F392504

General Info

Members Datasets Scaffolds Average Seq Length
295 160 590 415

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10034889|Ga0070709_100348892
Length 430
Sequence VRSLSRTGGDLEQVSYGEFSANLHQRQSGERVPLQVSIEVTRRCPLECQHCYNNLPMGDLEAKSREMTKEEHFRVLDELVEMGCFWILYTGGEIFARKDFLEIYTYAKKKGFLITLFTNGTIITEQIADYLAEWPPFAIEITLYGRTRETYEALTMIPGSYDRCLRGIRLLKERGLPLKLKTVATSINKHEVMAMRRFAEDEFGVEFKMDGQINPRIDCSQSPLAVRLTPEELVALDMAAPKAVDEYRRLAKRDFENPPNMAVSNTLYFCGGGVGGFALNAHGELGICVISQQETFQVRDAGVREIWEGSLAELRNRKRVRRTKCTTCRIQSLCGMCPANGELESGDRESPVEFLCEVAHLRAAVIGAEVPGHGDCNFCRGGSQHDSVLESARRIVTKEVDVEAWAPQHLLPILNNSQMPTGGCGACGSH

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
65 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
66 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
102 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
105 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
106 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
107 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
108 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
109 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
111 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
112 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
113 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
114 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
115 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
116 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
117 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
118 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
119 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
120 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
121 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
122 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
125 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
126 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
127 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
128 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
129 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
130 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
131 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
132 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
133 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
134 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
135 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
136 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
137 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
138 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
139 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
140 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
141 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
142 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
143 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
144 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
145 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
146 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
147 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
148 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
149 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
153 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
