077046
490 Ga0207669_10061688
491 Ga0207691_10002142
492 Ga0207691_10026471
493 Ga0207711_10125664
494 Ga0207711_10176233
495 Ga0207689_10001617
496 Ga0207689_10010119
497 Ga0207689_10027922
498 Ga0207689_10031021
499 Ga0207689_10126751
500 Ga0207661_10064058
501 Ga0207679_10031153
502 Ga0207679_10122731
503 Ga0207651_10014700
504 Ga0207651_10152847
505 Ga0207651_10318559
506 Ga0207712_10410119
507 Ga0207640_10029260
508 Ga0207658_10228650
509 Ga0207703_10456156
510 Ga0207639_10056648
511 Ga0207708_10036972
512 Ga0207708_10191271
513 Ga0207702_10002545
514 Ga0207641_10053096
515 Ga0207641_10474362
516 Ga0207648_10013939
517 Ga0207648_10039522
518 Ga0207648_10077186
519 Ga0207676_10015962
520 Ga0207676_10018034
521 Ga0207676_10145095
522 Ga0207676_10317944
523 Ga0207674_10001205
524 Ga0207674_10547809
525 Ga0207675_100002042
526 Ga0207675_100031332
527 Ga0207675_100247987
528 Ga0207675_100449811
529 Ga0207683_10006309
530 Ga0207683_10042782
531 Ga0207683_10096501
532 Ga0207698_10380873
533 Ga0207428_10036919
534 Ga0207428_10134459
535 Ga0268265_10082803
536 Ga0268265_10106674
537 Ga0268264_10331617
538 Ga0268264_10389740
539 Ga0268264_10433208
540 Ga0307515_10048777
541 Ga0307416_100299395
542 Ga0373945_0099880
543 Ga0373947_0050164
544 Ga0395899_0149626
545 Ga0395900_0004203
546 Ga0395900_0071401
547 Ga0395898_0358403
548 Ga0436365_1663022
549 Ga0436365_1820314
550 Ga0439453_0030706
551 Ga0466969_0020073
552 Ga0466965_0015210
553 Ga0466966_0001802
554 Ga0466966_0011558
555 Ga0466966_0044977
556 Ga0466961_0095277
557 Ga0466970_0159024
558 Ga0451576_0015297
559 Ga0451576_0540106
560 Ga0466958_0200619
561 Ga0466967_0000002
562 Ga0466967_0008695
563 Ga0495603_0087591
564 Ga0495653_0117937
565 Ga0495594_0002659
566 Ga0495632_0032492
567 Ga0495665_0227268
568 Ga0496102_0110079
569 Ga0496102_0181225
570 Ga0496107_0031904
571 Ga0496113_0170651
572 Ga0496113_0265691
573 Ga0496114_0253933
574 Ga0496118_0121946
575 Ga0496124_0063815
576 Ga0501040_0035257
577 Ga0501042_0172530
578 Ga0501046_0171407
579 Ga0501075_0037855
580 Ga0501076_0172739
581 Ga0501079_0064340
582 Ga0501079_0222764
583 Ga0501045_0025882
584 nmdc:mga0qj67_49314_c1
585 nmdc:mga0qj67_57207_c1
586 nmdc:mga06r32_38281_c1
587 nmdc:mga08y16_38325_c1
588 nmdc:mga08y16_71096_c1
589 nmdc:mga0n895_222402_c1
590 Ga0500555_000128
591 Ga0500658_0076906
592 Ga0500645_000272
593 Ga0501084_0028176
594 Ga0501084_0448260
595 Ga0501082_0035773
596 Ga0501082_0159817
597 Ga0530510_0078191
598 2809147706

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08443

RimK

RimK-like ATP-grasp domain

121

301

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3uiw-assembly1.cif.gz_A zebrafish grx2 (apo) 0.85 4 35
7m4s-assembly1.cif.gz_A crystal structure of macrocyclase amdnb from anabaena sp. pcc 7120 0.8055 3 302
7dro-assembly2.cif.gz_D structure of atp-grasp ligase psnb complexed with minimal precursor 0.7988 3 304
7dro-assembly3.cif.gz_F structure of atp-grasp ligase psnb complexed with minimal precursor 0.7963 3 304
7dro-assembly3.cif.gz_E structure of atp-grasp ligase psnb complexed with minimal precursor 0.7961 3 301
ID Description Score Start End Superfamily
af_Q9W2D1_13_116_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8907 4 33 3.40.30.10
af_C6T1G2_26_129_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8824 4 33 3.40.30.10
2e7pD00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8446 4 35 3.40.30.10
af_P40921_1_77_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8378 6 32 3.40.30.10
af_P50472_1_80_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8369 6 32 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A235BTT7-F1-model_v4 ATP-grasp domain-containing protein 0.9705 2 301 GO:0005524
GO:0005737
GO:0009432
GO:0018169
GO:0046872
AF-A0A235BSU7-F1-model_v4 ATP-grasp domain-containing protein 0.9661 121 301 GO:0005524
GO:0005737
GO:0009432
GO:0018169
GO:0046872
AF-A0A7V2HG38-F1-model_v4 ATP-grasp domain-containing protein 0.9608 2 300 GO:0005524
GO:0005737
GO:0009432
GO:0018169
GO:0046872
AF-A0A4P6KU11-F1-model_v4 Glutathione synthase 0.9577 2 299 GO:0005524
GO:0005737
GO:0009432
GO:0018169
GO:0046872
AF-A0A6L9ZZ80-F1-model_v4 RimK domain-containing protein ATP-grasp 0.9528 1 301 GO:0005524
GO:0005737
GO:0009432
GO:0018169
GO:0046872

Map