F391382

General Info

Members Datasets Scaffolds Average Seq Length
293 129 586 485

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10084574|Ga0070681_100845743
Length 527
Sequence MPTLAGWHVITYRPHGLNRLSYPSTASGSYPVPYMSTGARGIDIAVIVAYLAAITWFGAQFRSSQRTLRDYFLGGKTAPWWAIALSIVSAETSTLTVIGTPPLAFRGNYGFLQLVFGYLLARLVIVTFFLPAYFRGEMYTAYELMRVRFGERIRRLTAAAFLVLRALAEGVRVFAVSIVISIVLGSGETASIAVILCLTLFYTYEGGLTAVIWTDVVQMALYVAGAVVSLVLLLHQIPGGWGHVAAVAGPLGKLQVFDFRLAAPAAFFSRTYSFWAGILGGCFLTTASHGTDQLIVQRLLAARDCRQSQAALLASWVVIFVQFTLFLAIGTCLFVLYREQGQAAPAVLDRLYPLYIWQSLPAGVAGLVMAAILAAAMSNLSAALNSLASTTVLDLWKPLLGGFHKTGASASDAIWLARSRYATVVWGIVLMGVALLARQWGNVLQAGLSIASIVYGSLLGVFLLGLFTRRVGEIAAICGMSVGLVLLLYVRFATPIAFTWYVLIGASATFVTAVLVSLVITEPAHGA

Samples

Sample ID Description Type Environment
1 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
57 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
58 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
59 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
87 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
88 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
90 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
91 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
92 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
93 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
94 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
95 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
96 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
97 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
98 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
99 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
103 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
104 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
105 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
106 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
107 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
108 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
109 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
110 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
111 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
112 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
113 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
114 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
115 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
116 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
117 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
118 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
119 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
120 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
121 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
125 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
127 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
128 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
129 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 91.47
Stem 0
Stem Tuber 0
Unclassified 13.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070681_10084574 3300005458 Bacteria 3125
2 Ga0070658_10019481 3300005327 Bacteria 5433
3 Ga0070683_100000011 3300005329 Bacteria 283682