154 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
155 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
156 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
157 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
158 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
159 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
160 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.64
Metatranscriptomes 1.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.02
Rhizosphere 98.98
Stem 0
Stem Tuber 0
Unclassified 15.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10034889 3300005434 Bacteria 3054
2 Ga0070683_100044213 3300005329 Bacteria 4107
3 Ga0070670_100003088 3300005331 Bacteria 13775
4 Ga0070661_100006537 3300005344 Bacteria 8043
5 Ga0070669_100021576 3300005353 Bacteria 4602
6 Ga0070675_100147272 3300005354 Bacteria 2017
7 Ga0070709_10001608 3300005434 Bacteria 12197
8 Ga0070709_10029756 3300005434 Bacteria 3270
9 Ga0070709_10029839 3300005434 Unclassified 3266
10 Ga0070709_10117029 3300005434 Bacteria 1800
11 Ga0070714_100000197 3300005435 Bacteria 48773
12 Ga0070714_100001161 3300005435 Bacteria 18973
13 Ga0070714_100027260 3300005435 Unclassified 4729
14 Ga0070714_100093462 3300005435 Bacteria 2637
15 Ga0070714_100174247 3300005435 Bacteria 1954
16 Ga0070713_100009362 3300005436 Bacteria 7005
17 Ga0070713_100011125 3300005436 Bacteria 6538
18 Ga0070713_100014689 3300005436 Bacteria 5824
19 Ga0070713_100016822 3300005436 Bacteria 5509
20 Ga0070713_100024587 3300005436 Bacteria 4695
21 Ga0070713_100033528 3300005436 Bacteria 4114
22 Ga0070713_100084561 3300005436 Unclassified 2715
23 Ga0070713_100217103 3300005436 Bacteria 1734
24 Ga0070710_10004819 3300005437 Bacteria 6382
25 Ga0070711_100002773 3300005439 Bacteria 10045
26 Ga0070711_100013879 3300005439 Bacteria 5068
27 Ga0070711_100054751 3300005439 Unclassified 2754
28 Ga0070708_100006586 3300005445 Bacteria 9245
29 Ga0070708_100012107 3300005445 Bacteria 7032
30 Ga0070708_100033043 3300005445 Bacteria 4493
31 Ga0070708_100149823 3300005445 Bacteria 2169
32 Ga0070662_100060745 3300005457 Bacteria 2757
33 Ga0070681_10004267 3300005458 Bacteria 13562
34 Ga0068867_100008902 3300005459 Bacteria 7084
35 Ga0070706_100037914 3300005467 Unclassified 4450
36 Ga0070706_100166470 3300005467 Bacteria 2058
37 Ga0070707_100009770 3300005468 Bacteria 8920
38 Ga0070707_100041563 3300005468 Bacteria 4400
39 Ga0070707_100128213 3300005468 Bacteria 2466
40 Ga0070698_100044803 3300005471 Bacteria 4527
41 Ga0070699_100004413 3300005518 Bacteria 12433
42 Ga0070699_100044797 3300005518 Unclassified 3830
43 Ga0070699_100140098 3300005518 Unclassified 2135
44 Ga0070679_100028830 3300005530 Bacteria 5476
45 Ga0070697_100000065 3300005536 Bacteria 84031
46 Ga0070697_100004593 3300005536 Bacteria 10610
47 Ga0070697_100030759 3300005536 Unclassified 4314
48 Ga0070697_100118818 3300005536 Bacteria 2209
49 Ga0070693_100065322 3300005547 Bacteria 2126
50 Ga0070665_100171716 3300005548 Unclassified 2169
51 Ga0070704_100030838 3300005549 Bacteria 3597
52 Ga0068855_100047792 3300005563 Bacteria 5054
53 Ga0068855_100379486 3300005563 Bacteria 1552
54 Ga0070664_100002323 3300005564 Bacteria 15271
55 Ga0068857_100001429 3300005577 Bacteria 18919
56 Ga0068854_100010109 3300005578 Bacteria 6114
57 Ga0068854_100011270 3300005578 Bacteria 5813
58 Ga0068856_100000483 3300005614 Bacteria 44122
