F392394

General Info

Members Datasets Scaffolds Average Seq Length
294 171 588 506

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2873314349|2873320023
Length 552
Sequence EAEMVPGRRREVMVVLPGLMLAIMLAMLDNMIVGTAMPRIVGELGGLAHLSWVVTAYVLGTTVSTPIWGKIGDLYGRKTIFLASIAIFMIGSALCGMAGSELLGGTDGGMGELIGFRAIQGLGAGGLMVNAMAIIGDLVPPRERGRYQGIMAAIMSLAMVAGPLVGGFITDNLDWRWAFYVNLPIGAVAFVWLLLRLHLPKYRTEHRIDWWGAGLLAVGITALVLITTWGGTEYDWTSWQILGLAAVAVVTLAIFIPVQRRVAEPIMPLHVFRDRNFTLVSLIGFLLGFAMFGAINFLPLFQQTVQGASATNSGLLLLPMMAAMMVVSLFVGQAITKTGKYKIWPIAGGVFMAIAMWLLSLQDVNTTTWQTGVFIAVLGLGMGGLMQTTMLIAQNSVEQKDLGVASSASTFFRSIGGSFGVSVFGAVFNHHLSANLTDRLGPQAAAMAEGGGGGRLDPTALAALPAPVREGFLTSLADSISSVFLWAIFFAVLVPLLAAFIKEIPLRSGPGTPAASSGGDGDGDGKARDAADGAETPKDGAVKDAAPVAAFD