4 Ga0070683_100000834 3300005329 Bacteria 22848
5 Ga0070683_100002713 3300005329 Bacteria 14142
6 Ga0070683_100007338 3300005329 Bacteria 9312
7 Ga0070683_100022899 3300005329 Bacteria 5585
8 Ga0070683_100066697 3300005329 Unclassified 3353
9 Ga0070683_100222489 3300005329 Unclassified 1794
10 Ga0070666_10010041 3300005335 Bacteria 5909
11 Ga0070680_100009674 3300005336 Bacteria 7417
12 Ga0068868_100014086 3300005338 Bacteria 5887
13 Ga0070660_100006658 3300005339 Bacteria 8018
14 Ga0070691_10006171 3300005341 Bacteria 5468
15 Ga0070671_100032377 3300005355 Bacteria 4323
16 Ga0070671_100053725 3300005355 Bacteria 3349
17 Ga0070671_100177413 3300005355 Bacteria 1803
18 Ga0070709_10004107 3300005434 Bacteria 7849
19 Ga0070709_10022120 3300005434 Bacteria 3714
20 Ga0070714_100089430 3300005435 Bacteria 2696
21 Ga0070713_100000671 3300005436 Bacteria 21916
22 Ga0070713_100034118 3300005436 Unclassified 4084
23 Ga0070700_100065884 3300005441 Unclassified 2298
24 Ga0070694_100076104 3300005444 Unclassified 2323
25 Ga0070681_10000603 3300005458 Bacteria 29582
26 Ga0070681_10000766 3300005458 Bacteria 26704
27 Ga0070681_10003701 3300005458 Bacteria 14347
28 Ga0070681_10021363 3300005458 Bacteria 6490
29 Ga0070681_10116610 3300005458 Bacteria 2607
30 Ga0070681_10149374 3300005458 Unclassified 2264
31 Ga0070699_100196706 3300005518 Unclassified 1792
32 Ga0070679_100002388 3300005530 Bacteria 17025
33 Ga0070684_100000001 3300005535 Bacteria 300240
34 Ga0070684_100001688 3300005535 Bacteria 16052
35 Ga0070684_100017404 3300005535 Bacteria 5898
36 Ga0070684_100033751 3300005535 Bacteria 4372
37 Ga0070684_100051239 3300005535 Bacteria 3586
38 Ga0070684_100066221 3300005535 Bacteria 3171
39 Ga0070684_100168955 3300005535 Unclassified 1986
40 Ga0070697_100014615 3300005536 Bacteria 6164
41 Ga0068853_100016789 3300005539 Bacteria 6031
42 Ga0070693_100047400 3300005547 Bacteria 2445
43 Ga0070665_100028928 3300005548 Bacteria 5578
44 Ga0070665_100035565 3300005548 Bacteria 5009
45 Ga0070665_100036121 3300005548 Bacteria 4972
46 Ga0068855_100004826 3300005563 Bacteria 16464
47 Ga0068855_100018526 3300005563 Bacteria 8371
48 Ga0068855_100031982 3300005563 Bacteria 6282
49 Ga0068855_100262282 3300005563 Bacteria 1924
50 Ga0068857_100001898 3300005577 Bacteria 16837
51 Ga0068857_100003245 3300005577 Bacteria 13510
52 Ga0068857_100009759 3300005577 Bacteria 8334
53 Ga0068857_100015024 3300005577 Bacteria 6755
54 Ga0068856_100007638 3300005614 Bacteria 10554
55 Ga0068856_100008857 3300005614 Bacteria 9791
56 Ga0068856_100037712 3300005614 Unclassified 4743
57 Ga0068856_100082217 3300005614 Bacteria 3196
58 Ga0068856_100089476 3300005614 Bacteria 3061
59 Ga0068852_100008568 3300005616 Bacteria 7543
60 Ga0068852_100105119 3300005616 Bacteria 2557
61 Ga0068859_100032164 3300005617 Bacteria 5270
62 Ga0068859_100078306 3300005617 Bacteria 3346
63 Ga0068864_100100351 3300005618 Bacteria 2566
64 Ga0068863_100050254 3300005841 Bacteria 3953
65 Ga0068858_100004704 3300005842 Bacteria 13375
66 Ga0068858_100235276 3300005842 Unclassified 1737
67 Ga0068860_100012022 3300005843 Bacteria 8527
68 Ga0068860_100024390 3300005843 Bacteria 5844
69 Ga0070717_10003222 3300006028 Bacteria 11653
70 Ga0070717_10029205 3300006028 Bacteria 4421