59 Ga0068856_100023965 3300005614 Bacteria 5936
60 Ga0068856_100024062 3300005614 Bacteria 5926
61 Ga0068856_100075142 3300005614 Bacteria 3347
62 Ga0068859_100000034 3300005617 Bacteria 171376
63 Ga0068859_100000914 3300005617 Bacteria 30190
64 Ga0068859_100189508 3300005617 Unclassified 2141
65 Ga0068864_100000899 3300005618 Bacteria 25043
66 Ga0068866_10075152 3300005718 Unclassified 1798
67 Ga0068861_100061457 3300005719 Bacteria 2883
68 Ga0068863_100043423 3300005841 Bacteria 4268
69 Ga0068858_100004479 3300005842 Bacteria 13692
70 Ga0068860_100009124 3300005843 Bacteria 9865
71 Ga0068862_100057618 3300005844 Unclassified 3333
72 Ga0070717_10000096 3300006028 Bacteria 68299
73 Ga0070717_10000383 3300006028 Bacteria 28372
74 Ga0070717_10001849 3300006028 Bacteria 14772
75 Ga0070717_10007926 3300006028 Bacteria 7911
76 Ga0070717_10009197 3300006028 Bacteria 7425
77 Ga0070717_10009560 3300006028 Bacteria 7292
78 Ga0070717_10013081 3300006028 Bacteria 6341
79 Ga0070717_10032896 3300006028 Archaea 4181
80 Ga0070717_10099299 3300006028 Bacteria 2470
81 Ga0070717_10103896 3300006028 Bacteria 2416
82 Ga0070717_10196376 3300006028 Bacteria 1765
83 Ga0070715_10020454 3300006163 Bacteria 2553
84 Ga0070715_10029896 3300006163 Bacteria 2197
85 Ga0070712_100000038 3300006175 Bacteria 67408
86 Ga0070712_100002448 3300006175 Bacteria 11438
87 Ga0070712_100004341 3300006175 Bacteria 8738
88 Ga0070712_100010326 3300006175 Bacteria 5887
89 Ga0070712_100053305 3300006175 Bacteria 2824
90 Ga0070712_100095633 3300006175 Unclassified 2186
91 Ga0097621_100031900 3300006237 Unclassified 4183
92 Ga0097621_100051339 3300006237 Bacteria 3356
93 Ga0097621_100060060 3300006237 Bacteria 3115
94 Ga0068871_100013975 3300006358 Bacteria 5972
95 Ga0068871_100020025 3300006358 Bacteria 5119
96 Ga0068871_100034750 3300006358 Bacteria 4002
97 Ga0075431_100126198 3300006847 Bacteria 2640
98 Ga0075431_100252423 3300006847 Bacteria 1792
99 Ga0075433_10100154 3300006852 Unclassified 2565
100 Ga0075434_100020896 3300006871 Bacteria 6357
101 Ga0075434_100090720 3300006871 Unclassified 3057
102 Ga0075436_100001622 3300006914 Bacteria 15393
103 Ga0075436_100010375 3300006914 Bacteria 6383
104 Ga0097620_100000034 3300006931 Bacteria 171376
105 Ga0097620_100000914 3300006931 Bacteria 30190
106 Ga0097620_100189500 3300006931 Unclassified 2141
107 Ga0075435_100010100 3300007076 Bacteria 6889
108 Ga0075435_100017812 3300007076 Bacteria 5384
109 Ga0075435_100034503 3300007076 Bacteria 4010
110 Ga0105240_10009817 3300009093 Bacteria 13509
111 Ga0105240_10057634 3300009093 Bacteria 4852
112 Ga0105240_10135613 3300009093 Bacteria 2948
113 Ga0105240_10329030 3300009093 Bacteria 1739
114 Ga0105245_10002074 3300009098 Bacteria 18185
115 Ga0105245_10070436 3300009098 Bacteria 3173
116 Ga0105241_10004752 3300009174 Bacteria 10008
117 Ga0105241_10058113 3300009174 Bacteria 2969
118 Ga0105241_10087098 3300009174 Bacteria 2457
119 Ga0105248_10296119 3300009177 Bacteria 1822
120 Ga0105237_10034557 3300009545 Bacteria 5119
121 Ga0105238_10027763 3300009551 Bacteria 5768
122 Ga0105249_10293499 3300009553 Unclassified 1628
123 Ga0105239_10113555 3300010375 Bacteria 3004
124 Ga0157373_10002900 3300013100 Bacteria 12983
125 Ga0157373_10014603 3300013100 Bacteria 5756
126 Ga0157373_10028119 3300013100 Unclassified 4057
127 Ga0157370_10064591 3300013104 Bacteria 3465