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
3 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
4 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
25 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
26 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
41 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
60 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
61 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
62 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
63 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
64 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
65 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
66 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
67 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
68 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
69 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
70 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
71 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
72 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
73 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
74 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
75 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
76 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
77 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
78 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
79 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
80 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
81 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
82 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
84 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
85 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
86 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
87 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
88 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
89 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
90 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
91 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
92 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
93 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
94 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
95 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
96 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
97 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
98 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
99 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
100 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
101 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
102 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
103 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
104 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
105 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
106 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
107 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
108 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
109 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
110 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
111 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
112 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
113 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
114 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
115 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
116 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
117 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
118 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
119 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
120 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
121 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
122 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
123 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
124 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
125 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
126 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
127 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
128 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
129 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
130 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
131 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
132 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
133 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
134 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
135 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
136 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
137 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
138 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
139 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
140 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
141 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
142 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
143 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
144 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
145 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
146 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
147 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
148 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
149 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
150 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
151 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
152 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
153 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
154 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
155 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
156 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
157 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
158 2862574272 Streptomyces sp. AcE210 Isolate Nodule
159 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
160 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
161 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
162 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
163 2891562705 Microbispora tritici MT50 Isolate Unclassified
164 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
165 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
166 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
167 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
168 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
169 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
170 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
171 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.52
Metatranscriptomes 0.34
Isolates 7.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.72
Nodule 0.34
Rhizoplane 4.42
Rhizosphere 88.1
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100075515 3300005329 Bacteria 3149
2 Ga0070660_100059483 3300005339 Bacteria 2963
3 Ga0070661_100067365 3300005344 Bacteria 2631
4 Ga0070692_10016348 3300005345 Bacteria 3528
5 Ga0070709_10010921 3300005434 Bacteria 5043
6 Ga0070714_100001302 3300005435 Bacteria 18048
7 Ga0070714_100006309 3300005435 Bacteria 9138
8 Ga0070713_100026101 3300005436 Bacteria 4581
9 Ga0070713_100031044 3300005436 Bacteria 4251
10 Ga0070713_100138935 3300005436 Bacteria 2150
11 Ga0070713_100211124 3300005436 Bacteria 1757
12 Ga0070710_10000614 3300005437 Bacteria 16958
13 Ga0070710_10013010 3300005437 Bacteria 4150
14 Ga0070710_10076709 3300005437 Bacteria 1940
15 Ga0070711_100002744 3300005439 Bacteria 10090
16 Ga0070711_100034872 3300005439 Bacteria 3359
17 Ga0070711_100105734 3300005439 Bacteria 2056
18 Ga0070708_100005169 3300005445 Bacteria 10332
19 Ga0070706_100003619 3300005467 Bacteria 15138
20 Ga0070706_100007232 3300005467 Bacteria 10431
21 Ga0070706_100075184 3300005467 Bacteria 3126
22 Ga0070707_100038519 3300005468 Bacteria 4566
23 Ga0070698_100000892 3300005471 Bacteria 32792
24 Ga0070698_100005874 3300005471 Bacteria 13412
25 Ga0070698_100016225 3300005471 Bacteria 7863
26 Ga0070698_100027363 3300005471 Bacteria 5931
27 Ga0070699_100037582 3300005518 Bacteria 4192
28 Ga0070679_100131107 3300005530 Bacteria 2488
29 Ga0068857_100048345 3300005577 Bacteria 3777
30 Ga0068856_100046838 3300005614 Bacteria 4259
31 Ga0068856_100061868 3300005614 Bacteria 3698
32 Ga0068864_100003965 3300005618 Bacteria 12187
33 Ga0068863_100046084 3300005841 Bacteria 4138
34 Ga0068858_100063547 3300005842 Bacteria 3416
35 Ga0081455_10086852 3300005937 Bacteria 2547
36 Ga0081540_1000352 3300005983 Bacteria 46545
37 Ga0081540_1001572 3300005983 Bacteria 19511
38 Ga0070717_10001363 3300006028 Bacteria 16812
39 Ga0070717_10012063 3300006028 Bacteria 6583
40 Ga0070717_10079048 3300006028 Bacteria 2757
41 Ga0070717_10135629 3300006028 Bacteria 2119
42 Ga0070717_10138801 3300006028 Bacteria 2095
43 Ga0070717_10177448 3300006028 Bacteria 1855
44 Ga0070717_10223067 3300006028 Bacteria 1657
45 Ga0075363_100022187 3300006048 Bacteria 3207
46 Ga0070715_10032721 3300006163 Bacteria 2120
47 Ga0070715_10043051 3300006163 Bacteria 1901
