F394375

General Info

Members Datasets Scaffolds Average Seq Length
298 181 596 467

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0005214|Ga0373937_0005214_2479_4128
Length 549
Sequence MAEETAPKSQLRRAMGFWDVLLFNIAAVLGPRWIAAAAHNGTSSISLWVLAAVFFFLPTALIIIELSTRYPAEGGLYVWSKEAFGDFHGFVAGWSYWAYTFFYFPGLLTASVAMSVYIGGPKYAWLAGNPRYLLWASLALLAIAVLFNIIGLDIGKWLQNAGGVSTYVPLMMLVGIGGYLLLHRGSATHFSWPRLWPEWPPDIDKLNFWSSIAFAFTGMELVCAMSEEVREPRKTFPRAIYASTGLIAVIYVLGTMALLWLLPAEQIDPRNGVFGGISFGSAALGIAWFGMLAALLVTVGNAGGVGATVAGVARVPFVAGIDNYLPAIFGKIHPKWKTPYISILIQAGISAAILVLSQVDATVIGAYQFLVSMSVILYFIPFLYMYAAAIKLAYRTDRADGRGVLVPGGKLGIWTSGALAFLITLGSMVLAAIPPGGENKLLFEAKLIGSTSAFVGVGLVLYFWRRMSVPLKALAFAGLGIFVGLLWLVLLPAANYAAAHSMLAKISIIVCLLSCPGFLLGLGYKLTIGLNGLLYGAFAYWALQRRNRM

