F393728

General Info

Members Datasets Scaffolds Average Seq Length
297 171 594 361

Family's Representative Sequence

Representative Sequence 3300025910|Ga0207684_10032146|Ga0207684_100321463
Length 378
Sequence VKKILILTASFGEGHNSAARGVRDGLARVAPDMQVELHDLFAETYGRLNEIVRKAYLSLINRWPHSWGYVYRWLDRKRDFDGNFARFTQLKHHFSQLLTRFQPEVVVSTFPPYPYLLPQILGPRRPCKNIVVVTDSITVNAIWYRCAADYFLVPNEQSAAVVRTSGIAPEKIKTFGFPVSPKFADLTQVRQPDGLVLWRDRELPADKSGRRLLYVINAGTGNAPELVRRLLDLNLELTVTVGRDEKLRAAVEAAARDKACSERSRGIDIVGWTDQLPRMLCNSHLLVAKAGGAIVQETIAAGCPMIINHIVSGQEEGNARLIVEANSGAIALSPADVVAQIERAFANGAQQWHQWATNISKLSRPRASLDIAEFLLSM

Samples

Sample ID Description Type Environment
1 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
124 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
125 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
126 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
127 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
128 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
129 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
130 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
137 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
138 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
139 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
140 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
141 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
142 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
143 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
144 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
145 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
146 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
147 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
148 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
149 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
150 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
151 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
152 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
153 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
158 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
159 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
160 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
166 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
167 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
168 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
169 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
170 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
171 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.42
Rhizosphere 91.58
Stem 0
Stem Tuber 0
Unclassified 33.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207684_10032146 3300025910 Bacteria 4463
2 JGI24737J22298_10006503 3300001990 Unclassified 3988
3 JGI24035J26624_1002209 3300002126 Unclassified 1816
4 JGI25406J46586_10000002 3300003203 Bacteria 202415
5 Ga0065704_10093618 3300005289 Unclassified 2586
6 Ga0065712_10000368 3300005290 Bacteria 12481
7 Ga0065712_10002376 3300005290 Bacteria 5263
8 Ga0065712_10003447 3300005290 Bacteria 6878
9 Ga0065712_10147324 3300005290 Unclassified 1398
10 Ga0065715_10000600 3300005293 Bacteria 17837
11 Ga0065715_10003763 3300005293 Bacteria 4610
