F392836

General Info

Members Datasets Scaffolds Average Seq Length
295 177 590 303

Family's Representative Sequence

Representative Sequence 3300046689|Ga0495613_0203781|Ga0495613_0203781_275_1273
Length 332
Sequence MEPDDTAPPSNPESGTLKIVIAGGSGFLGRPLAERLAAEGHRVVVLGRHRPSTPSAALRFVEWTASADAAPWIAEVGDADAVVNLAGESIAGRRWSAAHKTRILDSRINATRALAGAISRSPRPPSVFVSGSAVGYYGPLGDEVVTEEQPAGSDFLAGVCVQWEAEAARAATSRTRVACVRTGIVLERDGGALPQMLPPFWFGAGGPVGTGRQYWPWIHRADWVNLVCWILRSPAATGAINATAPAPVTNAEFARALGRALHRPAFMPAPAFALRLILGEMADALLLSGQRAIPAKAERLGFSFTYTRVDDALAAIFHRRDQQTRSPAPGNT

Samples

Sample ID Description Type Environment
1 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
119 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
120 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
121 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
122 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
123 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
124 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
125 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
126 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
127 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
128 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
129 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
130 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
131 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
132 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
133 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
134 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
135 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
136 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
137 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
138 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
139 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
140 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
141 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
142 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
143 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
144 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
145 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
146 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
147 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
154 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
160 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
161 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
162 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
163 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
164 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
165 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
166 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
167 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
170 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
171 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
172 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
173 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
174 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
175 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
176 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
177 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.05
Rhizosphere 96.95
Stem 0
Stem Tuber 0
Unclassified 13.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495613_0203781 3300046689 Bacteria 1394
2 JGI24751J29686_10002449 3300002459 Bacteria 3739
