F391092

General Info

Members Datasets Scaffolds Average Seq Length
292 145 584 213

Family's Representative Sequence

Representative Sequence 3300045049|Ga0466959_0044138|Ga0466959_0044138_1126_1872
Length 248
Sequence MLSLREKSVRILKVLVFLLCLGPLSVLIWKGFHDVLGANPVDVITRTTGRWTLTFLLITLSVSPLRKLLRLPWLIRFRRMLGLFAFFYGTLHLMTYVWLDKFFNVHEMLHDIAKRRFITAGMTAWALMLPLALTSTTGWIRRLGGKRWQNLHRLIYFSALAGVVHFIWLVKADLRRPLTYGAVLAALLAFRVAQWSFQKLRSRAVVENRVTPPHQAQHQRSSGTPVIGSPSHRIIGKAQDKLAANPRE

Samples

Sample ID Description Type Environment
1 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
76 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
77 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
78 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
79 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
81 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
82 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
83 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
84 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
85 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
86 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
87 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
88 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
89 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
90 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
91 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
92 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
93 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
94 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
95 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
96 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
97 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
98 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
99 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
104 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
105 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
106 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
109 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
110 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
111 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
112 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
113 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
114 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
115 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
116 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
117 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
118 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
119 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
120 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
121 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
122 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
123 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
124 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
125 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
126 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
127 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
128 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
129 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
130 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
131 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
132 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