128 Ga0157369_10010221 3300013105 Bacteria 10710
129 Ga0157369_10066744 3300013105 Bacteria 3870
130 Ga0157369_10173338 3300013105 Bacteria 2272
131 Ga0157374_10000305 3300013296 Bacteria 45523
132 Ga0157378_10000265 3300013297 Bacteria 50886
133 Ga0163162_10064329 3300013306 Bacteria 3713
134 Ga0157372_10001033 3300013307 Bacteria 30439
135 Ga0157372_10001204 3300013307 Bacteria 27976
136 Ga0157372_10008399 3300013307 Bacteria 10972
137 Ga0157372_10011359 3300013307 Bacteria 9472
138 Ga0157372_10081915 3300013307 Unclassified 3653
139 Ga0163163_10247487 3300014325 Unclassified 1833
140 Ga0224569_100077 3300022732 Bacteria 6487
141 Ga0224571_100213 3300022734 Bacteria 2826
142 Ga0207692_10001303 3300025898 Bacteria 9289
143 Ga0207642_10051168 3300025899 Unclassified 1868
144 Ga0207685_10017088 3300025905 Bacteria 2336
145 Ga0207699_10001216 3300025906 Bacteria 12208
146 Ga0207699_10021075 3300025906 Bacteria 3505
147 Ga0207699_10024841 3300025906 Bacteria 3282
148 Ga0207684_10005819 3300025910 Bacteria 11299
149 Ga0207684_10078999 3300025910 Unclassified 2799
150 Ga0207654_10005341 3300025911 Bacteria 6490
151 Ga0207707_10032101 3300025912 Bacteria 4597
152 Ga0207695_10015350 3300025913 Bacteria 9019
153 Ga0207695_10088024 3300025913 Bacteria 3127
154 Ga0207695_10114162 3300025913 Bacteria 2677
155 Ga0207671_10077896 3300025914 Bacteria 2482
156 Ga0207671_10203683 3300025914 Bacteria 1546
157 Ga0207693_10000058 3300025915 Bacteria 94726
158 Ga0207693_10002771 3300025915 Bacteria 15175
159 Ga0207693_10006796 3300025915 Bacteria 9447
160 Ga0207693_10016484 3300025915 Bacteria 5904
161 Ga0207693_10026215 3300025915 Unclassified 4614
162 Ga0207663_10019893 3300025916 Bacteria 3792
163 Ga0207663_10036904 3300025916 Bacteria 2942
164 Ga0207649_10092785 3300025920 Unclassified 1980
165 Ga0207646_10024547 3300025922 Bacteria 5523
166 Ga0207646_10058349 3300025922 Unclassified 3447
167 Ga0207646_10091259 3300025922 Bacteria 2727
168 Ga0207694_10079239 3300025924 Bacteria 2576
169 Ga0207650_10002085 3300025925 Bacteria 13982
170 Ga0207687_10003486 3300025927 Bacteria 10587
171 Ga0207700_10006651 3300025928 Bacteria 7009
172 Ga0207700_10013903 3300025928 Bacteria 5258
173 Ga0207700_10017794 3300025928 Bacteria 4755
174 Ga0207700_10023668 3300025928 Bacteria 4241
175 Ga0207700_10093467 3300025928 Bacteria 2380
176 Ga0207700_10298699 3300025928 Bacteria 1390
177 Ga0207664_10000503 3300025929 Bacteria 27867
178 Ga0207664_10037927 3300025929 Bacteria 3734
179 Ga0207706_10087544 3300025933 Bacteria 2739
180 Ga0207665_10028031 3300025939 Bacteria 3720
181 Ga0207661_10019460 3300025944 Bacteria 5062
182 Ga0207679_10002647 3300025945 Bacteria 11050
183 Ga0207667_10046027 3300025949 Bacteria 4619
184 Ga0207667_10191352 3300025949 Bacteria 2099
185 Ga0207668_10090549 3300025972 Archaea 2246
186 Ga0207640_10001227 3300025981 Bacteria 13967
187 Ga0207640_10036952 3300025981 Bacteria 3069
188 Ga0207703_10006457 3300026035 Bacteria 9367
189 Ga0207702_10002423 3300026078 Bacteria 17733
190 Ga0207702_10040176 3300026078 Bacteria 3922
191 Ga0207702_10100660 3300026078 Bacteria 2550
192 Ga0207702_10496149 3300026078 Bacteria 1190
193 Ga0207641_10109247 3300026088 Bacteria 2449
194 Ga0207648_10034926 3300026089 Bacteria 4432
195 Ga0207676_10017762 3300026095 Bacteria 5161
196 Ga0207674_10005584 3300026116 Bacteria 14907