12 Ga0065715_10092200 3300005293 Bacteria 5255
13 Ga0065715_10195353 3300005293 Bacteria 1387
14 Ga0070683_100004003 3300005329 Bacteria 12069
15 Ga0070683_100038207 3300005329 Bacteria 4399
16 Ga0070683_100355627 3300005329 Bacteria 1395
17 Ga0070666_10093820 3300005335 Bacteria 2064
18 Ga0070666_10199740 3300005335 Unclassified 1407
19 Ga0068868_100110339 3300005338 Bacteria 2235
20 Ga0070689_100006841 3300005340 Bacteria 7930
21 Ga0070689_100018307 3300005340 Bacteria 5158
22 Ga0070689_100068521 3300005340 Bacteria 2767
23 Ga0070687_100002232 3300005343 Bacteria 7184
24 Ga0070687_100015325 3300005343 Unclassified 3464
25 Ga0070668_100012067 3300005347 Bacteria 6436
26 Ga0070668_100072722 3300005347 Unclassified 2679
27 Ga0070675_100006087 3300005354 Bacteria 9248
28 Ga0070675_100046179 3300005354 Unclassified 3566
29 Ga0070675_100283831 3300005354 Unclassified 1455
30 Ga0070671_100131726 3300005355 Bacteria 2106
31 Ga0070673_100059173 3300005364 Bacteria 3032
32 Ga0070673_100084857 3300005364 Bacteria 2577
33 Ga0070688_100011807 3300005365 Bacteria 4869
34 Ga0070659_100004797 3300005366 Bacteria 9664
35 Ga0070667_100017945 3300005367 Bacteria 5866
36 Ga0070709_10064608 3300005434 Unclassified 2340
37 Ga0070714_100047804 3300005435 Unclassified 3637
38 Ga0070714_100305458 3300005435 Bacteria 1484
39 Ga0070714_100504549 3300005435 Unclassified 1154
40 Ga0070713_100276474 3300005436 Unclassified 1539
41 Ga0070701_10095303 3300005438 Unclassified 1639
42 Ga0070711_100017288 3300005439 Unclassified 4590
43 Ga0070711_100019415 3300005439 Bacteria 4360
44 Ga0070700_100018243 3300005441 Bacteria 4031
45 Ga0070694_100034813 3300005444 Unclassified 3324
46 Ga0070708_100002373 3300005445 Bacteria 14577
47 Ga0070708_100060336 3300005445 Unclassified 3384
48 Ga0070708_100084912 3300005445 Bacteria 2872
49 Ga0070708_100169165 3300005445 Bacteria 2040
50 Ga0070708_100349805 3300005445 Unclassified 1393
51 Ga0070663_100239102 3300005455 Bacteria 1433
52 Ga0070678_100161548 3300005456 Bacteria 1816
53 Ga0070678_100200763 3300005456 Bacteria 1646
54 Ga0070662_100024394 3300005457 Unclassified 4166
55 Ga0070662_100048061 3300005457 Unclassified 3072
56 Ga0070662_100057615 3300005457 Bacteria 2823
57 Ga0070662_100264554 3300005457 Unclassified 1386
58 Ga0070681_10032934 3300005458 Bacteria 5202
59 Ga0070685_10085816 3300005466 Bacteria 1896
60 Ga0070706_100000292 3300005467 Bacteria 60823
61 Ga0070706_100005811 3300005467 Bacteria 11720
62 Ga0070706_100011433 3300005467 Bacteria 8250
63 Ga0070706_100211314 3300005467 Bacteria 1812
64 Ga0070706_100284130 3300005467 Unclassified 1544
65 Ga0070707_100001401 3300005468 Bacteria 23671
66 Ga0070707_100014565 3300005468 Bacteria 7373
67 Ga0070707_100019741 3300005468 Bacteria 6353
68 Ga0070707_100033327 3300005468 Bacteria 4911
69 Ga0070707_100036575 3300005468 Unclassified 4685
70 Ga0070707_100126096 3300005468 Bacteria 2487
71 Ga0070698_100019517 3300005471 Bacteria 7114
72 Ga0070698_100037492 3300005471 Bacteria 4998
73 Ga0070698_100049304 3300005471 Unclassified 4299
74 Ga0070699_100070676 3300005518 Bacteria 3035
75 Ga0070699_100112915 3300005518 Bacteria 2387
76 Ga0070699_100185168 3300005518 Unclassified 1849
77 Ga0070679_100079750 3300005530 Bacteria 3263
78 Ga0070684_100000685 3300005535 Bacteria 23382