3 Ga0070676_10026239 3300005328 Bacteria 3298
4 Ga0070676_10106342 3300005328 Bacteria 1741
5 Ga0070670_100116563 3300005331 Bacteria 2303
6 Ga0070670_100119460 3300005331 Bacteria 2273
7 Ga0070670_100166553 3300005331 Unclassified 1911
8 Ga0070666_10176967 3300005335 Bacteria 1496
9 Ga0068868_100021522 3300005338 Bacteria 4856
10 Ga0068868_100273663 3300005338 Bacteria 1427
11 Ga0068868_100463726 3300005338 Bacteria 1104
12 Ga0070660_100043831 3300005339 Bacteria 3420
13 Ga0070689_100132250 3300005340 Unclassified 2001
14 Ga0070687_100040582 3300005343 Bacteria 2346
15 Ga0070692_10199098 3300005345 Bacteria 1172
16 Ga0070669_100009926 3300005353 Bacteria 6777
17 Ga0070669_100026470 3300005353 Bacteria 4172
18 Ga0070669_100026842 3300005353 Bacteria 4144
19 Ga0070675_100000116 3300005354 Bacteria 46828
20 Ga0070674_100268482 3300005356 Bacteria 1347
21 Ga0070673_100001779 3300005364 Bacteria 12833
22 Ga0070688_100024517 3300005365 Bacteria 3560
23 Ga0070688_100104292 3300005365 Unclassified 1875
24 Ga0070667_100020291 3300005367 Bacteria 5516
25 Ga0070667_100373090 3300005367 Unclassified 1295
26 Ga0070714_100039800 3300005435 Bacteria 3959
27 Ga0070713_100075771 3300005436 Bacteria 2854
28 Ga0070701_10017033 3300005438 Bacteria 3390
29 Ga0070705_100020502 3300005440 Bacteria 3501
30 Ga0070705_100024315 3300005440 Bacteria 3268
31 Ga0070700_100146766 3300005441 Bacteria 1609
32 Ga0070694_100006060 3300005444 Bacteria 7336
33 Ga0070694_100101310 3300005444 Unclassified 2038
34 Ga0070708_100138837 3300005445 Bacteria 2253
35 Ga0070678_100080263 3300005456 Bacteria 2470
36 Ga0070681_10012443 3300005458 Bacteria 8441
37 Ga0070681_10026975 3300005458 Bacteria 5776
38 Ga0068867_100003466 3300005459 Bacteria 11093
39 Ga0068867_100004963 3300005459 Bacteria 9375
40 Ga0068867_100055253 3300005459 Bacteria 2935
41 Ga0070707_100028398 3300005468 Bacteria 5325
42 Ga0070707_100050869 3300005468 Bacteria 3972
43 Ga0070698_100014641 3300005471 Bacteria 8287
44 Ga0070698_100062114 3300005471 Bacteria 3769
45 Ga0070698_100282331 3300005471 Bacteria 1592
46 Ga0070699_100055865 3300005518 Bacteria 3418
47 Ga0070699_100180842 3300005518 Bacteria 1871
48 Ga0070699_100269830 3300005518 Unclassified 1523
49 Ga0070699_100287295 3300005518 Bacteria 1474
50 Ga0070679_100191871 3300005530 Bacteria 2012
51 Ga0070697_100081181 3300005536 Unclassified 2672
52 Ga0070695_100000285 3300005545 Bacteria 25550
53 Ga0070695_100033987 3300005545 Bacteria 3193
54 Ga0070696_100021566 3300005546 Bacteria 4368
55 Ga0070665_100002605 3300005548 Bacteria 19694
56 Ga0070665_100020416 3300005548 Bacteria 6654
57 Ga0070704_100005612 3300005549 Bacteria 7326
58 Ga0068855_100005715 3300005563 Bacteria 15187
59 Ga0070664_100209409 3300005564 Bacteria 1742
60 Ga0068854_100039225 3300005578 Bacteria 3335
61 Ga0068854_100188291 3300005578 Bacteria 1616
62 Ga0068856_100153706 3300005614 Bacteria 2311
63 Ga0068856_100203158 3300005614 Bacteria 1996
64 Ga0070702_100042793 3300005615 Bacteria 2548
65 Ga0070702_100258369 3300005615 Bacteria 1185
66 Ga0068852_100063813 3300005616 Bacteria 3208
67 Ga0068859_100283660 3300005617 Bacteria 1749
68 Ga0068859_100540792 3300005617 Bacteria 1260
69 Ga0068864_100030066 3300005618 Bacteria 4604
70 Ga0068864_100060929 3300005618 Bacteria 3268
71 Ga0068866_10025730 3300005718 Bacteria 2771
72 Ga0068861_100267109 3300005719 Bacteria 1467
73 Ga0068863_100144358 3300005841 Unclassified 2276
74 Ga0068858_100005554 3300005842 Bacteria 12339
75 Ga0068858_100024063 3300005842 Bacteria 5675