133 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
136 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
137 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
138 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
139 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.52
Metatranscriptomes 5.48
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.77
Rhizosphere 95.89
Stem 0
Stem Tuber 0
Unclassified 4.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466959_0044138 3300045049 Bacteria 3285
2 Ga0058863_10073722 3300004799 Bacteria 2464
3 Ga0058861_10097013 3300004800 Bacteria 1986
4 Ga0065715_10003717 3300005293 Bacteria 7453
5 Ga0070680_100035734 3300005336 Bacteria 4012
6 Ga0070680_100050587 3300005336 Bacteria 3389
7 Ga0070680_100298661 3300005336 Bacteria 1365
8 Ga0070682_100129707 3300005337 Bacteria 1705
9 Ga0070687_100001672 3300005343 Bacteria 7952
10 Ga0070692_10092719 3300005345 Bacteria 1644
11 Ga0070709_10181815 3300005434 Bacteria 1477
12 Ga0070714_100000031 3300005435 Bacteria 133682
13 Ga0070714_100032761 3300005435 Bacteria 4339
14 Ga0070714_100780540 3300005435 Bacteria 924
15 Ga0070714_101246956 3300005435 Bacteria 726
16 Ga0070713_100001574 3300005436 Bacteria 14595
17 Ga0070713_100002775 3300005436 Bacteria 11447
18 Ga0070713_100004242 3300005436 Bacteria 9582
19 Ga0070713_100026872 3300005436 Bacteria 4525
20 Ga0070713_100044543 3300005436 Bacteria 3632
21 Ga0070713_100180123 3300005436 Bacteria 1898
22 Ga0070713_100304768 3300005436 Bacteria 1467
23 Ga0070713_100352618 3300005436 Bacteria 1365
24 Ga0070710_10095518 3300005437 Bacteria 1761
25 Ga0070710_10160090 3300005437 Bacteria 1395
26 Ga0070711_100008970 3300005439 Bacteria 6137
27 Ga0070711_100019872 3300005439 Bacteria 4319
28 Ga0070711_100029650 3300005439 Bacteria 3613
29 Ga0070711_100577862 3300005439 Unclassified 935
30 Ga0070708_100003340 3300005445 Bacteria 12562
31 Ga0070708_100017023 3300005445 Bacteria 6051
32 Ga0070708_100327605 3300005445 Bacteria 1443
33 Ga0070708_100496304 3300005445 Bacteria 1151
34 Ga0070681_10004893 3300005458 Bacteria 12853
35 Ga0070681_10129895 3300005458 Bacteria 2451
36 Ga0070681_10274682 3300005458 Bacteria 1596
37 Ga0070706_100041055 3300005467 Bacteria 4271
38 Ga0070706_100224370 3300005467 Bacteria 1754
39 Ga0070707_100102563 3300005468 Bacteria 2772
40 Ga0070707_100475452 3300005468 Unclassified 1211
41 Ga0070699_100020126 3300005518 Bacteria 5752
42 Ga0070679_100006981 3300005530 Bacteria 10539
43 Ga0070679_100007054 3300005530 Bacteria 10481
44 Ga0070679_100012586 3300005530 Bacteria 8089
45 Ga0070684_100036678 3300005535 Bacteria 4201
46 Ga0068853_100245616 3300005539 Bacteria 1641
47 Ga0070693_100056125 3300005547 Bacteria 2272
48 Ga0068855_100059810 3300005563 Bacteria 4457
49 Ga0068855_100074691 3300005563 Bacteria 3936
50 Ga0068855_100337203 3300005563 Bacteria 1663
51 Ga0068854_100025155 3300005578 Bacteria 4084
52 Ga0068856_100000410 3300005614 Bacteria 47268
53 Ga0068856_100512170 3300005614 Bacteria 1221
54 Ga0068852_100025109 3300005616 Bacteria 4824
55 Ga0068852_100030012 3300005616 Bacteria 4471
56 Ga0068852_100099382 3300005616 Bacteria 2623
57 Ga0068866_10006316 3300005718 Bacteria 4932
58 Ga0070717_10008634 3300006028 Bacteria 7618
59 Ga0070717_10010308 3300006028 Bacteria 7049
60 Ga0070717_10013932 3300006028 Bacteria 6176
61 Ga0070717_10024454 3300006028 Bacteria 4797