197 Ga0207675_100024624 3300026118 Bacteria 5596
198 Ga0265356_1000665 3300028017 Bacteria 5967
199 Ga0268265_10054374 3300028380 Bacteria 3037
200 Ga0268264_10008372 3300028381 Bacteria 8598
201 Ga0265338_10009037 3300028800 Bacteria 11984
202 Ga0265762_1000261 3300030760 Bacteria 8744
203 Ga0265762_1009136 3300030760 Unclassified 1767
204 Ga0265760_10000317 3300031090 Bacteria 13372
205 Ga0265760_10007571 3300031090 Unclassified 3102
206 Ga0265339_10021479 3300031249 Unclassified 3755
207 Ga0265316_10004328 3300031344 Bacteria 14158
208 Ga0265316_10008701 3300031344 Bacteria 9393
209 Ga0265316_10016904 3300031344 Bacteria 6316
210 Ga0316579_10005196 3300031691 Bacteria 5238
211 Ga0265314_10000509 3300031711 Bacteria 50279
212 Ga0373934_0002455 3300035086 Bacteria 6818
213 Ga0373934_0025632 3300035086 Bacteria 2285
214 Ga0373923_0010986 3300035111 Bacteria 3310
215 Ga0373923_0066211 3300035111 Bacteria 1544
216 Ga0373936_0002215 3300035113 Bacteria 7252
217 Ga0373941_0051921 3300035115 Bacteria 1306
218 Ga0373945_0007873 3300035116 Bacteria 3457
219 Ga0373945_0042814 3300035116 Unclassified 1642
220 Ga0373953_0007744 3300035117 Bacteria 3614
221 Ga0373954_0030887 3300035118 Bacteria 2471
222 Ga0373956_0055850 3300035119 Unclassified 1781
223 Ga0373943_0014979 3300035170 Unclassified 3520
224 Ga0373946_0038092 3300035171 Bacteria 1957
225 Ga0373924_0040798 3300035410 Bacteria 1901
226 Ga0373935_0006733 3300035692 Bacteria 6865
227 Ga0373935_0036465 3300035692 Bacteria 3074
228 Ga0373927_0000321 3300035695 Bacteria 37654
229 Ga0373927_0013691 3300035695 Bacteria 5386
230 Ga0373933_0000438 3300035724 Bacteria 26060
231 Ga0373947_0000988 3300035725 Bacteria 17367
232 Ga0373947_0006829 3300035725 Bacteria 6617
233 Ga0373947_0062507 3300035725 Unclassified 2266
234 Ga0373937_0000322 3300036401 Bacteria 45481
235 Ga0373937_0003493 3300036401 Bacteria 13219
236 Ga0373937_0043729 3300036401 Bacteria 4091
237 Ga0373937_0143515 3300036401 Unclassified 2234
238 Ga0316582_0025438 3300036647 Bacteria 3555
239 Ga0373925_0000935 3300037068 Bacteria 26619
240 Ga0373925_0001722 3300037068 Bacteria 18395
241 Ga0373925_0011061 3300037068 Bacteria 6553
242 Ga0373925_0047713 3300037068 Bacteria 3189
243 Ga0373925_0048836 3300037068 Bacteria 3154
244 Ga0451576_0084908 3300045051 Unclassified 3293
245 Ga0466967_0031684 3300045976 Unclassified 4454
246 Ga0466967_0125264 3300045976 Unclassified 2379
247 Ga0466967_0145348 3300045976 Bacteria 2212
248 Ga0495592_0178297 3300046454 Unclassified 1449
249 Ga0495651_0022050 3300046462 Bacteria 4953
250 Ga0495651_0056323 3300046462 Bacteria 3021
251 Ga0495653_0032803 3300046463 Bacteria 4120
252 Ga0495653_0096771 3300046463 Bacteria 2146
253 Ga0495580_0000767 3300046472 Bacteria 27623
254 Ga0495580_0001097 3300046472 Bacteria 23738
255 Ga0495580_0012264 3300046472 Bacteria 6580
256 Ga0495580_0033804 3300046472 Unclassified 3682
257 Ga0495580_0121607 3300046472 Unclassified 1812
258 Ga0495580_0155029 3300046472 Unclassified 1586
259 Ga0495582_0000452 3300046473 Bacteria 22463
260 Ga0495582_0043452 3300046473 Bacteria 2475
261 Ga0495639_0017187 3300046475 Bacteria 3142
262 Ga0495608_0012792 3300046511 Bacteria 5824
263 Ga0495628_0267058 3300046516 Bacteria 1274
264 Ga0495630_0038556 3300046517 Unclassified 3574
265 Ga0495630_0168087 3300046517 Bacteria 1670
266 Ga0495666_0023102 3300046526 Unclassified 3076