76 Ga0068858_100042016 3300005842 Bacteria 4239
77 Ga0068858_100102360 3300005842 Bacteria 2672
78 Ga0068858_100168229 3300005842 Bacteria 2066
79 Ga0068858_100296685 3300005842 Bacteria 1541
80 Ga0068858_100440915 3300005842 Bacteria 1254
81 Ga0068860_100070080 3300005843 Bacteria 3333
82 Ga0068862_100018667 3300005844 Bacteria 5777
83 Ga0068862_100077121 3300005844 Bacteria 2885
84 Ga0075432_10083608 3300006058 Bacteria 1160
85 Ga0097621_100042252 3300006237 Bacteria 3672
86 Ga0097621_100494592 3300006237 Bacteria 1107
87 Ga0068871_100052506 3300006358 Bacteria 3301
88 Ga0075428_100195638 3300006844 Archaea 2186
89 Ga0075431_100078315 3300006847 Bacteria 3412
90 Ga0075431_100631080 3300006847 Bacteria 1053
91 Ga0075433_10039849 3300006852 Bacteria 4064
92 Ga0075433_10052425 3300006852 Bacteria 3555
93 Ga0075433_10188103 3300006852 Bacteria 1837
94 Ga0075433_10260239 3300006852 Bacteria 1538
95 Ga0075433_10495342 3300006852 Bacteria 1076
96 Ga0075434_100209773 3300006871 Unclassified 1968
97 Ga0075434_100348393 3300006871 Bacteria 1502
98 Ga0075434_100429425 3300006871 Bacteria 1342
99 Ga0075429_100182512 3300006880 Archaea 1839
100 Ga0068865_100009331 3300006881 Bacteria 6078
101 Ga0075436_100014737 3300006914 Bacteria 5358
102 Ga0075436_100133105 3300006914 Bacteria 1744
103 Ga0097620_100283642 3300006931 Bacteria 1749
104 Ga0097620_100540751 3300006931 Bacteria 1260
105 Ga0075435_100001719 3300007076 Bacteria 14224
106 Ga0075435_100050440 3300007076 Unclassified 3349
107 Ga0075435_100590559 3300007076 Bacteria 963
108 Ga0105240_10145744 3300009093 Bacteria 2826
109 Ga0105240_10226399 3300009093 Bacteria 2176
110 Ga0111539_10003099 3300009094 Bacteria 22033
111 Ga0111539_10029314 3300009094 Bacteria 6705
112 Ga0111539_10682836 3300009094 Unclassified 1195
113 Ga0105245_10164942 3300009098 Bacteria 2105
114 Ga0105245_10241403 3300009098 Bacteria 1751
115 Ga0105245_10599049 3300009098 Bacteria 1128
116 Ga0105247_10001308 3300009101 Bacteria 18279
117 Ga0114129_10003207 3300009147 Bacteria 22951
118 Ga0114129_10003412 3300009147 Bacteria 22328
119 Ga0114129_10003501 3300009147 Bacteria 22077
120 Ga0114129_10025410 3300009147 Bacteria 8392
121 Ga0114129_10035420 3300009147 Bacteria 7051
122 Ga0114129_10096638 3300009147 Bacteria 4089
123 Ga0114129_10172918 3300009147 Bacteria 2944
124 Ga0105243_10016193 3300009148 Bacteria 5641
125 Ga0105243_10069984 3300009148 Bacteria 2832
126 Ga0105243_10550911 3300009148 Unclassified 1102
127 Ga0105242_10001526 3300009176 Bacteria 18195
128 Ga0105242_10005531 3300009176 Bacteria 9751
129 Ga0105248_10007351 3300009177 Bacteria 12085
130 Ga0105248_10201955 3300009177 Unclassified 2240
131 Ga0105248_10204203 3300009177 Bacteria 2227
132 Ga0105248_10583723 3300009177 Bacteria 1261
133 Ga0105237_10346536 3300009545 Bacteria 1490
134 Ga0105249_10257059 3300009553 Bacteria 1734
135 Ga0105249_10622678 3300009553 Bacteria 1135
136 Ga0157374_10487877 3300013296 Unclassified 1236
137 Ga0163162_10080076 3300013306 Bacteria 3334
138 Ga0157375_10040807 3300013308 Bacteria 4476
139 Ga0163163_10389806 3300014325 Unclassified 1451
140 Ga0157380_10388822 3300014326 Bacteria 1319
141 Ga0157377_10055532 3300014745 Unclassified 2246
142 Ga0157377_10106340 3300014745 Bacteria 1680
143 Ga0157379_10010941 3300014968 Bacteria 7911
144 Ga0157379_10087909 3300014968 Bacteria 2786
145 Ga0157379_10124062 3300014968 Bacteria 2324
146 Ga0157376_10011578 3300014969 Bacteria 6510
147 Ga0157376_10037161 3300014969 Bacteria 3950