62 Ga0070717_10034415 3300006028 Bacteria 4095
63 Ga0070717_10049453 3300006028 Bacteria 3451
64 Ga0070717_10120046 3300006028 Bacteria 2251
65 Ga0070717_10141166 3300006028 Bacteria 2078
66 Ga0070717_10179835 3300006028 Bacteria 1843
67 Ga0070717_10227275 3300006028 Bacteria 1642
68 Ga0070717_10245965 3300006028 Bacteria 1579
69 Ga0070717_10553785 3300006028 Bacteria 1041
70 Ga0070715_10175378 3300006163 Bacteria 1071
71 Ga0070716_100173579 3300006173 Bacteria 1409
72 Ga0070716_100219257 3300006173 Bacteria 1277
73 Ga0070716_100485677 3300006173 Bacteria 908
74 Ga0070712_100001771 3300006175 Bacteria 13214
75 Ga0070712_100003621 3300006175 Bacteria 9527
76 Ga0075434_100803269 3300006871 Bacteria 957
77 Ga0068865_100012955 3300006881 Bacteria 5258
78 Ga0075436_100241001 3300006914 Bacteria 1286
79 Ga0105240_10095763 3300009093 Bacteria 3619
80 Ga0105242_10834282 3300009176 Bacteria 916
81 Ga0105237_10031400 3300009545 Bacteria 5387
82 Ga0105237_10170475 3300009545 Bacteria 2176
83 Ga0105238_10054347 3300009551 Bacteria 4022
84 Ga0105238_10165170 3300009551 Bacteria 2189
85 Ga0157373_10039785 3300013100 Bacteria 3365
86 Ga0157373_10101401 3300013100 Bacteria 2025
87 Ga0157370_10103287 3300013104 Bacteria 2668
88 Ga0157370_10188164 3300013104 Bacteria 1916
89 Ga0157369_10030947 3300013105 Bacteria 5897
90 Ga0157369_10086211 3300013105 Bacteria 3354
91 Ga0157369_10126899 3300013105 Bacteria 2704
92 Ga0157369_10200044 3300013105 Bacteria 2097
93 Ga0157369_10267799 3300013105 Bacteria 1781
94 Ga0157374_10234975 3300013296 Bacteria 1801
95 Ga0157374_10277663 3300013296 Bacteria 1653
96 Ga0163162_10693830 3300013306 Unclassified 1140
97 Ga0157372_10111651 3300013307 Bacteria 3132
98 Ga0157372_10113447 3300013307 Bacteria 3106
99 Ga0157372_10159437 3300013307 Bacteria 2607
100 Ga0157372_10220692 3300013307 Bacteria 2197
101 Ga0157376_10005780 3300014969 Bacteria 8665
102 Ga0206352_10278597 3300020078 Bacteria 1443
103 Ga0224712_10036292 3300022467 Bacteria 1826
104 Ga0224712_10053698 3300022467 Bacteria 1579
105 Ga0207682_10005060 3300025893 Bacteria 5405
106 Ga0207692_10122725 3300025898 Bacteria 1457
107 Ga0207692_10225569 3300025898 Bacteria 1113
108 Ga0207642_10206939 3300025899 Bacteria 1088
109 Ga0207685_10151123 3300025905 Bacteria 1051
110 Ga0207699_10016058 3300025906 Bacteria 3906
111 Ga0207699_10508374 3300025906 Bacteria 870
112 Ga0207684_10033009 3300025910 Bacteria 4403
113 Ga0207684_10182444 3300025910 Bacteria 1810
114 Ga0207654_10368727 3300025911 Bacteria 992
115 Ga0207707_10114385 3300025912 Bacteria 2358
116 Ga0207707_10261551 3300025912 Bacteria 1501
117 Ga0207707_10320236 3300025912 Bacteria 1339
118 Ga0207695_10028981 3300025913 Bacteria 6127
119 Ga0207695_10330232 3300025913 Bacteria 1414
120 Ga0207671_10251053 3300025914 Bacteria 1391
121 Ga0207693_10009111 3300025915 Bacteria 8103
122 Ga0207693_10016931 3300025915 Bacteria 5821
123 Ga0207693_10109736 3300025915 Bacteria 2164
124 Ga0207663_10038544 3300025916 Bacteria 2890
125 Ga0207663_10044185 3300025916 Bacteria 2734
126 Ga0207663_10219622 3300025916 Bacteria 1382
127 Ga0207660_10003975 3300025917 Bacteria 9635
128 Ga0207660_10134744 3300025917 Bacteria 1883
129 Ga0207660_10855461 3300025917 Bacteria 742
130 Ga0207652_10017488 3300025921 Bacteria 5867
131 Ga0207652_10184789 3300025921 Bacteria 1874
132 Ga0207652_10372916 3300025921 Bacteria 1288
133 Ga0207652_10890832 3300025921 Bacteria 786