48 Ga0070716_100001326 3300006173 Bacteria 10947
49 Ga0070716_100007502 3300006173 Bacteria 5375
50 Ga0070716_100010057 3300006173 Bacteria 4733
51 Ga0070716_100037340 3300006173 Bacteria 2684
52 Ga0070712_100007576 3300006175 Bacteria 6785
53 Ga0070712_100153902 3300006175 Bacteria 1768
54 Ga0075428_100014335 3300006844 Bacteria 8812
55 Ga0075428_100144384 3300006844 Bacteria 2587
56 Ga0075428_100250678 3300006844 Bacteria 1908
57 Ga0075431_100004725 3300006847 Bacteria 13384
58 Ga0075433_10133932 3300006852 Bacteria 2202
59 Ga0075434_100024783 3300006871 Bacteria 5865
60 Ga0075434_100052785 3300006871 Bacteria 4040
61 Ga0075436_100029814 3300006914 Bacteria 3752
62 Ga0075435_100019724 3300007076 Bacteria 5155
63 Ga0114129_10000010 3300009147 Bacteria 147651
64 Ga0114129_10010128 3300009147 Bacteria 13438
65 Ga0105248_10017902 3300009177 Bacteria 7818
66 Ga0157369_10113239 3300013105 Bacteria 2882
67 Ga0163163_10003868 3300014325 Bacteria 12755
68 Ga0157379_10077686 3300014968 Bacteria 2972
69 Ga0224712_10012996 3300022467 Bacteria 2638
70 Ga0207426_1002127 3300025302 Bacteria 13553
71 Ga0207426_1007178 3300025302 Bacteria 4702
72 Ga0207692_10000145 3300025898 Bacteria 22081
73 Ga0207692_10002703 3300025898 Bacteria 6830
74 Ga0207692_10002912 3300025898 Bacteria 6622
75 Ga0207692_10004285 3300025898 Bacteria 5643
76 Ga0207685_10000496 3300025905 Bacteria 6686
77 Ga0207685_10025892 3300025905 Bacteria 2032
78 Ga0207699_10003542 3300025906 Bacteria 7449
79 Ga0207699_10020369 3300025906 Bacteria 3553
80 Ga0207699_10071135 3300025906 Bacteria 2126
81 Ga0207684_10000836 3300025910 Bacteria 35502
82 Ga0207684_10003029 3300025910 Bacteria 16650
83 Ga0207684_10012709 3300025910 Bacteria 7309
84 Ga0207707_10064227 3300025912 Bacteria 3195
85 Ga0207693_10001455 3300025915 Bacteria 20958
86 Ga0207693_10061465 3300025915 Bacteria 2942
87 Ga0207693_10106242 3300025915 Bacteria 2202
88 Ga0207663_10000523 3300025916 Bacteria 16877
89 Ga0207663_10029368 3300025916 Bacteria 3229
90 Ga0207657_10095361 3300025919 Bacteria 2475
91 Ga0207652_10104621 3300025921 Bacteria 2504
92 Ga0207646_10005684 3300025922 Bacteria 13080
93 Ga0207700_10002259 3300025928 Bacteria 11061
94 Ga0207700_10005891 3300025928 Bacteria 7369
95 Ga0207700_10008819 3300025928 Bacteria 6266
96 Ga0207700_10017290 3300025928 Bacteria 4814
97 Ga0207700_10045519 3300025928 Bacteria 3238
98 Ga0207700_10112177 3300025928 Bacteria 2196
99 Ga0207700_10135321 3300025928 Bacteria 2018
100 Ga0207664_10000575 3300025929 Bacteria 25779
101 Ga0207664_10004158 3300025929 Bacteria 9771
102 Ga0207664_10013844 3300025929 Bacteria 5807
103 Ga0207664_10060927 3300025929 Bacteria 3009
104 Ga0207664_10127850 3300025929 Bacteria 2135
105 Ga0207665_10000332 3300025939 Bacteria 32557
106 Ga0207665_10002163 3300025939 Bacteria 13285
107 Ga0207665_10029740 3300025939 Bacteria 3610
108 Ga0207665_10079643 3300025939 Bacteria 2252
109 Ga0207665_10081609 3300025939 Bacteria 2227
110 Ga0207711_10107365 3300025941 Bacteria 2479
111 Ga0207661_10063837 3300025944 Bacteria 2983
112 Ga0207702_10069989 3300026078 Bacteria 3017
113 Ga0207702_10152679 3300026078 Bacteria 2102
114 Ga0207676_10058738 3300026095 Bacteria 3035
115 Ga0207674_10077389 3300026116 Bacteria 3332
116 Ga0207674_10145332 3300026116 Bacteria 2330
117 Ga0207428_10110105 3300027907 Bacteria 2121
118 Ga0265338_10000577 3300028800 Bacteria 64591
119 Ga0307514_10002213 3300031649 Bacteria 20767
120 Ga0307405_10003261 3300031731 Bacteria 7405
121 Ga0307410_10003281 3300031852 Bacteria 8083
122 Ga0307410_10084971 3300031852 Bacteria 2232
123 Ga0307406_10006317 3300031901 Bacteria 6535
124 Ga0307412_10036028 3300031911 Bacteria 3166
125 Ga0307409_100000053 3300031995 Bacteria 41097
126 Ga0307409_100039009 3300031995 Bacteria 3520
127 Ga0307415_100000016 3300032126 Bacteria 78647
128 Ga0373934_0000802 3300035086 Bacteria 11310
129 Ga0373940_0012333 3300035088 Bacteria 2047
130 Ga0373923_0025956 3300035111 Bacteria 2327
131 Ga0373923_0039108 3300035111 Bacteria 1946
132 Ga0373936_0000767 3300035113 Bacteria 11287
133 Ga0373936_0013869 3300035113 Bacteria 3077
134 Ga0373953_0000101 3300035117 Bacteria 20545
135 Ga0373954_0002313 3300035118 Bacteria 7944
136 Ga0373956_0000197 3300035119 Bacteria 23300
137 Ga0373946_0039132 3300035171 Bacteria 1935
138 Ga0373955_0000009 3300035172 Bacteria 81129
139 Ga0373955_0012827 3300035172 Bacteria 4039
140 Ga0373924_0001961 3300035410 Bacteria 6844
141 Ga0373924_0022477 3300035410 Bacteria 2466
142 Ga0373931_0077823 3300035691 Bacteria 1823