Samples

Sample ID Description Type Environment
1 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
108 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
109 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
110 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
111 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
112 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
113 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
114 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
115 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
116 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
117 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
118 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
119 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
120 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
121 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
122 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
123 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
124 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
125 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
126 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
127 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
128 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
129 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
130 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
131 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
132 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
133 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
134 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
135 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
136 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
137 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
138 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
139 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
142 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
145 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
146 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
147 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
148 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
149 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
150 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
151 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
152 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
153 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
154 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
155 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
156 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
157 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
158 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
159 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
160 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
161 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
162 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
163 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
164 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
171 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
174 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
175 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
176 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
177 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
178 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
179 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
180 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
181 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.02
Rhizosphere 96.98
Stem 0
Stem Tuber 0
Unclassified 14.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373937_0005214 3300036401 Bacteria 11098
2 Ga0058862_10008864 3300004803 Bacteria 3454
3 Ga0070658_10000511 3300005327 Bacteria 33660
4 Ga0070658_10027086 3300005327 Bacteria 4602
5 Ga0070683_100001778 3300005329 Bacteria 16790
6 Ga0070683_100132329 3300005329 Bacteria 2361
7 Ga0070670_100193331 3300005331 Bacteria 1768
8 Ga0070660_100112157 3300005339 Bacteria 2170