79 Ga0070684_100010902 3300005535 Bacteria 7222
80 Ga0070697_100001711 3300005536 Bacteria 16759
81 Ga0070697_100006196 3300005536 Bacteria 9257
82 Ga0070697_100008069 3300005536 Bacteria 8213
83 Ga0070697_100012967 3300005536 Bacteria 6531
84 Ga0070697_100033623 3300005536 Bacteria 4130
85 Ga0070697_100034423 3300005536 Bacteria 4084
86 Ga0070697_100039745 3300005536 Unclassified 3804
87 Ga0070697_100044748 3300005536 Unclassified 3586
88 Ga0070697_100057499 3300005536 Bacteria 3164
89 Ga0070697_100102891 3300005536 Bacteria 2373
90 Ga0070697_100127360 3300005536 Unclassified 2133
91 Ga0070686_100245741 3300005544 Unclassified 1305
92 Ga0070695_100015252 3300005545 Bacteria 4636
93 Ga0070665_100085043 3300005548 Bacteria 3168
94 Ga0070665_100194770 3300005548 Bacteria 2027
95 Ga0070704_100008542 3300005549 Bacteria 6147
96 Ga0070664_100100328 3300005564 Unclassified 2517
97 Ga0068856_100048664 3300005614 Bacteria 4178
98 Ga0068856_100086626 3300005614 Bacteria 3112
99 Ga0068859_100107442 3300005617 Unclassified 2851
100 Ga0068863_100006318 3300005841 Bacteria 11624
101 Ga0068863_100166682 3300005841 Bacteria 2112
102 Ga0068858_100022514 3300005842 Bacteria 5879
103 Ga0068860_100026947 3300005843 Bacteria 5538
104 Ga0068862_100057169 3300005844 Unclassified 3344
105 Ga0081455_10004735 3300005937 Bacteria 15127
106 Ga0081455_10033241 3300005937 Bacteria 4638
107 Ga0081455_10066637 3300005937 Bacteria 3006
108 Ga0081540_1041434 3300005983 Bacteria 2387
109 Ga0081539_10000061 3300005985 Bacteria 250890
110 Ga0081539_10027445 3300005985 Bacteria 3607
111 Ga0081539_10045934 3300005985 Unclassified 2506
112 Ga0070717_10001319 3300006028 Bacteria 16993
113 Ga0070717_10072730 3300006028 Unclassified 2871
114 Ga0070717_10174210 3300006028 Bacteria 1872
115 Ga0070712_100034385 3300006175 Unclassified 3434
116 Ga0070712_100035048 3300006175 Bacteria 3404
117 Ga0070712_100235308 3300006175 Bacteria 1456
118 Ga0097621_100068453 3300006237 Bacteria 2928
119 Ga0068871_100014007 3300006358 Bacteria 5966
120 Ga0075436_100138397 3300006914 Unclassified 1710
121 Ga0097620_100107443 3300006931 Unclassified 2851
122 Ga0111539_10608987 3300009094 Bacteria 1272
123 Ga0105245_10150454 3300009098 Bacteria 2200
124 Ga0105247_10079278 3300009101 Bacteria 2066
125 Ga0105243_10109459 3300009148 Unclassified 2308
126 Ga0105237_10075910 3300009545 Unclassified 3351
127 Ga0105237_10085285 3300009545 Unclassified 3148
128 Ga0105249_10008396 3300009553 Bacteria 8996
129 Ga0105249_10023369 3300009553 Bacteria 5547
130 Ga0105249_10075383 3300009553 Bacteria 3124
131 Ga0099796_10001818 3300010159 Bacteria 4476
132 Ga0099796_10031975 3300010159 Unclassified 1721
133 Ga0105239_10153918 3300010375 Bacteria 2567
134 Ga0105239_10183801 3300010375 Unclassified 2339
135 Ga0105246_10215358 3300011119 Unclassified 1502
136 Ga0157371_10096911 3300013102 Bacteria 2091
137 Ga0157371_10155493 3300013102 Bacteria 1632
138 Ga0157369_10024709 3300013105 Bacteria 6678
139 Ga0157374_10045543 3300013296 Unclassified 4060
140 Ga0157374_10085016 3300013296 Unclassified 3008
141 Ga0157374_10250141 3300013296 Unclassified 1744
142 Ga0157378_10037895 3300013297 Unclassified 4273
143 Ga0157378_10175126 3300013297 Bacteria 2015
144 Ga0157378_10250871 3300013297 Bacteria 1694