148 Ga0157376_10298892 3300014969 Bacteria 1523
149 Ga0207710_10003024 3300025900 Bacteria 7575
150 Ga0207680_10041851 3300025903 Bacteria 2676
151 Ga0207645_10007127 3300025907 Bacteria 7937
152 Ga0207643_10206169 3300025908 Bacteria 1199
153 Ga0207695_10102922 3300025913 Unclassified 2848
154 Ga0207695_10131565 3300025913 Bacteria 2459
155 Ga0207695_10398177 3300025913 Bacteria 1261
156 Ga0207657_10002930 3300025919 Bacteria 18321
157 Ga0207646_10053191 3300025922 Bacteria 3622
158 Ga0207681_10006142 3300025923 Bacteria 7370
159 Ga0207681_10006649 3300025923 Bacteria 7100
160 Ga0207650_10031465 3300025925 Bacteria 3832
161 Ga0207650_10043374 3300025925 Unclassified 3301
162 Ga0207659_10000064 3300025926 Bacteria 67058
163 Ga0207659_10118815 3300025926 Unclassified 2023
164 Ga0207659_10208653 3300025926 Bacteria 1564
165 Ga0207687_10105013 3300025927 Unclassified 2086
166 Ga0207664_10037776 3300025929 Bacteria 3740
167 Ga0207644_10078510 3300025931 Unclassified 2433
168 Ga0207706_10114614 3300025933 Bacteria 2371
169 Ga0207706_10138985 3300025933 Unclassified 2137
170 Ga0207686_10010656 3300025934 Bacteria 5007
171 Ga0207686_10313291 3300025934 Bacteria 1170
172 Ga0207709_10022996 3300025935 Bacteria 3543
173 Ga0207669_10327108 3300025937 Bacteria 1175
174 Ga0207704_10371924 3300025938 Bacteria 1119
175 Ga0207665_10088551 3300025939 Bacteria 2142
176 Ga0207691_10119653 3300025940 Bacteria 2335
177 Ga0207711_10024083 3300025941 Bacteria 5096
178 Ga0207711_10025737 3300025941 Bacteria 4934
179 Ga0207711_10039416 3300025941 Bacteria 4019
180 Ga0207711_10219563 3300025941 Bacteria 1738
181 Ga0207711_10230864 3300025941 Bacteria 1695
182 Ga0207711_10286332 3300025941 Bacteria 1518
183 Ga0207667_10041598 3300025949 Bacteria 4886
184 Ga0207651_10012085 3300025960 Bacteria 4865
185 Ga0207668_10086484 3300025972 Bacteria 2290
186 Ga0207658_10041470 3300025986 Bacteria 3333
187 Ga0207677_10227561 3300026023 Bacteria 1500
188 Ga0207677_10233951 3300026023 Unclassified 1482
189 Ga0207703_10006998 3300026035 Bacteria 8975
190 Ga0207703_10029585 3300026035 Bacteria 4323
191 Ga0207703_10146403 3300026035 Bacteria 2055
192 Ga0207703_10169743 3300026035 Unclassified 1918
193 Ga0207708_10044860 3300026075 Bacteria 3369
194 Ga0207708_10172947 3300026075 Bacteria 1712
195 Ga0207641_10023874 3300026088 Bacteria 5040
196 Ga0207641_10039322 3300026088 Bacteria 3956
197 Ga0207641_10257865 3300026088 Bacteria 1631
198 Ga0207648_10018093 3300026089 Bacteria 6383
199 Ga0207648_10052379 3300026089 Bacteria 3568
200 Ga0207648_10059090 3300026089 Bacteria 3344
201 Ga0207648_10119779 3300026089 Bacteria 2314
202 Ga0207648_10132466 3300026089 Bacteria 2194
203 Ga0207648_10143025 3300026089 Bacteria 2109
204 Ga0207676_10209750 3300026095 Bacteria 1727
205 Ga0207675_100126033 3300026118 Unclassified 2425
206 Ga0207675_100139936 3300026118 Bacteria 2299
207 Ga0207683_10142975 3300026121 Bacteria 2156
208 Ga0207428_10004093 3300027907 Bacteria 13970
209 Ga0268266_10008826 3300028379 Bacteria 8924
210 Ga0268266_10118877 3300028379 Bacteria 2350
211 Ga0268265_10014694 3300028380 Bacteria 5340
212 Ga0268265_10146380 3300028380 Bacteria 1985
213 Ga0268264_10477024 3300028381 Bacteria 1213
214 Ga0307408_100029092 3300031548 Bacteria 3825
215 Ga0373944_0010410 3300035089 Unclassified 2535
216 Ga0373939_0018524 3300035114 Bacteria 1867
217 Ga0373941_0058127 3300035115 Bacteria 1251
218 Ga0373957_0070868 3300035120 Bacteria 1363
219 Ga0373960_0017380 3300035121 Bacteria 1864
220 Ga0373943_0030739 3300035170 Unclassified 2544