9 Ga0070687_100006143 3300005343 Bacteria 4903
10 Ga0070668_100018029 3300005347 Bacteria 5295
11 Ga0070669_100030783 3300005353 Bacteria 3874
12 Ga0070675_100000462 3300005354 Bacteria 27734
13 Ga0070674_100156839 3300005356 Bacteria 1723
14 Ga0070688_100010296 3300005365 Bacteria 5152
15 Ga0070659_100013645 3300005366 Bacteria 6052
16 Ga0070667_100037604 3300005367 Bacteria 4058
17 Ga0070714_100004696 3300005435 Bacteria 10328
18 Ga0070714_100009147 3300005435 Bacteria 7775
19 Ga0070713_100007566 3300005436 Bacteria 7636
20 Ga0070713_100013736 3300005436 Bacteria 5988
21 Ga0070713_100032060 3300005436 Bacteria 4193
22 Ga0070713_100175949 3300005436 Bacteria 1920
23 Ga0070711_100002483 3300005439 Bacteria 10530
24 Ga0070711_100067584 3300005439 Bacteria 2508
25 Ga0070711_100069439 3300005439 Unclassified 2478
26 Ga0070708_100093599 3300005445 Bacteria 2740
27 Ga0070708_100171705 3300005445 Unclassified 2025
28 Ga0070681_10025619 3300005458 Bacteria 5933
29 Ga0068867_100052169 3300005459 Unclassified 3017
30 Ga0068867_100075115 3300005459 Bacteria 2535
31 Ga0070685_10009366 3300005466 Bacteria 5059
32 Ga0070707_100008721 3300005468 Bacteria 9402
33 Ga0070707_100199444 3300005468 Bacteria 1950
34 Ga0070707_100199756 3300005468 Bacteria 1949
35 Ga0070698_100004944 3300005471 Bacteria 14614
36 Ga0070684_100000965 3300005535 Bacteria 20493
37 Ga0070684_100008643 3300005535 Bacteria 7978
38 Ga0070684_100011100 3300005535 Bacteria 7167
39 Ga0070684_100196578 3300005535 Unclassified 1836
40 Ga0070697_100000777 3300005536 Bacteria 23935
41 Ga0070697_100020769 3300005536 Bacteria 5200
42 Ga0068853_100077634 3300005539 Unclassified 2901
43 Ga0070672_100035905 3300005543 Bacteria 3771
44 Ga0070672_100075124 3300005543 Bacteria 2697
45 Ga0070695_100165464 3300005545 Bacteria 1556
46 Ga0070693_100013071 3300005547 Bacteria 4220
47 Ga0068855_100004740 3300005563 Bacteria 16602
48 Ga0068855_100060762 3300005563 Bacteria 4418
49 Ga0070664_100003774 3300005564 Bacteria 12222
50 Ga0070664_100005147 3300005564 Bacteria 10495
51 Ga0068857_100020182 3300005577 Bacteria 5857
52 Ga0068857_100208966 3300005577 Bacteria 1781
53 Ga0068852_100000048 3300005616 Bacteria 87297
54 Ga0068852_100010709 3300005616 Bacteria 6865
55 Ga0068852_100117198 3300005616 Bacteria 2431
56 Ga0068859_100032260 3300005617 Bacteria 5261
57 Ga0068870_10002402 3300005840 Bacteria 7794
58 Ga0068863_100011437 3300005841 Bacteria 8582
59 Ga0081539_10076505 3300005985 Unclassified 1773
60 Ga0070717_10002009 3300006028 Bacteria 14214
61 Ga0070717_10013887 3300006028 Bacteria 6185
62 Ga0070717_10089605 3300006028 Bacteria 2595
63 Ga0070717_10127754 3300006028 Bacteria 2184
64 Ga0070717_10171647 3300006028 Bacteria 1886
65 Ga0070717_10246939 3300006028 Unclassified 1575
66 Ga0070715_10024765 3300006163 Unclassified 2369
67 Ga0070716_100000483 3300006173 Bacteria 16475
68 Ga0070716_100018196 3300006173 Unclassified 3656
69 Ga0070716_100044900 3300006173 Bacteria 2477
70 Ga0070712_100053282 3300006175 Bacteria 2825
71 Ga0097621_100146029 3300006237 Bacteria 2025
72 Ga0075428_100009561 3300006844 Bacteria 10767
73 Ga0075433_10041518 3300006852 Bacteria 3985
74 Ga0075434_100023467 3300006871 Bacteria 6013
75 Ga0075434_100034847 3300006871 Bacteria 4974
76 Ga0075434_100285789 3300006871 Unclassified 1669
77 Ga0075436_100002090 3300006914 Bacteria 13785
78 Ga0097620_100032263 3300006931 Bacteria 5261
79 Ga0075435_100051883 3300007076 Bacteria 3304
80 Ga0099794_10015211 3300007265 Bacteria 3392
81 Ga0105240_10004442 3300009093 Bacteria 21388
82 Ga0105240_10012355 3300009093 Bacteria 11792
83 Ga0105240_10052892 3300009093 Bacteria 5102
84 Ga0105240_10134144 3300009093 Bacteria 2966
85 Ga0105240_10371405 3300009093 Unclassified 1617
86 Ga0105245_10001494 3300009098 Bacteria 21154
87 Ga0105245_10034804 3300009098 Bacteria 4468
88 Ga0105245_10280407 3300009098 Bacteria 1628
89 Ga0114129_10002319 3300009147 Bacteria 26420
90 Ga0114129_10103081 3300009147 Bacteria 3945
91 Ga0114129_10140544 3300009147 Bacteria 3310
92 Ga0105242_10002325 3300009176 Bacteria 14988
93 Ga0105242_10046687 3300009176 Bacteria 3515
94 Ga0105248_10245622 3300009177 Bacteria 2015
95 Ga0105239_10235751 3300010375 Bacteria 2054