145 Ga0157378_10277152 3300013297 Bacteria 1615
146 Ga0163162_10017070 3300013306 Bacteria 7101
147 Ga0157372_10120885 3300013307 Unclassified 3008
148 Ga0157375_10178332 3300013308 Bacteria 2275
149 Ga0163163_10033074 3300014325 Bacteria 5000
150 Ga0182008_10027272 3300014497 Bacteria 2895
151 Ga0157377_10026876 3300014745 Unclassified 3084
152 Ga0157379_10005045 3300014968 Bacteria 11325
153 Ga0157376_10078779 3300014969 Bacteria 2823
154 Ga0157376_10152864 3300014969 Bacteria 2083
155 Ga0163161_10031417 3300017792 Unclassified 3783
156 Ga0163161_10082683 3300017792 Unclassified 2366
157 Ga0207666_1000275 3300025271 Bacteria 7336
158 Ga0207673_1000481 3300025290 Unclassified 4172
159 Ga0207697_10003022 3300025315 Bacteria 8453
160 Ga0207697_10006753 3300025315 Bacteria 5161
161 Ga0207697_10024372 3300025315 Bacteria 2477
162 Ga0207697_10040665 3300025315 Bacteria 1909
163 Ga0207653_10015676 3300025885 Unclassified 2379
164 Ga0207692_10004751 3300025898 Bacteria 5398
165 Ga0207647_10023104 3300025904 Unclassified 4117
166 Ga0207685_10022241 3300025905 Unclassified 2139
167 Ga0207685_10035866 3300025905 Bacteria 1813
168 Ga0207699_10116409 3300025906 Unclassified 1721
169 Ga0207645_10004611 3300025907 Bacteria 10157
170 Ga0207684_10000347 3300025910 Bacteria 64001
171 Ga0207684_10004511 3300025910 Bacteria 13087
172 Ga0207684_10006182 3300025910 Bacteria 10941
173 Ga0207684_10013334 3300025910 Bacteria 7110
174 Ga0207684_10043556 3300025910 Bacteria 3806
175 Ga0207684_10238642 3300025910 Bacteria 1568
176 Ga0207684_10276507 3300025910 Bacteria 1448
177 Ga0207693_10035593 3300025915 Unclassified 3925
178 Ga0207663_10006957 3300025916 Bacteria 5831
179 Ga0207663_10135201 3300025916 Unclassified 1710
180 Ga0207662_10001495 3300025918 Bacteria 11353
181 Ga0207662_10016511 3300025918 Bacteria 4168
182 Ga0207657_10006654 3300025919 Bacteria 11961
183 Ga0207657_10084549 3300025919 Bacteria 2659
184 Ga0207657_10323335 3300025919 Unclassified 1219
185 Ga0207649_10038504 3300025920 Bacteria 2895
186 Ga0207652_10189641 3300025921 Bacteria 1849
187 Ga0207646_10000386 3300025922 Bacteria 59216
188 Ga0207646_10000411 3300025922 Bacteria 57429
189 Ga0207646_10033214 3300025922 Bacteria 4668
190 Ga0207646_10081420 3300025922 Bacteria 2895
191 Ga0207646_10107321 3300025922 Bacteria 2505
192 Ga0207646_10180394 3300025922 Bacteria 1907
193 Ga0207646_10182511 3300025922 Archaea 1895
194 Ga0207646_10277739 3300025922 Unclassified 1514
195 Ga0207659_10034042 3300025926 Unclassified 3510
196 Ga0207659_10087079 3300025926 Bacteria 2324
197 Ga0207659_10373874 3300025926 Unclassified 1187
198 Ga0207687_10269028 3300025927 Bacteria 1362
199 Ga0207700_10011380 3300025928 Bacteria 5670
200 Ga0207664_10020497 3300025929 Unclassified 4901
201 Ga0207664_10117608 3300025929 Unclassified 2220
202 Ga0207644_10188198 3300025931 Bacteria 1622
203 Ga0207690_10025990 3300025932 Unclassified 3684
204 Ga0207690_10043368 3300025932 Unclassified 2960
205 Ga0207706_10009747 3300025933 Bacteria 8815
206 Ga0207706_10025485 3300025933 Bacteria 5298
207 Ga0207706_10051154 3300025933 Bacteria 3649
208 Ga0207709_10051867 3300025935 Unclassified 2516
209 Ga0207709_10225953 3300025935 Bacteria 1353
210 Ga0207670_10183752 3300025936 Unclassified 1576
211 Ga0207669_10215952 3300025937 Unclassified 1404