221 Ga0373943_0033294 3300035170 Unclassified 2454
222 Ga0373955_0168676 3300035172 Bacteria 1295
223 Ga0373935_0245985 3300035692 Bacteria 1250
224 Ga0373927_0033158 3300035695 Bacteria 3363
225 Ga0373933_0185983 3300035724 Bacteria 1326
226 Ga0373933_0204917 3300035724 Unclassified 1263
227 Ga0373947_0077828 3300035725 Bacteria 2046
228 Ga0373947_0184211 3300035725 Bacteria 1361
229 Ga0450896_006910 3300042133 Bacteria 1561
230 Ga0439464_0018555 3300042439 Bacteria 1893
231 Ga0439440_0071648 3300042993 Bacteria 903
232 Ga0451576_0055153 3300045051 Bacteria 4159
233 Ga0495592_0162917 3300046454 Bacteria 1533
234 Ga0495603_0050020 3300046455 Bacteria 2487
235 Ga0495629_0172878 3300046459 Bacteria 1499
236 Ga0495628_0121610 3300046516 Bacteria 2002
237 Ga0495665_0074846 3300046531 Bacteria 1783
238 Ga0495640_0103348 3300046533 Bacteria 1868
239 Ga0495621_0024509 3300046539 Bacteria 2016
240 Ga0495645_0044455 3300046543 Bacteria 3239
241 Ga0495667_0090084 3300046559 Bacteria 1988
242 Ga0495634_0085517 3300046642 Bacteria 2055
243 Ga0495635_0058997 3300046663 Bacteria 2639
244 Ga0495658_0060875 3300046683 Unclassified 2166
245 Ga0495604_0197116 3300047317 Bacteria 1400
246 Ga0495674_0080066 3300047319 Bacteria 2804
247 Ga0495684_0369066 3300047471 Bacteria 1015
248 Ga0496104_0469142 3300048907 Bacteria 1170
249 Ga0496108_0036609 3300048911 Bacteria 4083
250 Ga0496110_0310521 3300048913 Unclassified 1436
251 Ga0496111_0250660 3300048914 Unclassified 1314
252 Ga0496112_0190793 3300048915 Bacteria 2011
253 Ga0496112_0691323 3300048915 Bacteria 948
254 Ga0496114_0026616 3300048917 Unclassified 4737
255 Ga0496114_0107469 3300048917 Bacteria 2388
256 Ga0496114_0349889 3300048917 Bacteria 1307
257 Ga0501036_0014284 3300049572 Bacteria 6608
258 Ga0501040_0135736 3300049576 Bacteria 1732
259 Ga0501041_0004994 3300049577 Bacteria 7721
260 Ga0501042_0248242 3300049578 Bacteria 1284
261 Ga0501048_0185754 3300049582 Bacteria 1473
262 Ga0501071_0010435 3300049587 Bacteria 6224
263 Ga0501071_0152997 3300049587 Bacteria 1721
264 Ga0501072_0026565 3300049588 Bacteria 4514
265 Ga0501074_0375184 3300049590 Unclassified 1009
266 Ga0501076_0006881 3300049592 Bacteria 8260
267 Ga0501076_0021642 3300049592 Bacteria 4935
268 Ga0501077_0061362 3300049593 Unclassified 2386
269 Ga0501083_0261689 3300049744 Bacteria 1125
270 Ga0501045_0008674 3300049824 Bacteria 7089
271 nmdc:mga05p37_136126_c1 3300050507 Bacteria 3012
272 nmdc:mga05p37_14528_c1 3300050507 Bacteria 9455
273 nmdc:mga05p37_22365_c1 3300050507 Bacteria 7670
274 nmdc:mga05p37_3402_c1 3300050507 Bacteria 18563
275 nmdc:mga05p37_37918_c1 3300050507 Bacteria 5911
276 nmdc:mga05p37_49101_c1 3300050507 Bacteria 5190
277 nmdc:mga05p37_7175_c1 3300050507 Bacteria 13141
278 nmdc:mga06r32_261693_c1 3300050510 Bacteria 1717
279 nmdc:mga06r32_76460_c1 3300050510 Bacteria 3251
280 nmdc:mga08y16_53047_c1 3300050511 Unclassified 4241
281 nmdc:mga0n895_50820_c1 3300050512 Bacteria 4065
282 nmdc:mga0n895_55420_c1 3300050512 Bacteria 3902
283 nmdc:mga0rr50_157511_c1 3300050513 Unclassified 1841
284 nmdc:mga0rr50_16481_c1 3300050513 Bacteria 4911
285 nmdc:mga0rr50_52740_c1 3300050513 Bacteria 3023
286 nmdc:mga08x19_13595_c1 3300050514 Bacteria 4923
287 nmdc:mga08x19_9615_c1 3300050514 Bacteria 5789
288 nmdc:mga0a205_240835_c1 3300050515 Bacteria 1690
289 nmdc:mga0a205_72970_c1 3300050515 Bacteria 3316
290 Ga0495619_0066759 3300053085 Unclassified 2401
291 Ga0501084_0231761 3300054114 Bacteria 1559
292 Ga0501084_0242375 3300054114 Unclassified 1522