143 Ga0373935_0078266 3300035692 Bacteria 2144
144 Ga0373933_0000006 3300035724 Bacteria 125141
145 Ga0373947_0049724 3300035725 Bacteria 2518
146 Ga0373937_0000137 3300036401 Bacteria 70670
147 Ga0373937_0013261 3300036401 Bacteria 7259
148 Ga0373937_0021520 3300036401 Bacteria 5788
149 Ga0373937_0054334 3300036401 Bacteria 3675
150 Ga0373937_0055633 3300036401 Bacteria 3632
151 Ga0373937_0227422 3300036401 Bacteria 1756
152 Ga0373925_0052467 3300037068 Bacteria 3046
153 Ga0373925_0082141 3300037068 Bacteria 2451
154 Ga0395898_0135077 3300037466 Bacteria 2362
155 Ga0439448_0011422 3300042005 Bacteria 2646
156 Ga0466970_0002066 3300044765 Bacteria 9710
157 Ga0495592_0000426 3300046454 Bacteria 31916
158 Ga0495592_0033525 3300046454 Bacteria 3872
159 Ga0495629_0001026 3300046459 Bacteria 22402
160 Ga0495641_0008067 3300046461 Bacteria 6476
161 Ga0495651_0000082 3300046462 Bacteria 69575
162 Ga0495651_0002265 3300046462 Bacteria 14853
163 Ga0495651_0007124 3300046462 Bacteria 8551
164 Ga0495651_0103241 3300046462 Bacteria 2118
165 Ga0495653_0000343 3300046463 Bacteria 37889
166 Ga0495653_0002889 3300046463 Bacteria 13739
167 Ga0495653_0018357 3300046463 Bacteria 5681
168 Ga0495653_0096623 3300046463 Bacteria 2147
169 Ga0495580_0031564 3300046472 Bacteria 3827
170 Ga0495582_0008044 3300046473 Bacteria 5819
171 Ga0495582_0014617 3300046473 Bacteria 4312
172 Ga0495662_0001299 3300046476 Bacteria 12346
173 Ga0495662_0017108 3300046476 Bacteria 3510
174 Ga0495664_0002454 3300046477 Bacteria 9977
175 Ga0495664_0105862 3300046477 Bacteria 1696
176 Ga0495606_0000949 3300046507 Bacteria 42671
177 Ga0495608_0000328 3300046511 Bacteria 33529
178 Ga0495608_0004254 3300046511 Bacteria 10256
179 Ga0495628_0000136 3300046516 Bacteria 62431
180 Ga0495628_0029559 3300046516 Bacteria 4441
181 Ga0495628_0037850 3300046516 Bacteria 3865
182 Ga0495666_0002828 3300046526 Bacteria 8689
183 Ga0495652_0000273 3300046529 Bacteria 61215
184 Ga0495652_0000606 3300046529 Bacteria 42033
185 Ga0495665_0001867 3300046531 Bacteria 11388
186 Ga0495665_0029927 3300046531 Bacteria 2915
187 Ga0495640_0060882 3300046533 Bacteria 2566
188 Ga0495587_0000070 3300046536 Bacteria 85402
189 Ga0495587_0000975 3300046536 Bacteria 18752
190 Ga0495587_0018570 3300046536 Bacteria 4312
191 Ga0495587_0030730 3300046536 Bacteria 3257
192 Ga0495587_0058808 3300046536 Bacteria 2257
193 Ga0495645_0018375 3300046543 Bacteria 5019
194 Ga0495645_0088258 3300046543 Bacteria 2218
195 Ga0495667_0000048 3300046559 Bacteria 117509
196 Ga0495667_0000183 3300046559 Bacteria 42442
197 Ga0495667_0002344 3300046559 Bacteria 12663
198 Ga0495667_0024454 3300046559 Bacteria 4067
199 Ga0495668_0000275 3300046616 Bacteria 72330
200 Ga0495634_0092065 3300046642 Bacteria 1967
201 Ga0495634_0104791 3300046642 Bacteria 1824
202 Ga0495625_0000978 3300046660 Bacteria 37965
203 Ga0495635_0008014 3300046663 Bacteria 7380
204 Ga0495635_0045126 3300046663 Bacteria 3040
205 Ga0495635_0130697 3300046663 Bacteria 1711
206 Ga0495657_0000046 3300046675 Bacteria 106064
207 Ga0495657_0001619 3300046675 Bacteria 19320
208 Ga0495657_0015102 3300046675 Bacteria 5659
209 Ga0495599_0000023 3300046678 Bacteria 125139
210 Ga0495623_0000306 3300046679 Bacteria 31838
211 Ga0495623_0029447 3300046679 Bacteria 3533
212 Ga0495623_0061345 3300046679 Bacteria 2359
213 Ga0495646_0011265 3300046680 Bacteria 5679
214 Ga0495646_0018216 3300046680 Bacteria 4447
215 Ga0495658_0012688 3300046683 Bacteria 4274
216 Ga0495658_0062775 3300046683 Bacteria 2136
217 Ga0495613_0027069 3300046689 Bacteria 4267
218 Ga0495624_0003586 3300046690 Bacteria 11491
219 Ga0495624_0034119 3300046690 Bacteria 3293
220 Ga0495600_0000411 3300046809 Bacteria 22127
221 Ga0495600_0010941 3300046809 Bacteria 5643
222 Ga0495581_0015984 3300047315 Bacteria 4361
223 Ga0495581_0035251 3300047315 Bacteria 2895
224 Ga0495604_0000037 3300047317 Bacteria 125140
225 Ga0495674_0020372 3300047319 Bacteria 6141
226 Ga0495674_0135600 3300047319 Bacteria 2071
227 Ga0495674_0194059 3300047319 Bacteria 1687
228 Ga0495680_0000240 3300047322 Bacteria 60299
229 Ga0495680_0037225 3300047322 Bacteria 3898
230 Ga0495680_0066779 3300047322 Bacteria 2751
231 Ga0495675_0033392 3300047444 Bacteria 3285
232 Ga0495684_0007054 3300047471 Bacteria 8725
233 Ga0495684_0034974 3300047471 Bacteria 3854
234 Ga0495593_0046726 3300047673 Bacteria 2306
235 Ga0495602_0000127 3300048088 Bacteria 71692
236 Ga0495602_0004277 3300048088 Bacteria 14868
237 Ga0495614_0007560 3300048089 Bacteria 4836
238 Ga0495626_0000147 3300048091 Bacteria 87994
239 Ga0496101_0099974 3300048904 Bacteria 2169