96 Ga0105246_10045668 3300011119 Bacteria 2984
97 Ga0157373_10008861 3300013100 Bacteria 7448
98 Ga0157373_10085506 3300013100 Bacteria 2223
99 Ga0157370_10002535 3300013104 Bacteria 21958
100 Ga0157369_10000334 3300013105 Bacteria 62941
101 Ga0157369_10062453 3300013105 Bacteria 4015
102 Ga0157374_10000612 3300013296 Bacteria 31607
103 Ga0157374_10001694 3300013296 Bacteria 18453
104 Ga0157378_10003557 3300013297 Bacteria 13807
105 Ga0157378_10119593 3300013297 Bacteria 2426
106 Ga0157372_10000092 3300013307 Bacteria 93247
107 Ga0157372_10004032 3300013307 Bacteria 15750
108 Ga0157372_10079438 3300013307 Bacteria 3710
109 Ga0157375_10086930 3300013308 Bacteria 3178
110 Ga0157375_10141851 3300013308 Bacteria 2530
111 Ga0157375_10249158 3300013308 Bacteria 1937
112 Ga0157375_10351636 3300013308 Bacteria 1639
113 Ga0157379_10068735 3300014968 Bacteria 3167
114 Ga0157376_10000029 3300014969 Bacteria 201828
115 Ga0207682_10020582 3300025893 Unclassified 2590
116 Ga0207692_10058143 3300025898 Unclassified 1991
117 Ga0207699_10078308 3300025906 Unclassified 2042
118 Ga0207699_10117284 3300025906 Unclassified 1716
119 Ga0207645_10036436 3300025907 Bacteria 3158
120 Ga0207643_10013898 3300025908 Bacteria 4368
121 Ga0207705_10052437 3300025909 Bacteria 2937
122 Ga0207684_10010637 3300025910 Bacteria 8085
123 Ga0207684_10153606 3300025910 Unclassified 1981
124 Ga0207707_10013452 3300025912 Bacteria 7131
125 Ga0207695_10000115 3300025913 Bacteria 240394
126 Ga0207695_10007181 3300025913 Bacteria 14246
127 Ga0207695_10044106 3300025913 Bacteria 4746
128 Ga0207693_10015792 3300025915 Bacteria 6049
129 Ga0207693_10047169 3300025915 Unclassified 3386
130 Ga0207693_10065251 3300025915 Bacteria 2851
131 Ga0207663_10007975 3300025916 Bacteria 5522
132 Ga0207660_10000834 3300025917 Bacteria 20321
133 Ga0207662_10023243 3300025918 Bacteria 3560
134 Ga0207657_10000648 3300025919 Bacteria 37063
135 Ga0207657_10042744 3300025919 Bacteria 3996
136 Ga0207649_10028426 3300025920 Bacteria 3292
137 Ga0207649_10059806 3300025920 Bacteria 2392
138 Ga0207652_10018043 3300025921 Bacteria 5785
139 Ga0207652_10025319 3300025921 Bacteria 4932
140 Ga0207646_10000927 3300025922 Bacteria 37748
141 Ga0207681_10014369 3300025923 Bacteria 4918
142 Ga0207659_10003148 3300025926 Bacteria 9865
143 Ga0207659_10032734 3300025926 Bacteria 3572
144 Ga0207687_10004198 3300025927 Bacteria 9636
145 Ga0207700_10000506 3300025928 Bacteria 22874
146 Ga0207700_10098647 3300025928 Bacteria 2324
147 Ga0207664_10002082 3300025929 Bacteria 13160
148 Ga0207644_10108005 3300025931 Bacteria 2100
149 Ga0207690_10015644 3300025932 Bacteria 4602
150 Ga0207690_10032537 3300025932 Bacteria 3346
151 Ga0207686_10026969 3300025934 Bacteria 3358
152 Ga0207686_10032901 3300025934 Unclassified 3090
153 Ga0207669_10133872 3300025937 Bacteria 1708
154 Ga0207665_10028444 3300025939 Unclassified 3691
155 Ga0207665_10041708 3300025939 Bacteria 3066
156 Ga0207691_10072022 3300025940 Bacteria 3117
157 Ga0207661_10010190 3300025944 Bacteria 6759
158 Ga0207667_10004567 3300025949 Bacteria 16975
159 Ga0207667_10011903 3300025949 Bacteria 10076
160 Ga0207651_10038082 3300025960 Bacteria 3156
161 Ga0207668_10072730 3300025972 Unclassified 2461
162 Ga0207677_10072894 3300026023 Bacteria 2430
163 Ga0207703_10205492 3300026035 Bacteria 1753
164 Ga0207639_10065366 3300026041 Bacteria 2823
165 Ga0207641_10025042 3300026088 Bacteria 4920
166 Ga0207641_10218773 3300026088 Bacteria 1765
167 Ga0207648_10006890 3300026089 Bacteria 11262
168 Ga0207648_10041438 3300026089 Bacteria 4043
169 Ga0207676_10012846 3300026095 Bacteria 6013
170 Ga0207674_10011651 3300026116 Bacteria 9872
171 Ga0207698_10000011 3300026142 Bacteria 260352
172 Ga0207698_10007543 3300026142 Bacteria 6818
173 Ga0209588_1009671 3300027671 Unclassified 2884
174 Ga0209588_1013900 3300027671 Unclassified 2460
175 Ga0265319_1000770 3300028563 Bacteria 20820
176 Ga0265318_10000563 3300028577 Bacteria 26166
177 Ga0265330_10051904 3300031235 Bacteria 1797
178 Ga0265320_10000328 3300031240 Bacteria 38910
179 Ga0265320_10011867 3300031240 Bacteria 5105
180 Ga0265325_10000217 3300031241 Bacteria 40450
181 Ga0265329_10000518 3300031242 Bacteria 19897