267 Ga0495652_0176149 3300046529 Bacteria 1646
268 Ga0495665_0000411 3300046531 Bacteria 21896
269 Ga0495665_0051785 3300046531 Bacteria 2174
270 Ga0495587_0003365 3300046536 Bacteria 10662
271 Ga0495667_0082089 3300046559 Bacteria 2095
272 Ga0495657_0021762 3300046675 Unclassified 4600
273 Ga0495599_0161504 3300046678 Bacteria 1385
274 Ga0495623_0005021 3300046679 Bacteria 8677
275 Ga0495604_0000783 3300047317 Bacteria 26772
276 Ga0495674_0007387 3300047319 Bacteria 10507
277 Ga0495684_0130060 3300047471 Bacteria 1891
278 Ga0495602_0011230 3300048088 Bacteria 9262
279 Ga0496104_0156090 3300048907 Bacteria 2190
280 Ga0496109_0337901 3300048912 Unclassified 1422
281 Ga0496112_0270050 3300048915 Bacteria 1649
282 Ga0501067_0019959 3300049583 Unclassified 3708
283 Ga0501073_0004980 3300049589 Bacteria 9971
284 Ga0501073_0005029 3300049589 Bacteria 9915
285 Ga0501080_0093483 3300049742 Bacteria 2792
286 Ga0501080_0122987 3300049742 Unclassified 2404
287 nmdc:mga06r32_43259_c1 3300050510 Bacteria 4285
288 nmdc:mga0n895_118953_c1 3300050512 Bacteria 2663
289 nmdc:mga0n895_17211_c1 3300050512 Bacteria 6660
290 nmdc:mga0rr50_10377_c1 3300050513 Bacteria 5907
291 nmdc:mga0rr50_6355_c1 3300050513 Bacteria 7183
292 nmdc:mga0rr50_85156_c1 3300050513 Bacteria 2449
293 nmdc:mga08x19_1229_c1 3300050514 Bacteria 15884
294 nmdc:mga0a205_4593_c1 3300050515 Bacteria 12380
295 Ga0495655_0000173 3300053083 Bacteria 12206
296 Ga0070709_10034889
297 Ga0070683_100044213
298 Ga0070670_100003088
299 Ga0070661_100006537
300 Ga0070669_100021576
301 Ga0070675_100147272
302 Ga0070709_10001608
303 Ga0070709_10029756
304 Ga0070709_10029839
305 Ga0070709_10117029
306 Ga0070714_100000197
307 Ga0070714_100001161
308 Ga0070714_100027260
309 Ga0070714_100093462
310 Ga0070714_100174247
311 Ga0070713_100009362
312 Ga0070713_100011125
313 Ga0070713_100014689
314 Ga0070713_100016822
315 Ga0070713_100024587
316 Ga0070713_100033528
317 Ga0070713_100084561
318 Ga0070713_100217103
319 Ga0070710_10004819
320 Ga0070711_100002773
321 Ga0070711_100013879
322 Ga0070711_100054751
323 Ga0070708_100006586
324 Ga0070708_100012107
325 Ga0070708_100033043
326 Ga0070708_100149823
327 Ga0070662_100060745
328 Ga0070681_10004267
329 Ga0068867_100008902
330 Ga0070706_100037914
331 Ga0070706_100166470
332 Ga0070707_100009770
333 Ga0070707_100041563
334 Ga0070707_100128213
335 Ga0070698_100044803
336 Ga0070699_100004413
337 Ga0070699_100044797
338 Ga0070699_100140098
339 Ga0070679_100028830
340 Ga0070697_100000065
341 Ga0070697_100004593
342 Ga0070697_100030759
343 Ga0070697_100118818
344 Ga0070693_100065322
345 Ga0070665_100171716
346 Ga0070704_100030838
347 Ga0068855_100047792
348 Ga0068855_100379486
349 Ga0070664_100002323
350 Ga0068857_100001429
351 Ga0068854_100010109
352 Ga0068854_100011270
353 Ga0068856_100000483
354 Ga0068856_100023965
355 Ga0068856_100024062
356 Ga0068856_100075142
357 Ga0068859_100000034
358 Ga0068859_100000914
359 Ga0068859_100189508
360 Ga0068864_100000899
361 Ga0068866_10075152
362 Ga0068861_100061457
363 Ga0068863_100043423
364 Ga0068858_100004479
365 Ga0068860_100009124
366 Ga0068862_100057618
367 Ga0070717_10000096
368 Ga0070717_10000383
369 Ga0070717_10001849
370 Ga0070717_10007926
371 Ga0070717_10009197
372 Ga0070717_10009560
373 Ga0070717_10013081
374 Ga0070717_10032896
375 Ga0070717_10099299
376 Ga0070717_10103896