240 Ga0496104_0000353 3300048907 Bacteria 41013
241 Ga0496105_0016337 3300048908 Bacteria 5924
242 Ga0496105_0024294 3300048908 Bacteria 4924
243 Ga0496105_0157727 3300048908 Bacteria 1863
244 Ga0496108_0003330 3300048911 Bacteria 12912
245 Ga0496108_0020947 3300048911 Bacteria 5376
246 Ga0496109_0003141 3300048912 Bacteria 13782
247 Ga0496111_0005828 3300048914 Bacteria 7946
248 Ga0496113_0002624 3300048916 Bacteria 10523
249 Ga0496113_0007976 3300048916 Bacteria 6861
250 Ga0496114_0081816 3300048917 Bacteria 2728
251 Ga0496115_0109273 3300048918 Bacteria 2270
252 nmdc:mga03n38_128497_c1 3300050490 Bacteria 1253
253 nmdc:mga03n38_86325_c1 3300050490 Bacteria 1485
254 nmdc:mga05p37_3915_c1 3300050507 Bacteria 17433
255 nmdc:mga05p37_9847_c1 3300050507 Bacteria 11345
256 nmdc:mga0qj67_33230_c1 3300050509 Bacteria 4025
257 nmdc:mga0qj67_43421_c1 3300050509 Bacteria 3540
258 nmdc:mga06r32_6865_c1 3300050510 Bacteria 10231
259 nmdc:mga0n895_12598_c1 3300050512 Bacteria 7590
260 nmdc:mga0n895_3601_c1 3300050512 Bacteria 12521
261 nmdc:mga0rr50_15899_c1 3300050513 Bacteria 4980
262 nmdc:mga0rr50_8280_c1 3300050513 Bacteria 6466
263 nmdc:mga0a205_85243_c1 3300050515 Bacteria 3051
264 Ga0495612_0004843 3300053078 Bacteria 5574
265 Ga0495595_0002198 3300053084 Bacteria 7581
266 Ga0495595_0020202 3300053084 Bacteria 2897
267 Ga0495619_0006801 3300053085 Bacteria 7230
268 Ga0495619_0044571 3300053085 Bacteria 2912
269 Ga0495619_0060171 3300053085 Bacteria 2524
270 Ga0500646_0000237 3300053090 Bacteria 16818
271 Ga0500588_0011284 3300053146 Bacteria 2183
272 Ga0500616_0003968 3300053153 Bacteria 10831
273 Ga0530510_0019948 3300061734 Bacteria 4764
274 2873320023 2873314349 Bacteria 8512634
275 2786671672 2786546132 Bacteria 10419719
276 2795786068 2795385470 Bacteria 8317180
277 2811842787 2808606982 Bacteria 7791042
278 2856747003 2856741275 Bacteria 8096094
279 2861527405 2861520306 Bacteria 8348283
280 2862286703 2862281513 Bacteria 9621493
281 2862578410 2862574272 Bacteria 10567477
282 2884698260 2884693830 Bacteria 11273186
283 2887484836 2887478801 Bacteria 8972725
284 2891403847 2891395885 Bacteria 9251614
285 2891558204 2891554331 Bacteria 8812224
286 2891568784 2891562705 Bacteria 8039471
287 2895436893 2895427314 Bacteria 13147766
288 2895450851 2895442618 Bacteria 11027144
289 2954005906 2954002825 Bacteria 9173742
290 3006498258 3006493962 Bacteria 8825450
291 8001782231 8001781756 Bacteria 9586736
292 8055066046 8055066027 Bacteria 9479577
293 8055175362 8055172936 Bacteria 9305943
294 8057569426 8057568493 Bacteria 7221719
295 Ga0070683_100075515
296 Ga0070660_100059483
297 Ga0070661_100067365
298 Ga0070692_10016348
299 Ga0070709_10010921
300 Ga0070714_100001302
301 Ga0070714_100006309
302 Ga0070713_100026101
303 Ga0070713_100031044
304 Ga0070713_100138935
305 Ga0070713_100211124
306 Ga0070710_10000614
307 Ga0070710_10013010
308 Ga0070710_10076709
309 Ga0070711_100002744
310 Ga0070711_100034872
311 Ga0070711_100105734
312 Ga0070708_100005169
313 Ga0070706_100003619
314 Ga0070706_100007232
315 Ga0070706_100075184
316 Ga0070707_100038519
317 Ga0070698_100000892
318 Ga0070698_100005874
319 Ga0070698_100016225
320 Ga0070698_100027363
321 Ga0070699_100037582
322 Ga0070679_100131107
323 Ga0068857_100048345
324 Ga0068856_100046838
325 Ga0068856_100061868
326 Ga0068864_100003965
327 Ga0068863_100046084
328 Ga0068858_100063547
329 Ga0081455_10086852
330 Ga0081540_1000352
331 Ga0081540_1001572
332 Ga0070717_10001363
333 Ga0070717_10012063
334 Ga0070717_10079048
335 Ga0070717_10135629
336 Ga0070717_10138801
337 Ga0070717_10177448
338 Ga0070717_10223067
339 Ga0075363_100022187
340 Ga0070715_10032721
341 Ga0070715_10043051
342 Ga0070716_100001326
343 Ga0070716_100007502
344 Ga0070716_100010057
345 Ga0070716_100037340
346 Ga0070712_100007576
347 Ga0070712_100153902
348 Ga0075428_100014335
349 Ga0075428_100144384
350 Ga0075428_100250678
351 Ga0075431_100004725
352 Ga0075433_10133932
353 Ga0075434_100024783
354 Ga0075434_100052785
355 Ga0075436_100029814
356 Ga0075435_100019724
357 Ga0114129_10000010
358 Ga0114129_10010128
359 Ga0105248_10017902
360 Ga0157369_10113239
361 Ga0163163_10003868
362 Ga0157379_10077686
363 Ga0224712_10012996
364 Ga0207426_1002127
365 Ga0207426_1007178
366 Ga0207692_10000145
367 Ga0207692_10002703
368 Ga0207692_10002912
369 Ga0207692_10004285
370 Ga0207685_10000496
371 Ga0207685_10025892
372 Ga0207699_10003542
373 Ga0207699_10020369
374 Ga0207699_10071135
375 Ga0207684_10000836
376 Ga0207684_10003029
377 Ga0207684_10012709
378 Ga0207707_10064227