182 Ga0265340_10008669 3300031247 Bacteria 5483
183 Ga0265339_10001972 3300031249 Bacteria 15087
184 Ga0265331_10000021 3300031250 Bacteria 242632
185 Ga0265316_10000390 3300031344 Bacteria 50094
186 Ga0265316_10003604 3300031344 Bacteria 15612
187 Ga0265316_10156508 3300031344 Bacteria 1705
188 Ga0265313_10000730 3300031595 Bacteria 33796
189 Ga0265313_10011049 3300031595 Bacteria 5635
190 Ga0265313_10011855 3300031595 Bacteria 5385
191 Ga0265314_10012056 3300031711 Bacteria 7086
192 Ga0265342_10000032 3300031712 Bacteria 150633
193 Ga0265342_10001875 3300031712 Bacteria 18973
194 Ga0265342_10068917 3300031712 Bacteria 2066
195 Ga0307413_10005001 3300031824 Bacteria 5850
196 Ga0307416_100088450 3300032002 Bacteria 2648
197 Ga0307416_100134979 3300032002 Unclassified 2230
198 Ga0373926_0001062 3300035083 Bacteria 8077
199 Ga0373926_0008582 3300035083 Bacteria 3402
200 Ga0373926_0029372 3300035083 Unclassified 1932
201 Ga0373934_0025182 3300035086 Bacteria 2303
202 Ga0373940_0029815 3300035088 Unclassified 1448
203 Ga0373923_0011862 3300035111 Bacteria 3208
204 Ga0373945_0004611 3300035116 Bacteria 4388
205 Ga0373953_0023443 3300035117 Bacteria 2336
206 Ga0373954_0016682 3300035118 Unclassified 3290
207 Ga0373956_0004572 3300035119 Bacteria 5526
208 Ga0373956_0029246 3300035119 Unclassified 2402
209 Ga0373957_0002030 3300035120 Bacteria 5668
210 Ga0373943_0007885 3300035170 Unclassified 4780
211 Ga0373946_0008379 3300035171 Unclassified 3791
212 Ga0373946_0018587 3300035171 Bacteria 2671
213 Ga0373955_0003644 3300035172 Bacteria 6780
214 Ga0373924_0027454 3300035410 Unclassified 2263
215 Ga0373935_0011818 3300035692 Bacteria 5245
216 Ga0373935_0041690 3300035692 Unclassified 2884
217 Ga0373927_0009555 3300035695 Bacteria 6504
218 Ga0373927_0020185 3300035695 Unclassified 4368
219 Ga0373933_0000568 3300035724 Bacteria 23098
220 Ga0373933_0001282 3300035724 Bacteria 14787
221 Ga0373947_0001525 3300035725 Bacteria 14206
222 Ga0373947_0047178 3300035725 Unclassified 2580
223 Ga0373947_0105133 3300035725 Bacteria 1778
224 Ga0373947_0149700 3300035725 Unclassified 1502
225 Ga0373937_0000051 3300036401 Bacteria 104818
226 Ga0373937_0000942 3300036401 Bacteria 24733
227 Ga0373937_0017729 3300036401 Bacteria 6353
228 Ga0373925_0007278 3300037068 Bacteria 8089
229 Ga0373925_0014468 3300037068 Bacteria 5703
230 Ga0373925_0044205 3300037068 Unclassified 3307
231 Ga0373925_0053406 3300037068 Unclassified 3020
232 Ga0395898_0034755 3300037466 Bacteria 5018
233 Ga0466966_0140548 3300044684 Bacteria 1476
234 Ga0466963_0007607 3300044694 Bacteria 6468
235 Ga0466963_0056214 3300044694 Bacteria 2618
236 Ga0466963_0096798 3300044694 Unclassified 2016
237 Ga0466967_0022383 3300045976 Bacteria 5155
238 Ga0466967_0052745 3300045976 Bacteria 3571
239 Ga0495651_0008669 3300046462 Bacteria 7803
240 Ga0495651_0052268 3300046462 Bacteria 3147
241 Ga0495651_0069759 3300046462 Unclassified 2676
242 Ga0495653_0030294 3300046463 Bacteria 4311
243 Ga0495580_0017563 3300046472 Bacteria 5347
244 Ga0495582_0003027 3300046473 Bacteria 9419
245 Ga0495582_0006938 3300046473 Bacteria 6300
246 Ga0495608_0008749 3300046511 Bacteria 7082
247 Ga0495628_0000743 3300046516 Bacteria 30199
248 Ga0495630_0032646 3300046517 Bacteria 3880
249 Ga0495630_0036648 3300046517 Bacteria 3667
250 Ga0495630_0067466 3300046517 Unclassified 2689
251 Ga0495652_0001695 3300046529 Bacteria 23794
252 Ga0495652_0027991 3300046529 Unclassified 4964
253 Ga0495587_0000381 3300046536 Bacteria 31640
254 Ga0495587_0000902 3300046536 Bacteria 19683
255 Ga0495587_0005351 3300046536 Bacteria 8395
256 Ga0495587_0027792 3300046536 Unclassified 3444
257 Ga0495645_0027873 3300046543 Bacteria 4104
258 Ga0495667_0033936 3300046559 Bacteria 3413
259 Ga0495635_0075129 3300046663 Unclassified 2315
260 Ga0495659_0034343 3300046664 Bacteria 1783
261 Ga0495658_0036460 3300046683 Bacteria 2713
262 Ga0495600_0005166 3300046809 Bacteria 7847
263 Ga0495604_0003883 3300047317 Bacteria 11898
264 Ga0495604_0007609 3300047317 Bacteria 8576
265 Ga0495604_0011284 3300047317 Bacteria 7094
266 Ga0495674_0006253 3300047319 Bacteria 11427
267 Ga0495680_0011639 3300047322 Bacteria 7774