212 Ga0207665_10056464 3300025939 Unclassified 2650
213 Ga0207691_10118185 3300025940 Bacteria 2352
214 Ga0207661_10026547 3300025944 Bacteria 4414
215 Ga0207661_10211543 3300025944 Unclassified 1709
216 Ga0207651_10098744 3300025960 Bacteria 2160
217 Ga0207712_10009421 3300025961 Bacteria 6179
218 Ga0207712_10019455 3300025961 Unclassified 4435
219 Ga0207668_10041274 3300025972 Unclassified 3118
220 Ga0207668_10067187 3300025972 Unclassified 2544
221 Ga0207703_10013778 3300026035 Bacteria 6302
222 Ga0207639_10190303 3300026041 Unclassified 1752
223 Ga0207678_10068188 3300026067 Bacteria 3053
224 Ga0207708_10028679 3300026075 Bacteria 4215
225 Ga0207702_10024856 3300026078 Bacteria 4970
226 Ga0207641_10011093 3300026088 Bacteria 7392
227 Ga0207683_10132299 3300026121 Bacteria 2244
228 Ga0268266_10048018 3300028379 Bacteria 3658
229 Ga0268266_10066856 3300028379 Unclassified 3110
230 Ga0268264_10056689 3300028381 Unclassified 3275
231 Ga0373936_0090446 3300035113 Unclassified 1283
232 Ga0373953_0046543 3300035117 Unclassified 1742
233 Ga0373957_0025619 3300035120 Bacteria 2127
234 Ga0373943_0028672 3300035170 Unclassified 2625
235 Ga0373931_0057957 3300035691 Unclassified 2079
236 Ga0373935_0035087 3300035692 Bacteria 3129
237 Ga0373935_0077748 3300035692 Bacteria 2151
238 Ga0373927_0147368 3300035695 Unclassified 1541
239 Ga0373947_0133224 3300035725 Unclassified 1588
240 Ga0373937_0287764 3300036401 Bacteria 1552
241 Ga0373937_0355218 3300036401 Unclassified 1389
242 Ga0373937_0566470 3300036401 Bacteria 1079
243 Ga0373925_0035436 3300037068 Unclassified 3682
244 Ga0373925_0079695 3300037068 Bacteria 2488
245 Ga0373925_0375306 3300037068 Unclassified 1157
246 Ga0395898_0119195 3300037466 Unclassified 2528
247 Ga0439455_0003840 3300042012 Bacteria 2916
248 Ga0466967_0374032 3300045976 Bacteria 1382
249 Ga0495603_0184396 3300046455 Unclassified 1207
250 Ga0495653_0105063 3300046463 Bacteria 2040
251 Ga0495664_0100596 3300046477 Bacteria 1741
252 Ga0495608_0168250 3300046511 Unclassified 1391
253 Ga0495628_0230182 3300046516 Bacteria 1389
254 Ga0495630_0017159 3300046517 Bacteria 5300
255 Ga0495666_0116484 3300046526 Unclassified 1253
256 Ga0495652_0070225 3300046529 Unclassified 2928
257 Ga0495665_0080152 3300046531 Bacteria 1718
258 Ga0495587_0038359 3300046536 Bacteria 2873
259 Ga0495667_0085955 3300046559 Bacteria 2041
260 Ga0495599_0016333 3300046678 Bacteria 4609
261 Ga0495623_0008479 3300046679 Bacteria 6676
262 Ga0495646_0038965 3300046680 Unclassified 2931
263 Ga0495604_0118048 3300047317 Bacteria 1924
264 Ga0495604_0126677 3300047317 Bacteria 1840
265 Ga0495674_0068837 3300047319 Bacteria 3062
266 Ga0496100_0336817 3300048903 Unclassified 1137
267 Ga0496101_0076191 3300048904 Bacteria 2471
268 Ga0496101_0076982 3300048904 Bacteria 2458
269 Ga0496102_0028612 3300048905 Unclassified 4979
270 Ga0496102_0031519 3300048905 Bacteria 4756
271 Ga0496103_0099674 3300048906 Unclassified 1838
272 Ga0496104_0131062 3300048907 Bacteria 2408
273 Ga0496104_0282845 3300048907 Unclassified 1572
274 Ga0496104_0324168 3300048907 Bacteria 1453
275 Ga0496105_0027386 3300048908 Bacteria 4656
276 Ga0496107_0073986 3300048910 Unclassified 2479
277 Ga0496108_0007875 3300048911 Bacteria 8639
278 Ga0496108_0184210 3300048911 Bacteria 1809