293 Ga0590071_000303 3300059421 Bacteria 14415
294 Ga0590077_002567 3300059426 Bacteria 3850
295 Ga0530510_0173390 3300061734 Bacteria 1598
296 Ga0495613_0203781
297 JGI24751J29686_10002449
298 Ga0070676_10026239
299 Ga0070676_10106342
300 Ga0070670_100116563
301 Ga0070670_100119460
302 Ga0070670_100166553
303 Ga0070666_10176967
304 Ga0068868_100021522
305 Ga0068868_100273663
306 Ga0068868_100463726
307 Ga0070660_100043831
308 Ga0070689_100132250
309 Ga0070687_100040582
310 Ga0070692_10199098
311 Ga0070669_100009926
312 Ga0070669_100026470
313 Ga0070669_100026842
314 Ga0070675_100000116
315 Ga0070674_100268482
316 Ga0070673_100001779
317 Ga0070688_100024517
318 Ga0070688_100104292
319 Ga0070667_100020291
320 Ga0070667_100373090
321 Ga0070714_100039800
322 Ga0070713_100075771
323 Ga0070701_10017033
324 Ga0070705_100020502
325 Ga0070705_100024315
326 Ga0070700_100146766
327 Ga0070694_100006060
328 Ga0070694_100101310
329 Ga0070708_100138837
330 Ga0070678_100080263
331 Ga0070681_10012443
332 Ga0070681_10026975
333 Ga0068867_100003466
334 Ga0068867_100004963
335 Ga0068867_100055253
336 Ga0070707_100028398
337 Ga0070707_100050869
338 Ga0070698_100014641
339 Ga0070698_100062114
340 Ga0070698_100282331
341 Ga0070699_100055865
342 Ga0070699_100180842
343 Ga0070699_100269830
344 Ga0070699_100287295
345 Ga0070679_100191871
346 Ga0070697_100081181
347 Ga0070695_100000285
348 Ga0070695_100033987
349 Ga0070696_100021566
350 Ga0070665_100002605
351 Ga0070665_100020416
352 Ga0070704_100005612
353 Ga0068855_100005715
354 Ga0070664_100209409
355 Ga0068854_100039225
356 Ga0068854_100188291
357 Ga0068856_100153706
358 Ga0068856_100203158
359 Ga0070702_100042793
360 Ga0070702_100258369
361 Ga0068852_100063813
362 Ga0068859_100283660
363 Ga0068859_100540792
364 Ga0068864_100030066
365 Ga0068864_100060929
366 Ga0068866_10025730
367 Ga0068861_100267109
368 Ga0068863_100144358
369 Ga0068858_100005554
370 Ga0068858_100024063
371 Ga0068858_100042016
372 Ga0068858_100102360
373 Ga0068858_100168229
374 Ga0068858_100296685
375 Ga0068858_100440915
376 Ga0068860_100070080
377 Ga0068862_100018667
378 Ga0068862_100077121
379 Ga0075432_10083608
380 Ga0097621_100042252
381 Ga0097621_100494592
382 Ga0068871_100052506
383 Ga0075428_100195638
384 Ga0075431_100078315
385 Ga0075431_100631080
386 Ga0075433_10039849
387 Ga0075433_10052425
388 Ga0075433_10188103
389 Ga0075433_10260239
390 Ga0075433_10495342
391 Ga0075434_100209773
392 Ga0075434_100348393
393 Ga0075434_100429425
394 Ga0075429_100182512
395 Ga0068865_100009331
396 Ga0075436_100014737
397 Ga0075436_100133105
398 Ga0097620_100283642
399 Ga0097620_100540751
400 Ga0075435_100001719
401 Ga0075435_100050440
402 Ga0075435_100590559
403 Ga0105240_10145744
404 Ga0105240_10226399
405 Ga0111539_10003099
406 Ga0111539_10029314
407 Ga0111539_10682836
408 Ga0105245_10164942
409 Ga0105245_10241403
410 Ga0105245_10599049
411 Ga0105247_10001308
412 Ga0114129_10003207
413 Ga0114129_10003412
414 Ga0114129_10003501
415 Ga0114129_10025410
416 Ga0114129_10035420
417 Ga0114129_10096638
418 Ga0114129_10172918
419 Ga0105243_10016193
420 Ga0105243_10069984
421 Ga0105243_10550911
422 Ga0105242_10001526
423 Ga0105242_10005531
424 Ga0105248_10007351
425 Ga0105248_10201955
426 Ga0105248_10204203
427 Ga0105248_10583723
428 Ga0105237_10346536
429 Ga0105249_10257059
430 Ga0105249_10622678
431 Ga0157374_10487877
432 Ga0163162_10080076
433 Ga0157375_10040807
434 Ga0163163_10389806
435 Ga0157380_10388822
436 Ga0157377_10055532
437 Ga0157377_10106340
438 Ga0157379_10010941