71 Ga0070717_10057344 3300006028 Bacteria 3219
72 Ga0070717_10079602 3300006028 Unclassified 2748
73 Ga0097621_100017815 3300006237 Bacteria 5407
74 Ga0097621_100046907 3300006237 Unclassified 3498
75 Ga0068871_100005165 3300006358 Bacteria 9128
76 Ga0068871_100051020 3300006358 Unclassified 3348
77 Ga0075430_100015441 3300006846 Bacteria 6502
78 Ga0075436_100002499 3300006914 Bacteria 12648
79 Ga0097620_100032165 3300006931 Bacteria 5270
80 Ga0097620_100078304 3300006931 Bacteria 3346
81 Ga0105240_10000779 3300009093 Bacteria 57657
82 Ga0105240_10000981 3300009093 Bacteria 50908
83 Ga0105240_10007810 3300009093 Bacteria 15451
84 Ga0105240_10020614 3300009093 Bacteria 8788
85 Ga0105240_10045777 3300009093 Bacteria 5548
86 Ga0105240_10073918 3300009093 Unclassified 4209
87 Ga0105240_10105892 3300009093 Bacteria 3413
88 Ga0105245_10007629 3300009098 Bacteria 9475
89 Ga0105245_10015335 3300009098 Bacteria 6678
90 Ga0105245_10029685 3300009098 Bacteria 4834
91 Ga0105245_10035601 3300009098 Bacteria 4419
92 Ga0105245_10040608 3300009098 Bacteria 4145
93 Ga0105245_10045628 3300009098 Bacteria 3914
94 Ga0105243_10039378 3300009148 Unclassified 3684
95 Ga0105243_10086293 3300009148 Unclassified 2574
96 Ga0105243_10197304 3300009148 Unclassified 1763
97 Ga0105241_10008126 3300009174 Bacteria 7726
98 Ga0105241_10016479 3300009174 Bacteria 5422
99 Ga0105241_10157706 3300009174 Bacteria 1862
100 Ga0105241_10206360 3300009174 Bacteria 1644
101 Ga0105242_10020290 3300009176 Bacteria 5210
102 Ga0105242_10058520 3300009176 Unclassified 3160
103 Ga0105248_10002273 3300009177 Bacteria 21267
104 Ga0105248_10008283 3300009177 Bacteria 11420
105 Ga0105248_10023898 3300009177 Bacteria 6793
106 Ga0105248_10077267 3300009177 Bacteria 3742
107 Ga0105248_10266300 3300009177 Bacteria 1929
108 Ga0105237_10002035 3300009545 Bacteria 25703
109 Ga0105237_10010856 3300009545 Bacteria 9665
110 Ga0105237_10031491 3300009545 Bacteria 5378
111 Ga0105237_10097002 3300009545 Unclassified 2938
112 Ga0105238_10008406 3300009551 Bacteria 10331
113 Ga0105238_10015633 3300009551 Bacteria 7681
114 Ga0105238_10051508 3300009551 Bacteria 4141
115 Ga0105238_10053486 3300009551 Unclassified 4057
116 Ga0105238_10233606 3300009551 Bacteria 1815
117 Ga0105249_10047646 3300009553 Bacteria 3906
118 Ga0105239_10003677 3300010375 Bacteria 18726
119 Ga0105239_10007256 3300010375 Bacteria 12733
120 Ga0105239_10009143 3300010375 Bacteria 11208
121 Ga0105239_10009385 3300010375 Bacteria 11034
122 Ga0105239_10016108 3300010375 Bacteria 8271
123 Ga0157370_10001881 3300013104 Bacteria 25852
124 Ga0157370_10002467 3300013104 Bacteria 22312
125 Ga0157370_10015225 3300013104 Bacteria 7829
126 Ga0157370_10027235 3300013104 Bacteria 5636
127 Ga0157369_10004394 3300013105 Bacteria 16642
128 Ga0157369_10006136 3300013105 Bacteria 13947
129 Ga0157369_10007281 3300013105 Bacteria 12739
130 Ga0157369_10014538 3300013105 Bacteria 8881
131 Ga0157369_10029661 3300013105 Bacteria 6042
132 Ga0157369_10048402 3300013105 Bacteria 4613
133 Ga0157369_10141675 3300013105 Bacteria 2544
134 Ga0157369_10257950 3300013105 Unclassified 1818
135 Ga0157374_10013761 3300013296 Bacteria 7067
136 Ga0157374_10092403 3300013296 Unclassified 2887
137 Ga0157378_10020083 3300013297 Bacteria 5875