377 Ga0070717_10196376
378 Ga0070715_10020454
379 Ga0070715_10029896
380 Ga0070712_100000038
381 Ga0070712_100002448
382 Ga0070712_100004341
383 Ga0070712_100010326
384 Ga0070712_100053305
385 Ga0070712_100095633
386 Ga0097621_100031900
387 Ga0097621_100051339
388 Ga0097621_100060060
389 Ga0068871_100013975
390 Ga0068871_100020025
391 Ga0068871_100034750
392 Ga0075431_100126198
393 Ga0075431_100252423
394 Ga0075433_10100154
395 Ga0075434_100020896
396 Ga0075434_100090720
397 Ga0075436_100001622
398 Ga0075436_100010375
399 Ga0097620_100000034
400 Ga0097620_100000914
401 Ga0097620_100189500
402 Ga0075435_100010100
403 Ga0075435_100017812
404 Ga0075435_100034503
405 Ga0105240_10009817
406 Ga0105240_10057634
407 Ga0105240_10135613
408 Ga0105240_10329030
409 Ga0105245_10002074
410 Ga0105245_10070436
411 Ga0105241_10004752
412 Ga0105241_10058113
413 Ga0105241_10087098
414 Ga0105248_10296119
415 Ga0105237_10034557
416 Ga0105238_10027763
417 Ga0105249_10293499
418 Ga0105239_10113555
419 Ga0157373_10002900
420 Ga0157373_10014603
421 Ga0157373_10028119
422 Ga0157370_10064591
423 Ga0157369_10010221
424 Ga0157369_10066744
425 Ga0157369_10173338
426 Ga0157374_10000305
427 Ga0157378_10000265
428 Ga0163162_10064329
429 Ga0157372_10001033
430 Ga0157372_10001204
431 Ga0157372_10008399
432 Ga0157372_10011359
433 Ga0157372_10081915
434 Ga0163163_10247487
435 Ga0224569_100077
436 Ga0224571_100213
437 Ga0207692_10001303
438 Ga0207642_10051168
439 Ga0207685_10017088
440 Ga0207699_10001216
441 Ga0207699_10021075
442 Ga0207699_10024841
443 Ga0207684_10005819
444 Ga0207684_10078999
445 Ga0207654_10005341
446 Ga0207707_10032101
447 Ga0207695_10015350
448 Ga0207695_10088024
449 Ga0207695_10114162
450 Ga0207671_10077896
451 Ga0207671_10203683
452 Ga0207693_10000058
453 Ga0207693_10002771
454 Ga0207693_10006796
455 Ga0207693_10016484
456 Ga0207693_10026215
457 Ga0207663_10019893
458 Ga0207663_10036904
459 Ga0207649_10092785
460 Ga0207646_10024547
461 Ga0207646_10058349
462 Ga0207646_10091259
463 Ga0207694_10079239
464 Ga0207650_10002085
465 Ga0207687_10003486
466 Ga0207700_10006651
467 Ga0207700_10013903
468 Ga0207700_10017794
469 Ga0207700_10023668
470 Ga0207700_10093467
471 Ga0207700_10298699
472 Ga0207664_10000503
473 Ga0207664_10037927
474 Ga0207706_10087544
475 Ga0207665_10028031
476 Ga0207661_10019460
477 Ga0207679_10002647
478 Ga0207667_10046027
479 Ga0207667_10191352
480 Ga0207668_10090549
481 Ga0207640_10001227
482 Ga0207640_10036952
483 Ga0207703_10006457
484 Ga0207702_10002423
485 Ga0207702_10040176
486 Ga0207702_10100660
487 Ga0207702_10496149
488 Ga0207641_10109247
489 Ga0207648_10034926
490 Ga0207676_10017762
491 Ga0207674_10005584
492 Ga0207675_100024624
493 Ga0265356_1000665
494 Ga0268265_10054374
495 Ga0268264_10008372
496 Ga0265338_10009037
497 Ga0265762_1000261
498 Ga0265762_1009136
499 Ga0265760_10000317
500 Ga0265760_10007571
501 Ga0265339_10021479
502 Ga0265316_10004328
503 Ga0265316_10008701
504 Ga0265316_10016904
505 Ga0316579_10005196
506 Ga0265314_10000509
507 Ga0373934_0002455
508 Ga0373934_0025632
509 Ga0373923_0010986
510 Ga0373923_0066211
511 Ga0373936_0002215
512 Ga0373941_0051921
513 Ga0373945_0007873
514 Ga0373945_0042814
515 Ga0373953_0007744
516 Ga0373954_0030887
517 Ga0373956_0055850
518 Ga0373943_0014979
519 Ga0373946_0038092
520 Ga0373924_0040798
521 Ga0373935_0006733
522 Ga0373935_0036465