439 Ga0157379_10087909
440 Ga0157379_10124062
441 Ga0157376_10011578
442 Ga0157376_10037161
443 Ga0157376_10298892
444 Ga0207710_10003024
445 Ga0207680_10041851
446 Ga0207645_10007127
447 Ga0207643_10206169
448 Ga0207695_10102922
449 Ga0207695_10131565
450 Ga0207695_10398177
451 Ga0207657_10002930
452 Ga0207646_10053191
453 Ga0207681_10006142
454 Ga0207681_10006649
455 Ga0207650_10031465
456 Ga0207650_10043374
457 Ga0207659_10000064
458 Ga0207659_10118815
459 Ga0207659_10208653
460 Ga0207687_10105013
461 Ga0207664_10037776
462 Ga0207644_10078510
463 Ga0207706_10114614
464 Ga0207706_10138985
465 Ga0207686_10010656
466 Ga0207686_10313291
467 Ga0207709_10022996
468 Ga0207669_10327108
469 Ga0207704_10371924
470 Ga0207665_10088551
471 Ga0207691_10119653
472 Ga0207711_10024083
473 Ga0207711_10025737
474 Ga0207711_10039416
475 Ga0207711_10219563
476 Ga0207711_10230864
477 Ga0207711_10286332
478 Ga0207667_10041598
479 Ga0207651_10012085
480 Ga0207668_10086484
481 Ga0207658_10041470
482 Ga0207677_10227561
483 Ga0207677_10233951
484 Ga0207703_10006998
485 Ga0207703_10029585
486 Ga0207703_10146403
487 Ga0207703_10169743
488 Ga0207708_10044860
489 Ga0207708_10172947
490 Ga0207641_10023874
491 Ga0207641_10039322
492 Ga0207641_10257865
493 Ga0207648_10018093
494 Ga0207648_10052379
495 Ga0207648_10059090
496 Ga0207648_10119779
497 Ga0207648_10132466
498 Ga0207648_10143025
499 Ga0207676_10209750
500 Ga0207675_100126033
501 Ga0207675_100139936
502 Ga0207683_10142975
503 Ga0207428_10004093
504 Ga0268266_10008826
505 Ga0268266_10118877
506 Ga0268265_10014694
507 Ga0268265_10146380
508 Ga0268264_10477024
509 Ga0307408_100029092
510 Ga0373944_0010410
511 Ga0373939_0018524
512 Ga0373941_0058127
513 Ga0373957_0070868
514 Ga0373960_0017380
515 Ga0373943_0030739
516 Ga0373943_0033294
517 Ga0373955_0168676
518 Ga0373935_0245985
519 Ga0373927_0033158
520 Ga0373933_0185983
521 Ga0373933_0204917
522 Ga0373947_0077828
523 Ga0373947_0184211
524 Ga0450896_006910
525 Ga0439464_0018555
526 Ga0439440_0071648
527 Ga0451576_0055153
528 Ga0495592_0162917
529 Ga0495603_0050020
530 Ga0495629_0172878
531 Ga0495628_0121610
532 Ga0495665_0074846
533 Ga0495640_0103348
534 Ga0495621_0024509
535 Ga0495645_0044455
536 Ga0495667_0090084
537 Ga0495634_0085517
538 Ga0495635_0058997
539 Ga0495658_0060875
540 Ga0495604_0197116
541 Ga0495674_0080066
542 Ga0495684_0369066
543 Ga0496104_0469142
544 Ga0496108_0036609
545 Ga0496110_0310521
546 Ga0496111_0250660
547 Ga0496112_0190793
548 Ga0496112_0691323
549 Ga0496114_0026616
550 Ga0496114_0107469
551 Ga0496114_0349889
552 Ga0501036_0014284
553 Ga0501040_0135736
554 Ga0501041_0004994
555 Ga0501042_0248242
556 Ga0501048_0185754
557 Ga0501071_0010435
558 Ga0501071_0152997
559 Ga0501072_0026565
560 Ga0501074_0375184
561 Ga0501076_0006881
562 Ga0501076_0021642
563 Ga0501077_0061362
564 Ga0501083_0261689
565 Ga0501045_0008674
566 nmdc:mga05p37_136126_c1
567 nmdc:mga05p37_14528_c1
568 nmdc:mga05p37_22365_c1
569 nmdc:mga05p37_3402_c1
570 nmdc:mga05p37_37918_c1
571 nmdc:mga05p37_49101_c1
572 nmdc:mga05p37_7175_c1
573 nmdc:mga06r32_261693_c1
574 nmdc:mga06r32_76460_c1
575 nmdc:mga08y16_53047_c1
576 nmdc:mga0n895_50820_c1
577 nmdc:mga0n895_55420_c1
578 nmdc:mga0rr50_157511_c1
579 nmdc:mga0rr50_16481_c1
580 nmdc:mga0rr50_52740_c1
581 nmdc:mga08x19_13595_c1
582 nmdc:mga08x19_9615_c1
583 nmdc:mga0a205_240835_c1
584 nmdc:mga0a205_72970_c1
585 Ga0495619_0066759
586 Ga0501084_0231761
587 Ga0501084_0242375
588 Ga0590071_000303
589 Ga0590077_002567
590 Ga0530510_0173390