379 Ga0207693_10001455
380 Ga0207693_10061465
381 Ga0207693_10106242
382 Ga0207663_10000523
383 Ga0207663_10029368
384 Ga0207657_10095361
385 Ga0207652_10104621
386 Ga0207646_10005684
387 Ga0207700_10002259
388 Ga0207700_10005891
389 Ga0207700_10008819
390 Ga0207700_10017290
391 Ga0207700_10045519
392 Ga0207700_10112177
393 Ga0207700_10135321
394 Ga0207664_10000575
395 Ga0207664_10004158
396 Ga0207664_10013844
397 Ga0207664_10060927
398 Ga0207664_10127850
399 Ga0207665_10000332
400 Ga0207665_10002163
401 Ga0207665_10029740
402 Ga0207665_10079643
403 Ga0207665_10081609
404 Ga0207711_10107365
405 Ga0207661_10063837
406 Ga0207702_10069989
407 Ga0207702_10152679
408 Ga0207676_10058738
409 Ga0207674_10077389
410 Ga0207674_10145332
411 Ga0207428_10110105
412 Ga0265338_10000577
413 Ga0307514_10002213
414 Ga0307405_10003261
415 Ga0307410_10003281
416 Ga0307410_10084971
417 Ga0307406_10006317
418 Ga0307412_10036028
419 Ga0307409_100000053
420 Ga0307409_100039009
421 Ga0307415_100000016
422 Ga0373934_0000802
423 Ga0373940_0012333
424 Ga0373923_0025956
425 Ga0373923_0039108
426 Ga0373936_0000767
427 Ga0373936_0013869
428 Ga0373953_0000101
429 Ga0373954_0002313
430 Ga0373956_0000197
431 Ga0373946_0039132
432 Ga0373955_0000009
433 Ga0373955_0012827
434 Ga0373924_0001961
435 Ga0373924_0022477
436 Ga0373931_0077823
437 Ga0373935_0078266
438 Ga0373933_0000006
439 Ga0373947_0049724
440 Ga0373937_0000137
441 Ga0373937_0013261
442 Ga0373937_0021520
443 Ga0373937_0054334
444 Ga0373937_0055633
445 Ga0373937_0227422
446 Ga0373925_0052467
447 Ga0373925_0082141
448 Ga0395898_0135077
449 Ga0439448_0011422
450 Ga0466970_0002066
451 Ga0495592_0000426
452 Ga0495592_0033525
453 Ga0495629_0001026
454 Ga0495641_0008067
455 Ga0495651_0000082
456 Ga0495651_0002265
457 Ga0495651_0007124
458 Ga0495651_0103241
459 Ga0495653_0000343
460 Ga0495653_0002889
461 Ga0495653_0018357
462 Ga0495653_0096623
463 Ga0495580_0031564
464 Ga0495582_0008044
465 Ga0495582_0014617
466 Ga0495662_0001299
467 Ga0495662_0017108
468 Ga0495664_0002454
469 Ga0495664_0105862
470 Ga0495606_0000949
471 Ga0495608_0000328
472 Ga0495608_0004254
473 Ga0495628_0000136
474 Ga0495628_0029559
475 Ga0495628_0037850
476 Ga0495666_0002828
477 Ga0495652_0000273
478 Ga0495652_0000606
479 Ga0495665_0001867
480 Ga0495665_0029927
481 Ga0495640_0060882
482 Ga0495587_0000070
483 Ga0495587_0000975
484 Ga0495587_0018570
485 Ga0495587_0030730
486 Ga0495587_0058808
487 Ga0495645_0018375
488 Ga0495645_0088258
489 Ga0495667_0000048
490 Ga0495667_0000183
491 Ga0495667_0002344
492 Ga0495667_0024454
493 Ga0495668_0000275
494 Ga0495634_0092065
495 Ga0495634_0104791
496 Ga0495625_0000978
497 Ga0495635_0008014
498 Ga0495635_0045126
499 Ga0495635_0130697
500 Ga0495657_0000046
501 Ga0495657_0001619
502 Ga0495657_0015102
503 Ga0495599_0000023
504 Ga0495623_0000306
505 Ga0495623_0029447
506 Ga0495623_0061345
507 Ga0495646_0011265
508 Ga0495646_0018216
509 Ga0495658_0012688
510 Ga0495658_0062775
511 Ga0495613_0027069
512 Ga0495624_0003586
513 Ga0495624_0034119
514 Ga0495600_0000411
515 Ga0495600_0010941
516 Ga0495581_0015984
517 Ga0495581_0035251
518 Ga0495604_0000037
519 Ga0495674_0020372
520 Ga0495674_0135600
521 Ga0495674_0194059
522 Ga0495680_0000240
523 Ga0495680_0037225
524 Ga0495680_0066779
525 Ga0495675_0033392
526 Ga0495684_0007054
527 Ga0495684_0034974
528 Ga0495593_0046726
529 Ga0495602_0000127
530 Ga0495602_0004277
531 Ga0495614_0007560
532 Ga0495626_0000147
533 Ga0496101_0099974
534 Ga0496104_0000353
535 Ga0496105_0016337
536 Ga0496105_0024294
537 Ga0496105_0157727
538 Ga0496108_0003330
539 Ga0496108_0020947
540 Ga0496109_0003141
541 Ga0496111_0005828
542 Ga0496113_0002624
543 Ga0496113_0007976
544 Ga0496114_0081816
545 Ga0496115_0109273
546 nmdc:mga03n38_128497_c1
547 nmdc:mga03n38_86325_c1
548 nmdc:mga05p37_3915_c1
549 nmdc:mga05p37_9847_c1
550 nmdc:mga0qj67_33230_c1
551 nmdc:mga0qj67_43421_c1
552 nmdc:mga06r32_6865_c1
553 nmdc:mga0n895_12598_c1
554 nmdc:mga0n895_3601_c1
555 nmdc:mga0rr50_15899_c1
556 nmdc:mga0rr50_8280_c1
557 nmdc:mga0a205_85243_c1
558 Ga0495612_0004843
559 Ga0495595_0002198
560 Ga0495595_0020202
561 Ga0495619_0006801
562 Ga0495619_0044571
563 Ga0495619_0060171
564 Ga0500646_0000237
565 Ga0500588_0011284
566 Ga0500616_0003968
567 Ga0530510_0019948
568 2873320023
569 2786671672
570 2795786068
571 2811842787
572 2856747003
573 2861527405
574 2862286703
575 2862578410
576 2884698260
577 2887484836
578 2891403847
579 2891558204
580 2891568784
581 2895436893
582 2895450851
583 2954005906
584 3006498258
585 8001782231
586 8055066046
587 8055175362
588 8057569426