138 Ga0157372_10076870 3300013307 Bacteria 3770
139 Ga0157372_10083832 3300013307 Bacteria 3611
140 Ga0157372_10219889 3300013307 Bacteria 2202
141 Ga0157372_10225628 3300013307 Bacteria 2172
142 Ga0157375_10005404 3300013308 Bacteria 11105
143 Ga0163163_10036218 3300014325 Bacteria 4793
144 Ga0163163_10039123 3300014325 Bacteria 4626
145 Ga0163163_10058529 3300014325 Unclassified 3811
146 Ga0163163_10179197 3300014325 Bacteria 2166
147 Ga0163163_10235609 3300014325 Bacteria 1880
148 Ga0157379_10021464 3300014968 Bacteria 5715
149 Ga0157379_10057143 3300014968 Unclassified 3487
150 Ga0157376_10043891 3300014969 Bacteria 3671
151 Ga0157376_10149487 3300014969 Bacteria 2105
152 Ga0213876_10005246 3300021384 Bacteria 7138
153 Ga0213876_10052313 3300021384 Bacteria 2158
154 Ga0213876_10053553 3300021384 Unclassified 2131
155 Ga0213875_10000017 3300021388 Bacteria 239813
156 Ga0213875_10001609 3300021388 Bacteria 14268
157 Ga0213875_10003506 3300021388 Bacteria 8925
158 Ga0213875_10005665 3300021388 Bacteria 6668
159 Ga0213875_10013379 3300021388 Bacteria 4032
160 Ga0228598_1000432 3300024227 Bacteria 8526
161 Ga0207699_10009978 3300025906 Bacteria 4749
162 Ga0207707_10006193 3300025912 Bacteria 10452
163 Ga0207707_10008939 3300025912 Bacteria 8701
164 Ga0207707_10026236 3300025912 Bacteria 5094
165 Ga0207707_10110657 3300025912 Unclassified 2401
166 Ga0207695_10003500 3300025913 Bacteria 22030
167 Ga0207695_10004208 3300025913 Bacteria 19770
168 Ga0207695_10012393 3300025913 Bacteria 10239
169 Ga0207695_10046586 3300025913 Bacteria 4596
170 Ga0207695_10051103 3300025913 Unclassified 4342
171 Ga0207671_10018837 3300025914 Bacteria 5290
172 Ga0207671_10021893 3300025914 Bacteria 4842
173 Ga0207663_10061482 3300025916 Bacteria 2383
174 Ga0207660_10013057 3300025917 Bacteria 5438
175 Ga0207657_10007784 3300025919 Bacteria 10938
176 Ga0207657_10099198 3300025919 Bacteria 2419
177 Ga0207649_10045551 3300025920 Bacteria 2690
178 Ga0207652_10006024 3300025921 Bacteria 9817
179 Ga0207652_10103534 3300025921 Bacteria 2517
180 Ga0207694_10001877 3300025924 Bacteria 17419
181 Ga0207694_10068882 3300025924 Unclassified 2764
182 Ga0207694_10089168 3300025924 Bacteria 2432
183 Ga0207687_10003072 3300025927 Bacteria 11328
184 Ga0207687_10004997 3300025927 Bacteria 8785
185 Ga0207687_10018358 3300025927 Bacteria 4616
186 Ga0207700_10001522 3300025928 Bacteria 13124
187 Ga0207686_10024370 3300025934 Bacteria 3506
188 Ga0207709_10040732 3300025935 Bacteria 2783
189 Ga0207711_10013114 3300025941 Bacteria 6882
190 Ga0207711_10038421 3300025941 Bacteria 4071
191 Ga0207661_10000016 3300025944 Bacteria 305159
192 Ga0207661_10001576 3300025944 Bacteria 15516
193 Ga0207661_10010330 3300025944 Bacteria 6717
194 Ga0207661_10013862 3300025944 Bacteria 5891
195 Ga0207661_10190769 3300025944 Unclassified 1796
196 Ga0207667_10011904 3300025949 Bacteria 10076
197 Ga0207667_10026571 3300025949 Bacteria 6320
198 Ga0207667_10035292 3300025949 Bacteria 5365
199 Ga0207667_10152477 3300025949 Bacteria 2378
200 Ga0207651_10041708 3300025960 Bacteria 3048
201 Ga0207703_10008144 3300026035 Bacteria 8286
202 Ga0207703_10014954 3300026035 Bacteria 6056
203 Ga0207639_10041714 3300026041 Bacteria 3435
204 Ga0207702_10003732 3300026078 Bacteria 13765