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08338

DUF1731

Domain of unknown function (DUF1731)

269

316

0.98

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

19

242

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4b4o-assembly6.cif.gz_F crystal structure of human epimerase family protein sdr39u1 (isoform2) with nadph 0.9078 1 307
4b4o-assembly6.cif.gz_F crystal structure of human epimerase family protein sdr39u1 (isoform2) with nadph 0.8962 1 307
3oh8-assembly1.cif.gz_A crystal structure of the nucleoside-diphosphate sugar epimerase from corynebacterium glutamicum. northeast structural genomics consortium target cgr91 0.8864 1 308
3m2p-assembly2.cif.gz_F the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus 0.8093 1 307
6y79-assembly1.cif.gz_E cryo-em structure of a respiratory complex i f89a mutant 0.7964 2 253
ID Description Score Start End Superfamily
af_K7K156_39_177_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9454 1 33 3.40.50.720
af_Q54LY2_135_306_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9389 2 31 3.40.50.720
af_A0A1D6H4Q8_14_113_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9357 1 32 3.40.50.720
af_A0A1D6I798_6_113_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9326 2 32 3.40.50.720
af_P9WGP7_2_287_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9322 2 296 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7W1P9Q5-F1-model_v4 TIGR01777 family protein 0.9837 1 233
AF-A0A7W1P9Q5-F1-model_v4 TIGR01777 family protein 0.9796 1 233
AF-A0A3D1CFI4-F1-model_v4 TIGR01777 family protein 0.9729 129 306
AF-A0A1V5PVJ2-F1-model_v4 Epimerase family protein 0.9708 109 306
AF-A0A2N9LNI8-F1-model_v4 Epimerase family protein YfcH 0.9697 110 307

Map