279 Ga0496108_0391886 3300048911 Bacteria 1213
280 Ga0496109_0004613 3300048912 Bacteria 11501
281 Ga0496109_0030614 3300048912 Bacteria 4824
282 Ga0496109_0154937 3300048912 Bacteria 2146
283 Ga0496110_0034595 3300048913 Unclassified 4378
284 Ga0496110_0105531 3300048913 Bacteria 2528
285 Ga0496110_0205804 3300048913 Bacteria 1788
286 Ga0496111_0035033 3300048914 Unclassified 3586
287 Ga0496112_0183075 3300048915 Bacteria 2059
288 Ga0496113_0292481 3300048916 Bacteria 1303
289 Ga0496114_0014670 3300048917 Bacteria 6296
290 Ga0496115_0093788 3300048918 Bacteria 2455
291 nmdc:mga08y16_273449_c1 3300050511 Bacteria 1743
292 nmdc:mga0rr50_162325_c1 3300050513 Bacteria 1814
293 nmdc:mga08x19_132728_c1 3300050514 Bacteria 1676
294 nmdc:mga08x19_78162_c1 3300050514 Bacteria 2168
295 Ga0495601_0006600 3300053077 Bacteria 6785
296 Ga0495619_0056200 3300053085 Unclassified 2609
297 Ga0495619_0133741 3300053085 Bacteria 1705
298 Ga0207684_10032146
299 JGI24737J22298_10006503
300 JGI24035J26624_1002209
301 JGI25406J46586_10000002
302 Ga0065704_10093618
303 Ga0065712_10000368
304 Ga0065712_10002376
305 Ga0065712_10003447
306 Ga0065712_10147324
307 Ga0065715_10000600
308 Ga0065715_10003763
309 Ga0065715_10092200
310 Ga0065715_10195353
311 Ga0070683_100004003
312 Ga0070683_100038207
313 Ga0070683_100355627
314 Ga0070666_10093820
315 Ga0070666_10199740
316 Ga0068868_100110339
317 Ga0070689_100006841
318 Ga0070689_100018307
319 Ga0070689_100068521
320 Ga0070687_100002232
321 Ga0070687_100015325
322 Ga0070668_100012067
323 Ga0070668_100072722
324 Ga0070675_100006087
325 Ga0070675_100046179
326 Ga0070675_100283831
327 Ga0070671_100131726
328 Ga0070673_100059173
329 Ga0070673_100084857
330 Ga0070688_100011807
331 Ga0070659_100004797
332 Ga0070667_100017945
333 Ga0070709_10064608
334 Ga0070714_100047804
335 Ga0070714_100305458
336 Ga0070714_100504549
337 Ga0070713_100276474
338 Ga0070701_10095303
339 Ga0070711_100017288
340 Ga0070711_100019415
341 Ga0070700_100018243
342 Ga0070694_100034813
343 Ga0070708_100002373
344 Ga0070708_100060336
345 Ga0070708_100084912
346 Ga0070708_100169165
347 Ga0070708_100349805
348 Ga0070663_100239102
349 Ga0070678_100161548
350 Ga0070678_100200763
351 Ga0070662_100024394
352 Ga0070662_100048061
353 Ga0070662_100057615
354 Ga0070662_100264554
355 Ga0070681_10032934
356 Ga0070685_10085816
357 Ga0070706_100000292
358 Ga0070706_100005811
359 Ga0070706_100011433
360 Ga0070706_100211314
361 Ga0070706_100284130
362 Ga0070707_100001401
363 Ga0070707_100014565
364 Ga0070707_100019741
365 Ga0070707_100033327
366 Ga0070707_100036575
367 Ga0070707_100126096
368 Ga0070698_100019517
369 Ga0070698_100037492
370 Ga0070698_100049304
371 Ga0070699_100070676
372 Ga0070699_100112915
373 Ga0070699_100185168
374 Ga0070679_100079750
375 Ga0070684_100000685
376 Ga0070684_100010902
377 Ga0070697_100001711
378 Ga0070697_100006196
379 Ga0070697_100008069
380 Ga0070697_100012967
381 Ga0070697_100033623
382 Ga0070697_100034423
383 Ga0070697_100039745
384 Ga0070697_100044748
385 Ga0070697_100057499
386 Ga0070697_100102891
387 Ga0070697_100127360
388 Ga0070686_100245741
389 Ga0070695_100015252
390 Ga0070665_100085043
391 Ga0070665_100194770
392 Ga0070704_100008542
393 Ga0070664_100100328
394 Ga0068856_100048664
395 Ga0068856_100086626