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00083

Sugar_tr

Sugar (and other) transporter

47

202

0.93

PF07690

MFS_1

Major Facilitator Superfamily

19

421

0.91

PF13347

MFS_2

MFS/sugar transport protein

7

173

0.89

PF06609

TRI12

Fungal trichothecene efflux pump (TRI12)

8

504

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
7yr5-assembly1.cif.gz_A embigin facilitates monocarboxylate transporter 1 localization to plasma membrane and transition to a decoupling state 0.8141 22 448
6kkk-assembly3.cif.gz_C crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation (h115a mutant) 0.8074 23 445
6vs2-assembly1.cif.gz_A protein d 0.8043 22 438
8jtc-assembly1.cif.gz_A human vmat2 complex with reserpine 0.7965 18 448
6oom-assembly2.cif.gz_A-2 protein a 0.7958 20 436
ID Description Score Start End Superfamily
af_Q04301_34_211_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9652 23 198 1.20.1250.20
af_P33335_10_275_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.956 25 194 1.20.1250.20
af_Q86M88_601_814_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9554 24 212 1.20.1250.20
af_P38358_1_192_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9532 62 202 1.20.1250.20
af_P9WG85_29_254_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9516 27 211 1.20.1250.20
ID Description Score Start End GO Terms
AF-C0XND7-F1-model_v4 Drug resistance transporter, EmrB/QacA family 0.971 16 193 GO:0005886
GO:0022857
AF-A0A6G3VUH5-F1-model_v4 deleted 0.956 25 210
AF-A0A3D1QCW4-F1-model_v4 MFS transporter 0.9485 18 200 GO:0005886
GO:0022857
AF-A0A6G3VUH5-F1-model_v4 deleted 0.9364 25 210
AF-A0A353DBH9-F1-model_v4 MFS transporter 0.9303 23 211 GO:0016020
GO:0022857

Map