205 Ga0207702_10007019 3300026078 Bacteria 9634
206 Ga0207702_10007247 3300026078 Bacteria 9486
207 Ga0207702_10090426 3300026078 Bacteria 2679
208 Ga0207702_10099574 3300026078 Bacteria 2563
209 Ga0207641_10038850 3300026088 Unclassified 3980
210 Ga0207674_10003320 3300026116 Bacteria 19781
211 Ga0207674_10005510 3300026116 Bacteria 15028
212 Ga0207674_10010534 3300026116 Bacteria 10466
213 Ga0207674_10018602 3300026116 Bacteria 7546
214 Ga0207683_10036753 3300026121 Bacteria 4265
215 Ga0207698_10012585 3300026142 Bacteria 5543
216 Ga0268266_10021367 3300028379 Bacteria 5514
217 Ga0268266_10024205 3300028379 Bacteria 5167
218 Ga0268266_10073327 3300028379 Bacteria 2971
219 Ga0268264_10008328 3300028381 Bacteria 8617
220 Ga0265323_10000200 3300028653 Bacteria 36094
221 Ga0265338_10038032 3300028800 Bacteria 4568
222 Ga0265338_10119120 3300028800 Unclassified 2108
223 Ga0265760_10019512 3300031090 Bacteria 1953
224 Ga0265325_10002989 3300031241 Bacteria 11221
225 Ga0265325_10021656 3300031241 Unclassified 3528
226 Ga0265340_10061691 3300031247 Unclassified 1793
227 Ga0265316_10050214 3300031344 Bacteria 3282
228 Ga0265313_10005374 3300031595 Bacteria 9451
229 Ga0265314_10002684 3300031711 Bacteria 17824
230 Ga0265314_10009574 3300031711 Bacteria 8164
231 Ga0373923_0018420 3300035111 Bacteria 2687
232 Ga0373954_0001488 3300035118 Bacteria 9532
233 Ga0373943_0042795 3300035170 Bacteria 2196
234 Ga0373935_0120011 3300035692 Bacteria 1755
235 Ga0373927_0010423 3300035695 Bacteria 6197
236 Ga0373947_0000038 3300035725 Bacteria 63712
237 Ga0373937_0004947 3300036401 Bacteria 11329
238 Ga0373937_0198609 3300036401 Bacteria 1885
239 Ga0373925_0000040 3300037068 Bacteria 138266
240 Ga0373925_0007888 3300037068 Bacteria 7752
241 Ga0436364_0170374 3300037853 Unclassified 4162
242 Ga0436364_0209156 3300037853 Unclassified 3959
243 Ga0436364_0339530 3300037853 Bacteria 240640
244 Ga0436364_0380069 3300037853 Bacteria 5735
245 Ga0436364_0528804 3300037853 Bacteria 9153
246 Ga0436364_0601128 3300037853 Bacteria 88345
247 Ga0436364_0745246 3300037853 Bacteria 72310
248 Ga0436364_0749102 3300037853 Unclassified 1618
249 Ga0436364_0780002 3300037853 Bacteria 7439
250 Ga0436364_0856578 3300037853 Bacteria 6806
251 Ga0436364_1381725 3300037853 Unclassified 4054
252 Ga0436365_0139641 3300039437 Bacteria 31900
253 Ga0436365_0556836 3300039437 Bacteria 4181
254 Ga0436365_0957404 3300039437 Bacteria 8140
255 Ga0436365_1791776 3300039437 Bacteria 7536
256 Ga0436363_0635343 3300039450 Unclassified 4935
257 Ga0436363_0962479 3300039450 Bacteria 12348
258 Ga0436362_1014000 3300039453 Bacteria 3986
259 Ga0466966_0022899 3300044684 Unclassified 4093
260 Ga0466959_0059082 3300045049 Bacteria 2793
261 Ga0451576_0176926 3300045051 Bacteria 2228
262 Ga0466967_0093235 3300045976 Bacteria 2740
263 Ga0495592_0045301 3300046454 Bacteria 3283
264 Ga0495580_0000579 3300046472 Bacteria 30897
265 Ga0495580_0016154 3300046472 Bacteria 5610
266 Ga0495580_0085712 3300046472 Unclassified 2194
267 Ga0495639_0014623 3300046475 Bacteria 3400
268 Ga0495652_0013521 3300046529 Bacteria 7347
269 Ga0495652_0068735 3300046529 Bacteria 2967
270 Ga0495586_0027096 3300046535 Bacteria 3067
271 Ga0495667_0116475 3300046559 Bacteria 1726