134 Ga0207646_10402873 3300025922 Unclassified 1235
135 Ga0207694_10152294 3300025924 Bacteria 1863
136 Ga0207694_10246717 3300025924 Bacteria 1460
137 Ga0207687_10006392 3300025927 Bacteria 7787
138 Ga0207687_10093033 3300025927 Bacteria 2203
139 Ga0207700_10003638 3300025928 Bacteria 8988
140 Ga0207700_10003942 3300025928 Bacteria 8678
141 Ga0207700_10006793 3300025928 Bacteria 6951
142 Ga0207700_10019216 3300025928 Bacteria 4612
143 Ga0207700_10021093 3300025928 Bacteria 4441
144 Ga0207700_10258511 3300025928 Bacteria 1490
145 Ga0207700_10270473 3300025928 Bacteria 1458
146 Ga0207664_10000045 3300025929 Bacteria 141234
147 Ga0207664_10023009 3300025929 Bacteria 4663
148 Ga0207664_10036959 3300025929 Bacteria 3776
149 Ga0207664_10090866 3300025929 Bacteria 2502
150 Ga0207664_10135515 3300025929 Bacteria 2077
151 Ga0207665_10074372 3300025939 Bacteria 2325
152 Ga0207665_10226378 3300025939 Bacteria 1373
153 Ga0207661_10188826 3300025944 Bacteria 1805
154 Ga0207667_10073216 3300025949 Bacteria 3560
155 Ga0207667_10427915 3300025949 Bacteria 1346
156 Ga0207667_10432627 3300025949 Bacteria 1338
157 Ga0207667_10589182 3300025949 Bacteria 1122
158 Ga0207640_10032032 3300025981 Bacteria 3256
159 Ga0207640_10096248 3300025981 Bacteria 2063
160 Ga0207640_10126198 3300025981 Bacteria 1842
161 Ga0207677_10023171 3300026023 Bacteria 3829
162 Ga0207639_10038421 3300026041 Bacteria 3560
163 Ga0207639_10562237 3300026041 Bacteria 1048
164 Ga0207702_10000932 3300026078 Bacteria 30177
165 Ga0207702_10065213 3300026078 Bacteria 3119
166 Ga0207698_10306701 3300026142 Bacteria 1480
167 Ga0207698_10671978 3300026142 Bacteria 1028
168 Ga0265356_1000750 3300028017 Bacteria 5504
169 Ga0265357_1001308 3300028023 Bacteria 1796
170 Ga0265355_1005691 3300028036 Bacteria 962
171 Ga0265338_10009412 3300028800 Bacteria 11652
172 Ga0265338_10035442 3300028800 Bacteria 4796
173 Ga0265760_10000370 3300031090 Bacteria 12538
174 Ga0265760_10135294 3300031090 Bacteria 799
175 Ga0265325_10031981 3300031241 Bacteria 2813
176 Ga0265339_10030929 3300031249 Bacteria 3028
177 Ga0265339_10049076 3300031249 Bacteria 2313
178 Ga0265339_10087886 3300031249 Bacteria 1633
179 Ga0265314_10109331 3300031711 Bacteria 1759
180 Ga0373926_0019301 3300035083 Unclassified 2349
181 Ga0373926_0027761 3300035083 Bacteria 1985
182 Ga0373926_0053714 3300035083 Unclassified 1458
183 Ga0373944_0009160 3300035089 Bacteria 2680
184 Ga0373944_0160107 3300035089 Unclassified 798
185 Ga0373923_0009214 3300035111 Bacteria 3555
186 Ga0373923_0117764 3300035111 Bacteria 1184
187 Ga0373936_0000633 3300035113 Bacteria 12135
188 Ga0373936_0200223 3300035113 Bacteria 881
189 Ga0373945_0001385 3300035116 Bacteria 7361
190 Ga0373945_0010568 3300035116 Bacteria 3042
191 Ga0373953_0161961 3300035117 Bacteria 962
192 Ga0373954_0007479 3300035118 Bacteria 4780
193 Ga0373954_0249968 3300035118 Bacteria 873
194 Ga0373956_0035597 3300035119 Bacteria 2196
195 Ga0373956_0042143 3300035119 Bacteria 2029
196 Ga0373956_0206554 3300035119 Bacteria 931
197 Ga0373957_0005694 3300035120 Bacteria 3878
198 Ga0373943_0000037 3300035170 Bacteria 45150
199 Ga0373943_0059852 3300035170 Bacteria 1899
200 Ga0373946_0001083 3300035171 Bacteria 9387
201 Ga0373946_0054306 3300035171 Bacteria 1685
202 Ga0373946_0080336 3300035171 Bacteria 1426
203 Ga0373955_0029578 3300035172 Bacteria 2850
204 Ga0373955_0119935 3300035172 Bacteria 1528
205 Ga0373924_0000275 3300035410 Bacteria 15798