396 Ga0068859_100107442
397 Ga0068863_100006318
398 Ga0068863_100166682
399 Ga0068858_100022514
400 Ga0068860_100026947
401 Ga0068862_100057169
402 Ga0081455_10004735
403 Ga0081455_10033241
404 Ga0081455_10066637
405 Ga0081540_1041434
406 Ga0081539_10000061
407 Ga0081539_10027445
408 Ga0081539_10045934
409 Ga0070717_10001319
410 Ga0070717_10072730
411 Ga0070717_10174210
412 Ga0070712_100034385
413 Ga0070712_100035048
414 Ga0070712_100235308
415 Ga0097621_100068453
416 Ga0068871_100014007
417 Ga0075436_100138397
418 Ga0097620_100107443
419 Ga0111539_10608987
420 Ga0105245_10150454
421 Ga0105247_10079278
422 Ga0105243_10109459
423 Ga0105237_10075910
424 Ga0105237_10085285
425 Ga0105249_10008396
426 Ga0105249_10023369
427 Ga0105249_10075383
428 Ga0099796_10001818
429 Ga0099796_10031975
430 Ga0105239_10153918
431 Ga0105239_10183801
432 Ga0105246_10215358
433 Ga0157371_10096911
434 Ga0157371_10155493
435 Ga0157369_10024709
436 Ga0157374_10045543
437 Ga0157374_10085016
438 Ga0157374_10250141
439 Ga0157378_10037895
440 Ga0157378_10175126
441 Ga0157378_10250871
442 Ga0157378_10277152
443 Ga0163162_10017070
444 Ga0157372_10120885
445 Ga0157375_10178332
446 Ga0163163_10033074
447 Ga0182008_10027272
448 Ga0157377_10026876
449 Ga0157379_10005045
450 Ga0157376_10078779
451 Ga0157376_10152864
452 Ga0163161_10031417
453 Ga0163161_10082683
454 Ga0207666_1000275
455 Ga0207673_1000481
456 Ga0207697_10003022
457 Ga0207697_10006753
458 Ga0207697_10024372
459 Ga0207697_10040665
460 Ga0207653_10015676
461 Ga0207692_10004751
462 Ga0207647_10023104
463 Ga0207685_10022241
464 Ga0207685_10035866
465 Ga0207699_10116409
466 Ga0207645_10004611
467 Ga0207684_10000347
468 Ga0207684_10004511
469 Ga0207684_10006182
470 Ga0207684_10013334
471 Ga0207684_10043556
472 Ga0207684_10238642
473 Ga0207684_10276507
474 Ga0207693_10035593
475 Ga0207663_10006957
476 Ga0207663_10135201
477 Ga0207662_10001495
478 Ga0207662_10016511
479 Ga0207657_10006654
480 Ga0207657_10084549
481 Ga0207657_10323335
482 Ga0207649_10038504
483 Ga0207652_10189641
484 Ga0207646_10000386
485 Ga0207646_10000411
486 Ga0207646_10033214
487 Ga0207646_10081420
488 Ga0207646_10107321
489 Ga0207646_10180394
490 Ga0207646_10182511
491 Ga0207646_10277739
492 Ga0207659_10034042
493 Ga0207659_10087079
494 Ga0207659_10373874
495 Ga0207687_10269028
496 Ga0207700_10011380
497 Ga0207664_10020497
498 Ga0207664_10117608
499 Ga0207644_10188198
500 Ga0207690_10025990
501 Ga0207690_10043368
502 Ga0207706_10009747
503 Ga0207706_10025485
504 Ga0207706_10051154
505 Ga0207709_10051867
506 Ga0207709_10225953
507 Ga0207670_10183752
508 Ga0207669_10215952
509 Ga0207665_10056464
510 Ga0207691_10118185
511 Ga0207661_10026547
512 Ga0207661_10211543
513 Ga0207651_10098744
514 Ga0207712_10009421
515 Ga0207712_10019455
516 Ga0207668_10041274
517 Ga0207668_10067187
518 Ga0207703_10013778
519 Ga0207639_10190303
520 Ga0207678_10068188
521 Ga0207708_10028679
522 Ga0207702_10024856
523 Ga0207641_10011093
524 Ga0207683_10132299
525 Ga0268266_10048018
526 Ga0268266_10066856
527 Ga0268264_10056689
528 Ga0373936_0090446
529 Ga0373953_0046543
530 Ga0373957_0025619
531 Ga0373943_0028672
532 Ga0373931_0057957
533 Ga0373935_0035087
534 Ga0373935_0077748
535 Ga0373927_0147368
536 Ga0373947_0133224
537 Ga0373937_0287764