272 Ga0495635_0153596 3300046663 Bacteria 1567
273 Ga0495599_0001682 3300046678 Bacteria 12780
274 Ga0495674_0153946 3300047319 Bacteria 1927
275 Ga0495684_0001648 3300047471 Bacteria 17929
276 Ga0495684_0039224 3300047471 Bacteria 3631
277 Ga0495684_0054400 3300047471 Bacteria 3053
278 Ga0495684_0070558 3300047471 Bacteria 2656
279 Ga0495602_0000464 3300048088 Bacteria 37661
280 Ga0495602_0170676 3300048088 Bacteria 1689
281 Ga0501034_0043306 3300049571 Bacteria 4556
282 Ga0501034_0225719 3300049571 Bacteria 1824
283 Ga0501047_0003484 3300049581 Bacteria 14875
284 Ga0501047_0259634 3300049581 Bacteria 1585
285 Ga0501048_0123130 3300049582 Bacteria 1833
286 Ga0501070_0013339 3300049586 Bacteria 6931
287 Ga0501070_0058198 3300049586 Bacteria 3203
288 Ga0501035_0153398 3300049822 Bacteria 1998
289 Ga0501044_0007708 3300049823 Bacteria 11840
290 Ga0501044_0008607 3300049823 Bacteria 11173
291 nmdc:mga0qj67_48461_c1 3300050509 Bacteria 3356
292 nmdc:mga06r32_37767_c1 3300050510 Bacteria 4569
293 nmdc:mga08x19_7400_c1 3300050514 Bacteria 6519
294 Ga0070681_10084574
295 Ga0070658_10019481
296 Ga0070683_100000011
297 Ga0070683_100000834
298 Ga0070683_100002713
299 Ga0070683_100007338
300 Ga0070683_100022899
301 Ga0070683_100066697
302 Ga0070683_100222489
303 Ga0070666_10010041
304 Ga0070680_100009674
305 Ga0068868_100014086
306 Ga0070660_100006658
307 Ga0070691_10006171
308 Ga0070671_100032377
309 Ga0070671_100053725
310 Ga0070671_100177413
311 Ga0070709_10004107
312 Ga0070709_10022120
313 Ga0070714_100089430
314 Ga0070713_100000671
315 Ga0070713_100034118
316 Ga0070700_100065884
317 Ga0070694_100076104
318 Ga0070681_10000603
319 Ga0070681_10000766
320 Ga0070681_10003701
321 Ga0070681_10021363
322 Ga0070681_10116610
323 Ga0070681_10149374
324 Ga0070699_100196706
325 Ga0070679_100002388
326 Ga0070684_100000001
327 Ga0070684_100001688
328 Ga0070684_100017404
329 Ga0070684_100033751
330 Ga0070684_100051239
331 Ga0070684_100066221
332 Ga0070684_100168955
333 Ga0070697_100014615
334 Ga0068853_100016789
335 Ga0070693_100047400
336 Ga0070665_100028928
337 Ga0070665_100035565
338 Ga0070665_100036121
339 Ga0068855_100004826
340 Ga0068855_100018526
341 Ga0068855_100031982
342 Ga0068855_100262282
343 Ga0068857_100001898
344 Ga0068857_100003245
345 Ga0068857_100009759
346 Ga0068857_100015024
347 Ga0068856_100007638
348 Ga0068856_100008857
349 Ga0068856_100037712
350 Ga0068856_100082217
351 Ga0068856_100089476
352 Ga0068852_100008568
353 Ga0068852_100105119
354 Ga0068859_100032164
355 Ga0068859_100078306
356 Ga0068864_100100351
357 Ga0068863_100050254
358 Ga0068858_100004704
359 Ga0068858_100235276
360 Ga0068860_100012022
361 Ga0068860_100024390
362 Ga0070717_10003222
363 Ga0070717_10029205
364 Ga0070717_10057344
365 Ga0070717_10079602
366 Ga0097621_100017815
367 Ga0097621_100046907
368 Ga0068871_100005165
369 Ga0068871_100051020
370 Ga0075430_100015441
371 Ga0075436_100002499
372 Ga0097620_100032165
373 Ga0097620_100078304
374 Ga0105240_10000779
375 Ga0105240_10000981
376 Ga0105240_10007810
377 Ga0105240_10020614
378 Ga0105240_10045777
379 Ga0105240_10073918
380 Ga0105240_10105892
381 Ga0105245_10007629
382 Ga0105245_10015335
383 Ga0105245_10029685
384 Ga0105245_10035601
385 Ga0105245_10040608
386 Ga0105245_10045628