268 Ga0495675_0000077 3300047444 Bacteria 68982
269 Ga0495675_0001043 3300047444 Bacteria 16841
270 Ga0495684_0006645 3300047471 Bacteria 8969
271 Ga0495684_0030561 3300047471 Bacteria 4135
272 Ga0495602_0000048 3300048088 Bacteria 116248
273 Ga0495602_0006628 3300048088 Bacteria 12141
274 Ga0496104_0018972 3300048907 Bacteria 6284
275 Ga0496104_0100717 3300048907 Bacteria 2766
276 Ga0496105_0011100 3300048908 Bacteria 7104
277 Ga0496108_0136234 3300048911 Bacteria 2113
278 Ga0496111_0012556 3300048914 Bacteria 5739
279 Ga0496112_0023225 3300048915 Bacteria 5921
280 Ga0496112_0052136 3300048915 Unclassified 4014
281 Ga0496113_0003044 3300048916 Bacteria 9933
282 Ga0496114_0060453 3300048917 Bacteria 3167
283 Ga0501047_0035571 3300049581 Bacteria 4812
284 Ga0501070_0020661 3300049586 Bacteria 5523
285 nmdc:mga05p37_3017_c1 3300050507 Bacteria 19539
286 nmdc:mga05p37_31973_c1 3300050507 Bacteria 3159
287 nmdc:mga05p37_9137_c2 3300050507 Bacteria 5720
288 nmdc:mga06r32_72045_c1 3300050510 Bacteria 3345
289 nmdc:mga0n895_30139_c1 3300050512 Bacteria 5181
290 nmdc:mga0n895_60080_c1 3300050512 Bacteria 3750
291 nmdc:mga0rr50_16075_c1 3300050513 Bacteria 4958
292 nmdc:mga0rr50_233636_c1 3300050513 Unclassified 1522
293 nmdc:mga0rr50_87764_c1 3300050513 Bacteria 2415
294 nmdc:mga08x19_10183_c1 3300050514 Bacteria 5642
295 nmdc:mga08x19_2342_c1 3300050514 Bacteria 11501
296 nmdc:mga0a205_4255_c2 3300050515 Bacteria 5884
297 Ga0495601_0006620 3300053077 Bacteria 6779
298 Ga0495619_0104473 3300053085 Bacteria 1931
299 Ga0373937_0005214
300 Ga0058862_10008864
301 Ga0070658_10000511
302 Ga0070658_10027086
303 Ga0070683_100001778
304 Ga0070683_100132329
305 Ga0070670_100193331
306 Ga0070660_100112157
307 Ga0070687_100006143
308 Ga0070668_100018029
309 Ga0070669_100030783
310 Ga0070675_100000462
311 Ga0070674_100156839
312 Ga0070688_100010296
313 Ga0070659_100013645
314 Ga0070667_100037604
315 Ga0070714_100004696
316 Ga0070714_100009147
317 Ga0070713_100007566
318 Ga0070713_100013736
319 Ga0070713_100032060
320 Ga0070713_100175949
321 Ga0070711_100002483
322 Ga0070711_100067584
323 Ga0070711_100069439
324 Ga0070708_100093599
325 Ga0070708_100171705
326 Ga0070681_10025619
327 Ga0068867_100052169
328 Ga0068867_100075115
329 Ga0070685_10009366
330 Ga0070707_100008721
331 Ga0070707_100199444
332 Ga0070707_100199756
333 Ga0070698_100004944
334 Ga0070684_100000965
335 Ga0070684_100008643
336 Ga0070684_100011100
337 Ga0070684_100196578
338 Ga0070697_100000777
339 Ga0070697_100020769
340 Ga0068853_100077634
341 Ga0070672_100035905
342 Ga0070672_100075124
343 Ga0070695_100165464
344 Ga0070693_100013071
345 Ga0068855_100004740
346 Ga0068855_100060762
347 Ga0070664_100003774
348 Ga0070664_100005147
349 Ga0068857_100020182
350 Ga0068857_100208966
351 Ga0068852_100000048
352 Ga0068852_100010709
353 Ga0068852_100117198
354 Ga0068859_100032260
355 Ga0068870_10002402
356 Ga0068863_100011437
357 Ga0081539_10076505
358 Ga0070717_10002009
359 Ga0070717_10013887
360 Ga0070717_10089605
361 Ga0070717_10127754
362 Ga0070717_10171647
363 Ga0070717_10246939
364 Ga0070715_10024765
365 Ga0070716_100000483
366 Ga0070716_100018196
367 Ga0070716_100044900
368 Ga0070712_100053282
369 Ga0097621_100146029
370 Ga0075428_100009561
371 Ga0075433_10041518
372 Ga0075434_100023467
373 Ga0075434_100034847
374 Ga0075434_100285789
375 Ga0075436_100002090
376 Ga0097620_100032263
377 Ga0075435_100051883
378 Ga0099794_10015211
379 Ga0105240_10004442
380 Ga0105240_10012355
381 Ga0105240_10052892
382 Ga0105240_10134144
383 Ga0105240_10371405
384 Ga0105245_10001494
385 Ga0105245_10034804
386 Ga0105245_10280407
387 Ga0114129_10002319
388 Ga0114129_10103081
389 Ga0114129_10140544
390 Ga0105242_10002325
391 Ga0105242_10046687
392 Ga0105248_10245622
393 Ga0105239_10235751
394 Ga0105246_10045668
395 Ga0157373_10008861
396 Ga0157373_10085506
397 Ga0157370_10002535
398 Ga0157369_10000334
399 Ga0157369_10062453
400 Ga0157374_10000612
401 Ga0157374_10001694
402 Ga0157378_10003557
403 Ga0157378_10119593
404 Ga0157372_10000092
405 Ga0157372_10004032
406 Ga0157372_10079438
407 Ga0157375_10086930
408 Ga0157375_10141851
409 Ga0157375_10249158
410 Ga0157375_10351636
411 Ga0157379_10068735
412 Ga0157376_10000029