523 Ga0373927_0000321
524 Ga0373927_0013691
525 Ga0373933_0000438
526 Ga0373947_0000988
527 Ga0373947_0006829
528 Ga0373947_0062507
529 Ga0373937_0000322
530 Ga0373937_0003493
531 Ga0373937_0043729
532 Ga0373937_0143515
533 Ga0316582_0025438
534 Ga0373925_0000935
535 Ga0373925_0001722
536 Ga0373925_0011061
537 Ga0373925_0047713
538 Ga0373925_0048836
539 Ga0451576_0084908
540 Ga0466967_0031684
541 Ga0466967_0125264
542 Ga0466967_0145348
543 Ga0495592_0178297
544 Ga0495651_0022050
545 Ga0495651_0056323
546 Ga0495653_0032803
547 Ga0495653_0096771
548 Ga0495580_0000767
549 Ga0495580_0001097
550 Ga0495580_0012264
551 Ga0495580_0033804
552 Ga0495580_0121607
553 Ga0495580_0155029
554 Ga0495582_0000452
555 Ga0495582_0043452
556 Ga0495639_0017187
557 Ga0495608_0012792
558 Ga0495628_0267058
559 Ga0495630_0038556
560 Ga0495630_0168087
561 Ga0495666_0023102
562 Ga0495652_0176149
563 Ga0495665_0000411
564 Ga0495665_0051785
565 Ga0495587_0003365
566 Ga0495667_0082089
567 Ga0495657_0021762
568 Ga0495599_0161504
569 Ga0495623_0005021
570 Ga0495604_0000783
571 Ga0495674_0007387
572 Ga0495684_0130060
573 Ga0495602_0011230
574 Ga0496104_0156090
575 Ga0496109_0337901
576 Ga0496112_0270050
577 Ga0501067_0019959
578 Ga0501073_0004980
579 Ga0501073_0005029
580 Ga0501080_0093483
581 Ga0501080_0122987
582 nmdc:mga06r32_43259_c1
583 nmdc:mga0n895_118953_c1
584 nmdc:mga0n895_17211_c1
585 nmdc:mga0rr50_10377_c1
586 nmdc:mga0rr50_6355_c1
587 nmdc:mga0rr50_85156_c1
588 nmdc:mga08x19_1229_c1
589 nmdc:mga0a205_4593_c1
590 Ga0495655_0000173

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04055

Radical_SAM

Radical SAM superfamily

38

199

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fsi-assembly1.cif.gz_A the structure of a crystallizable variant of e. coli pyruvate formate-lyase activating enzyme bound to sam 0.7937 36 201
7jma-assembly1.cif.gz_A crystal structure of the apo form of nitrogenase iron-molybdenum cofactor biosynthesis enzyme nifb from methanothermobacter thermautotrophicus 0.7766 27 206
5tgs-assembly1.cif.gz_A crystal structure of quee from bacillus subtilis with methionine bound 0.7447 36 201
6b4c-assembly5.cif.gz_E structure of viperin from trichoderma virens 0.7319 23 305
6b4c-assembly3.cif.gz_C structure of viperin from trichoderma virens 0.7202 23 305
ID Description Score Start End Superfamily
af_O33183_77_264_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8234 26 201 3.20.20.70
af_Q59026_29_239_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8121 30 205 3.20.20.70
af_Q57567_110_367_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.783 29 205 3.20.20.70
af_O69696_93_337_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7714 31 228 3.20.20.70
af_O33183_77_264_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7643 26 201 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A1Q7RLY8-F1-model_v4 Radical SAM core domain-containing protein 0.9599 1 221 GO:0003824
GO:0006783
GO:0046872
GO:0051536
AF-A0A7X7XG92-F1-model_v4 Radical SAM protein 0.9504 98 356
AF-A0A7C5WBC6-F1-model_v4 Radical SAM protein 0.9484 3 359 GO:0003824
GO:0046872
GO:0051539
AF-A0A3C0MY29-F1-model_v4 Radical SAM core domain-containing protein 0.9467 3 354 GO:0003824
GO:0046872
GO:0051539
AF-A0A1Q7RLY8-F1-model_v4 Radical SAM core domain-containing protein 0.9428 1 221 GO:0003824
GO:0006783
GO:0046872
GO:0051536

Map