387 Ga0105243_10039378
388 Ga0105243_10086293
389 Ga0105243_10197304
390 Ga0105241_10008126
391 Ga0105241_10016479
392 Ga0105241_10157706
393 Ga0105241_10206360
394 Ga0105242_10020290
395 Ga0105242_10058520
396 Ga0105248_10002273
397 Ga0105248_10008283
398 Ga0105248_10023898
399 Ga0105248_10077267
400 Ga0105248_10266300
401 Ga0105237_10002035
402 Ga0105237_10010856
403 Ga0105237_10031491
404 Ga0105237_10097002
405 Ga0105238_10008406
406 Ga0105238_10015633
407 Ga0105238_10051508
408 Ga0105238_10053486
409 Ga0105238_10233606
410 Ga0105249_10047646
411 Ga0105239_10003677
412 Ga0105239_10007256
413 Ga0105239_10009143
414 Ga0105239_10009385
415 Ga0105239_10016108
416 Ga0157370_10001881
417 Ga0157370_10002467
418 Ga0157370_10015225
419 Ga0157370_10027235
420 Ga0157369_10004394
421 Ga0157369_10006136
422 Ga0157369_10007281
423 Ga0157369_10014538
424 Ga0157369_10029661
425 Ga0157369_10048402
426 Ga0157369_10141675
427 Ga0157369_10257950
428 Ga0157374_10013761
429 Ga0157374_10092403
430 Ga0157378_10020083
431 Ga0157372_10076870
432 Ga0157372_10083832
433 Ga0157372_10219889
434 Ga0157372_10225628
435 Ga0157375_10005404
436 Ga0163163_10036218
437 Ga0163163_10039123
438 Ga0163163_10058529
439 Ga0163163_10179197
440 Ga0163163_10235609
441 Ga0157379_10021464
442 Ga0157379_10057143
443 Ga0157376_10043891
444 Ga0157376_10149487
445 Ga0213876_10005246
446 Ga0213876_10052313
447 Ga0213876_10053553
448 Ga0213875_10000017
449 Ga0213875_10001609
450 Ga0213875_10003506
451 Ga0213875_10005665
452 Ga0213875_10013379
453 Ga0228598_1000432
454 Ga0207699_10009978
455 Ga0207707_10006193
456 Ga0207707_10008939
457 Ga0207707_10026236
458 Ga0207707_10110657
459 Ga0207695_10003500
460 Ga0207695_10004208
461 Ga0207695_10012393
462 Ga0207695_10046586
463 Ga0207695_10051103
464 Ga0207671_10018837
465 Ga0207671_10021893
466 Ga0207663_10061482
467 Ga0207660_10013057
468 Ga0207657_10007784
469 Ga0207657_10099198
470 Ga0207649_10045551
471 Ga0207652_10006024
472 Ga0207652_10103534
473 Ga0207694_10001877
474 Ga0207694_10068882
475 Ga0207694_10089168
476 Ga0207687_10003072
477 Ga0207687_10004997
478 Ga0207687_10018358
479 Ga0207700_10001522
480 Ga0207686_10024370
481 Ga0207709_10040732
482 Ga0207711_10013114
483 Ga0207711_10038421
484 Ga0207661_10000016
485 Ga0207661_10001576
486 Ga0207661_10010330
487 Ga0207661_10013862
488 Ga0207661_10190769
489 Ga0207667_10011904
490 Ga0207667_10026571
491 Ga0207667_10035292
492 Ga0207667_10152477
493 Ga0207651_10041708
494 Ga0207703_10008144
495 Ga0207703_10014954
496 Ga0207639_10041714
497 Ga0207702_10003732
498 Ga0207702_10007019
499 Ga0207702_10007247
500 Ga0207702_10090426
501 Ga0207702_10099574
502 Ga0207641_10038850
503 Ga0207674_10003320
504 Ga0207674_10005510
505 Ga0207674_10010534
506 Ga0207674_10018602
507 Ga0207683_10036753
508 Ga0207698_10012585
509 Ga0268266_10021367
510 Ga0268266_10024205
511 Ga0268266_10073327
512 Ga0268264_10008328
513 Ga0265323_10000200
514 Ga0265338_10038032
515 Ga0265338_10119120
516 Ga0265760_10019512
517 Ga0265325_10002989
518 Ga0265325_10021656
519 Ga0265340_10061691
520 Ga0265316_10050214
521 Ga0265313_10005374
522 Ga0265314_10002684
523 Ga0265314_10009574
524 Ga0373923_0018420
525 Ga0373954_0001488
526 Ga0373943_0042795
527 Ga0373935_0120011
528 Ga0373927_0010423