413 Ga0207682_10020582
414 Ga0207692_10058143
415 Ga0207699_10078308
416 Ga0207699_10117284
417 Ga0207645_10036436
418 Ga0207643_10013898
419 Ga0207705_10052437
420 Ga0207684_10010637
421 Ga0207684_10153606
422 Ga0207707_10013452
423 Ga0207695_10000115
424 Ga0207695_10007181
425 Ga0207695_10044106
426 Ga0207693_10015792
427 Ga0207693_10047169
428 Ga0207693_10065251
429 Ga0207663_10007975
430 Ga0207660_10000834
431 Ga0207662_10023243
432 Ga0207657_10000648
433 Ga0207657_10042744
434 Ga0207649_10028426
435 Ga0207649_10059806
436 Ga0207652_10018043
437 Ga0207652_10025319
438 Ga0207646_10000927
439 Ga0207681_10014369
440 Ga0207659_10003148
441 Ga0207659_10032734
442 Ga0207687_10004198
443 Ga0207700_10000506
444 Ga0207700_10098647
445 Ga0207664_10002082
446 Ga0207644_10108005
447 Ga0207690_10015644
448 Ga0207690_10032537
449 Ga0207686_10026969
450 Ga0207686_10032901
451 Ga0207669_10133872
452 Ga0207665_10028444
453 Ga0207665_10041708
454 Ga0207691_10072022
455 Ga0207661_10010190
456 Ga0207667_10004567
457 Ga0207667_10011903
458 Ga0207651_10038082
459 Ga0207668_10072730
460 Ga0207677_10072894
461 Ga0207703_10205492
462 Ga0207639_10065366
463 Ga0207641_10025042
464 Ga0207641_10218773
465 Ga0207648_10006890
466 Ga0207648_10041438
467 Ga0207676_10012846
468 Ga0207674_10011651
469 Ga0207698_10000011
470 Ga0207698_10007543
471 Ga0209588_1009671
472 Ga0209588_1013900
473 Ga0265319_1000770
474 Ga0265318_10000563
475 Ga0265330_10051904
476 Ga0265320_10000328
477 Ga0265320_10011867
478 Ga0265325_10000217
479 Ga0265329_10000518
480 Ga0265340_10008669
481 Ga0265339_10001972
482 Ga0265331_10000021
483 Ga0265316_10000390
484 Ga0265316_10003604
485 Ga0265316_10156508
486 Ga0265313_10000730
487 Ga0265313_10011049
488 Ga0265313_10011855
489 Ga0265314_10012056
490 Ga0265342_10000032
491 Ga0265342_10001875
492 Ga0265342_10068917
493 Ga0307413_10005001
494 Ga0307416_100088450
495 Ga0307416_100134979
496 Ga0373926_0001062
497 Ga0373926_0008582
498 Ga0373926_0029372
499 Ga0373934_0025182
500 Ga0373940_0029815
501 Ga0373923_0011862
502 Ga0373945_0004611
503 Ga0373953_0023443
504 Ga0373954_0016682
505 Ga0373956_0004572
506 Ga0373956_0029246
507 Ga0373957_0002030
508 Ga0373943_0007885
509 Ga0373946_0008379
510 Ga0373946_0018587
511 Ga0373955_0003644
512 Ga0373924_0027454
513 Ga0373935_0011818
514 Ga0373935_0041690
515 Ga0373927_0009555
516 Ga0373927_0020185
517 Ga0373933_0000568
518 Ga0373933_0001282
519 Ga0373947_0001525
520 Ga0373947_0047178
521 Ga0373947_0105133
522 Ga0373947_0149700
523 Ga0373937_0000051
524 Ga0373937_0000942
525 Ga0373937_0017729
526 Ga0373925_0007278
527 Ga0373925_0014468
528 Ga0373925_0044205
529 Ga0373925_0053406
530 Ga0395898_0034755
531 Ga0466966_0140548
532 Ga0466963_0007607
533 Ga0466963_0056214
534 Ga0466963_0096798
535 Ga0466967_0022383
536 Ga0466967_0052745
537 Ga0495651_0008669
538 Ga0495651_0052268
539 Ga0495651_0069759
540 Ga0495653_0030294
541 Ga0495580_0017563
542 Ga0495582_0003027
543 Ga0495582_0006938
544 Ga0495608_0008749
545 Ga0495628_0000743
546 Ga0495630_0032646
547 Ga0495630_0036648
548 Ga0495630_0067466
549 Ga0495652_0001695
550 Ga0495652_0027991
551 Ga0495587_0000381
552 Ga0495587_0000902
553 Ga0495587_0005351
554 Ga0495587_0027792
555 Ga0495645_0027873
556 Ga0495667_0033936
557 Ga0495635_0075129
558 Ga0495659_0034343
559 Ga0495658_0036460
560 Ga0495600_0005166
561 Ga0495604_0003883
562 Ga0495604_0007609
563 Ga0495604_0011284
564 Ga0495674_0006253
565 Ga0495680_0011639
566 Ga0495675_0000077
567 Ga0495675_0001043
568 Ga0495684_0006645
569 Ga0495684_0030561
570 Ga0495602_0000048
571 Ga0495602_0006628
572 Ga0496104_0018972
573 Ga0496104_0100717
574 Ga0496105_0011100
575 Ga0496108_0136234
576 Ga0496111_0012556
577 Ga0496112_0023225
578 Ga0496112_0052136
579 Ga0496113_0003044
580 Ga0496114_0060453
581 Ga0501047_0035571
582 Ga0501070_0020661
583 nmdc:mga05p37_3017_c1
584 nmdc:mga05p37_31973_c1
585 nmdc:mga05p37_9137_c2
586 nmdc:mga06r32_72045_c1
587 nmdc:mga0n895_30139_c1
588 nmdc:mga0n895_60080_c1
589 nmdc:mga0rr50_16075_c1
590 nmdc:mga0rr50_233636_c1
591 nmdc:mga0rr50_87764_c1
592 nmdc:mga08x19_10183_c1
593 nmdc:mga08x19_2342_c1
594 nmdc:mga0a205_4255_c2
595 Ga0495601_0006620
596 Ga0495619_0104473