538 Ga0373937_0355218
539 Ga0373937_0566470
540 Ga0373925_0035436
541 Ga0373925_0079695
542 Ga0373925_0375306
543 Ga0395898_0119195
544 Ga0439455_0003840
545 Ga0466967_0374032
546 Ga0495603_0184396
547 Ga0495653_0105063
548 Ga0495664_0100596
549 Ga0495608_0168250
550 Ga0495628_0230182
551 Ga0495630_0017159
552 Ga0495666_0116484
553 Ga0495652_0070225
554 Ga0495665_0080152
555 Ga0495587_0038359
556 Ga0495667_0085955
557 Ga0495599_0016333
558 Ga0495623_0008479
559 Ga0495646_0038965
560 Ga0495604_0118048
561 Ga0495604_0126677
562 Ga0495674_0068837
563 Ga0496100_0336817
564 Ga0496101_0076191
565 Ga0496101_0076982
566 Ga0496102_0028612
567 Ga0496102_0031519
568 Ga0496103_0099674
569 Ga0496104_0131062
570 Ga0496104_0282845
571 Ga0496104_0324168
572 Ga0496105_0027386
573 Ga0496107_0073986
574 Ga0496108_0007875
575 Ga0496108_0184210
576 Ga0496108_0391886
577 Ga0496109_0004613
578 Ga0496109_0030614
579 Ga0496109_0154937
580 Ga0496110_0034595
581 Ga0496110_0105531
582 Ga0496110_0205804
583 Ga0496111_0035033
584 Ga0496112_0183075
585 Ga0496113_0292481
586 Ga0496114_0014670
587 Ga0496115_0093788
588 nmdc:mga08y16_273449_c1
589 nmdc:mga0rr50_162325_c1
590 nmdc:mga08x19_132728_c1
591 nmdc:mga08x19_78162_c1
592 Ga0495601_0006600
593 Ga0495619_0056200
594 Ga0495619_0133741

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06925

MGDG_synth

Monogalactosyldiacylglycerol (MGDG) synthase

15

179

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4x1t-assembly1.cif.gz_A the crystal structure of arabidopsis thaliana galactolipid synthase mgd1 in complex with udp 0.8115 3 357
4wyi-assembly1.cif.gz_A the crystal structure of arabidopsis thaliana galactolipid synthase, mgd1 (apo-form) 0.8081 2 357
4x1t-assembly1.cif.gz_A the crystal structure of arabidopsis thaliana galactolipid synthase mgd1 in complex with udp 0.7927 3 357
4wyi-assembly1.cif.gz_A the crystal structure of arabidopsis thaliana galactolipid synthase, mgd1 (apo-form) 0.7902 2 357
3s2u-assembly1.cif.gz_A crystal structure of the pseudomonas aeruginosa murg:udp-glcnac substrate complex 0.7377 4 357
ID Description Score Start End Superfamily
af_Q2FZP7_194_351_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8721 200 339 3.40.50.2000
af_O82730_82_250_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8591 16 181 3.40.50.2000
af_Q2FV16_5_493_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8557 1 41 3.50.50.60
af_A0A1D6KIM9_167_280_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8462 94 181 3.40.50.2000
af_O82730_82_250_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8408 16 181 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A2V5N1Q7-F1-model_v4 UDP-N-acetylglucosamine--LPS N-acetylglucosamine transferase 0.9787 1 187 GO:0009247
GO:0016020
GO:0016758
AF-A0A2V5N1Q7-F1-model_v4 UDP-N-acetylglucosamine--LPS N-acetylglucosamine transferase 0.9736 1 187 GO:0009247
GO:0016020
GO:0016758
AF-A0A2V6L0G3-F1-model_v4 UDP-N-acetylglucosamine--LPS N-acetylglucosamine transferase 0.9642 1 307 GO:0009247
GO:0016020
GO:0016758
AF-A0A2V6L0G3-F1-model_v4 UDP-N-acetylglucosamine--LPS N-acetylglucosamine transferase 0.9582 1 307 GO:0009247
GO:0016020
GO:0016758
AF-A0A2W5Z5R6-F1-model_v4 Glycosyl transferase family 28 C-terminal domain-containing protein 0.9571 202 358 GO:0016758

Map