529 Ga0373947_0000038
530 Ga0373937_0004947
531 Ga0373937_0198609
532 Ga0373925_0000040
533 Ga0373925_0007888
534 Ga0436364_0170374
535 Ga0436364_0209156
536 Ga0436364_0339530
537 Ga0436364_0380069
538 Ga0436364_0528804
539 Ga0436364_0601128
540 Ga0436364_0745246
541 Ga0436364_0749102
542 Ga0436364_0780002
543 Ga0436364_0856578
544 Ga0436364_1381725
545 Ga0436365_0139641
546 Ga0436365_0556836
547 Ga0436365_0957404
548 Ga0436365_1791776
549 Ga0436363_0635343
550 Ga0436363_0962479
551 Ga0436362_1014000
552 Ga0466966_0022899
553 Ga0466959_0059082
554 Ga0451576_0176926
555 Ga0466967_0093235
556 Ga0495592_0045301
557 Ga0495580_0000579
558 Ga0495580_0016154
559 Ga0495580_0085712
560 Ga0495639_0014623
561 Ga0495652_0013521
562 Ga0495652_0068735
563 Ga0495586_0027096
564 Ga0495667_0116475
565 Ga0495635_0153596
566 Ga0495599_0001682
567 Ga0495674_0153946
568 Ga0495684_0001648
569 Ga0495684_0039224
570 Ga0495684_0054400
571 Ga0495684_0070558
572 Ga0495602_0000464
573 Ga0495602_0170676
574 Ga0501034_0043306
575 Ga0501034_0225719
576 Ga0501047_0003484
577 Ga0501047_0259634
578 Ga0501048_0123130
579 Ga0501070_0013339
580 Ga0501070_0058198
581 Ga0501035_0153398
582 Ga0501044_0007708
583 Ga0501044_0008607
584 nmdc:mga0qj67_48461_c1
585 nmdc:mga06r32_37767_c1
586 nmdc:mga08x19_7400_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00474

SSF

Sodium:solute symporter family

71

483

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5nva-assembly1.cif.gz_A substrate-bound outward-open state of a na+-coupled sialic acid symporter reveals a novel na+-site 0.8947 8 489
5nva-assembly1.cif.gz_A substrate-bound outward-open state of a na+-coupled sialic acid symporter reveals a novel na+-site 0.8803 8 489
5nv9-assembly1.cif.gz_A substrate-bound outward-open state of a na+-coupled sialic acid symporter reveals a novel na+-site 0.8719 8 485
8hg7-assembly1.cif.gz_A structure of human sglt2-map17 complex with sotagliflozin 0.8708 6 488
8hdh-assembly1.cif.gz_A structure of human sglt2-map17 complex with canagliflozin 0.8674 6 488
ID Description Score Start End Superfamily
af_P83740_46_534_1.20.1730.10 Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter 0.9144 44 484 1.20.1730.10
af_Q1EHB4_32_596_1.20.1730.10 Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter 0.9014 29 484 1.20.1730.10
af_Q9Y289_54_554_1.20.1730.10 Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter 0.8966 32 484 1.20.1730.10
af_Q9W3R0_60_567_1.20.1730.10 Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter 0.8949 37 487 1.20.1730.10
af_Q7K3Q2_41_585_1.20.1730.10 Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter 0.8932 36 488 1.20.1730.10
ID Description Score Start End GO Terms
AF-A0A2T0V3F3-F1-model_v4 SSS family transporter 0.9475 5 488 GO:0005886
GO:0006814
GO:0015075
GO:0015293
GO:0098660
AF-A0A3D2FQD0-F1-model_v4 Peptidoglycan beta-N-acetylmuramidase NamZ C-terminal domain-containing protein 0.9473 1 304 GO:0005886
GO:0006814
GO:0015293
AF-A0A2D8KGW6-F1-model_v4 Sodium:solute symporter 0.947 11 304 GO:0005886
GO:0006814
GO:0015293
AF-A0A2V6NQ96-F1-model_v4 Sodium:solute symporter 0.9445 7 303 GO:0005886
GO:0006814
GO:0015293
AF-A0A3M1TUS5-F1-model_v4 Sodium transporter 0.941 59 488 GO:0005886
GO:0006814
GO:0015293

Map