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13520

AA_permease_2

Amino acid permease

15

461

0.86

PF00324

AA_permease

Amino acid permease

20

475

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dji-assembly3.cif.gz_A structure of glutamate-gaba antiporter gadc 0.8502 18 443
4dji-assembly3.cif.gz_B structure of glutamate-gaba antiporter gadc 0.8397 23 443
4djk-assembly3.cif.gz_A structure of glutamate-gaba antiporter gadc 0.8032 16 443
4dji-assembly3.cif.gz_A structure of glutamate-gaba antiporter gadc 0.7948 18 443
4djk-assembly3.cif.gz_B structure of glutamate-gaba antiporter gadc 0.7897 16 443
ID Description Score Start End Superfamily
af_P63235_7_481_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8525 10 443 1.20.1740.10
af_P75835_4_476_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8427 11 451 1.20.1740.10
af_P42590_4_465_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8192 13 448 1.20.1740.10
af_P75835_4_476_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8139 11 451 1.20.1740.10
af_P63235_7_481_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8111 10 443 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A538TXC7-F1-model_v4 Amino acid permease 0.9343 18 455 GO:0005886
GO:0022857
AF-A0A5M8SBZ5-F1-model_v4 APC family permease 0.926 2 452 GO:0005886
GO:0022857
AF-A0A5M8SBZ5-F1-model_v4 APC family permease 0.9124 2 452 GO:0005886
GO:0022857
AF-A0A2V7Z5X3-F1-model_v4 Amino acid permease 0.9066 12 451 GO:0005886
GO:0022857
AF-A0A2H0I6T3-F1-model_v4 Amino acid permease 0.9037 4 451 GO:0005886
GO:0022857

Map