206 Ga0373935_0009168 3300035692 Bacteria 5921
207 Ga0373935_0020248 3300035692 Bacteria 4063
208 Ga0373935_0049252 3300035692 Bacteria 2670
209 Ga0373927_0000588 3300035695 Bacteria 27700
210 Ga0373927_0053717 3300035695 Bacteria 2606
211 Ga0373927_0057821 3300035695 Bacteria 2508
212 Ga0373927_0057868 3300035695 Bacteria 2506
213 Ga0373927_0188596 3300035695 Bacteria 1353
214 Ga0373927_0225208 3300035695 Unclassified 1232
215 Ga0373933_0034336 3300035724 Bacteria 2955
216 Ga0373933_0194575 3300035724 Bacteria 1296
217 Ga0373933_0482429 3300035724 Bacteria 812
218 Ga0373947_0000500 3300035725 Bacteria 22709
219 Ga0373947_0045144 3300035725 Bacteria 2636
220 Ga0373947_0119122 3300035725 Bacteria 1675
221 Ga0373947_0151032 3300035725 Bacteria 1496
222 Ga0373947_0221382 3300035725 Bacteria 1244
223 Ga0373947_0420228 3300035725 Bacteria 903
224 Ga0373937_0014137 3300036401 Bacteria 7039
225 Ga0373937_0046754 3300036401 Bacteria 3958
226 Ga0373937_0288782 3300036401 Bacteria 1549
227 Ga0373925_0002017 3300037068 Bacteria 16814
228 Ga0373925_0002957 3300037068 Bacteria 13417
229 Ga0373925_0109976 3300037068 Bacteria 2127
230 Ga0373925_0254682 3300037068 Bacteria 1408
231 Ga0373925_0601541 3300037068 Bacteria 905
232 Ga0373925_0892579 3300037068 Bacteria 733
233 Ga0395898_0482109 3300037466 Bacteria 1180
234 Ga0395898_0879426 3300037466 Unclassified 835
235 Ga0436364_0685345 3300037853 Unclassified 1628
236 Ga0466963_0016392 3300044694 Bacteria 4608
237 Ga0466957_0000211 3300044842 Bacteria 27323
238 Ga0466958_0093546 3300045836 Bacteria 1862
239 Ga0466967_0028425 3300045976 Bacteria 4667
240 Ga0466967_0057188 3300045976 Bacteria 3442
241 Ga0495651_0045709 3300046462 Bacteria 3392
242 Ga0495651_0118684 3300046462 Bacteria 1946
243 Ga0495653_0467328 3300046463 Bacteria 791
244 Ga0495580_0012339 3300046472 Bacteria 6556
245 Ga0495580_0183683 3300046472 Bacteria 1444
246 Ga0495580_0253486 3300046472 Bacteria 1204
247 Ga0495580_0558768 3300046472 Bacteria 759
248 Ga0495582_0021283 3300046473 Bacteria 3549
249 Ga0495639_0030106 3300046475 Bacteria 2412
250 Ga0495664_0010894 3300046477 Bacteria 5113
251 Ga0495594_0061512 3300046499 Bacteria 2078
252 Ga0495628_0022514 3300046516 Bacteria 5177
253 Ga0495630_0173145 3300046517 Bacteria 1645
254 Ga0495666_0035092 3300046526 Bacteria 2446
255 Ga0495652_0187130 3300046529 Bacteria 1583
256 Ga0495665_0060748 3300046531 Bacteria 1995
257 Ga0495665_0246537 3300046531 Bacteria 920
258 Ga0495667_0041207 3300046559 Bacteria 3063
259 Ga0495635_0088033 3300046663 Bacteria 2125
260 Ga0495658_0084200 3300046683 Bacteria 1872
261 Ga0495658_0160871 3300046683 Bacteria 1384
262 Ga0495581_0050536 3300047315 Bacteria 2401
263 Ga0495581_0119531 3300047315 Bacteria 1533
264 Ga0495674_0603996 3300047319 Bacteria 869
265 Ga0495680_0235761 3300047322 Bacteria 1301
266 Ga0495684_0231426 3300047471 Bacteria 1351
267 Ga0495593_0061274 3300047673 Bacteria 1968
268 Ga0495602_0233545 3300048088 Unclassified 1380
269 Ga0495602_0242667 3300048088 Bacteria 1347
270 Ga0495602_0531804 3300048088 Unclassified 817
271 Ga0496102_0278637 3300048905 Bacteria 1576
272 Ga0496102_0321246 3300048905 Bacteria 1458
273 Ga0496103_0030367 3300048906 Bacteria 3289
274 Ga0496104_0071248 3300048907 Bacteria 3305
275 Ga0496104_0252540 3300048907 Bacteria 1676
276 Ga0496105_0009596 3300048908 Bacteria 7574
277 Ga0496111_0007434 3300048914 Bacteria 7179
278 Ga0496112_0003090 3300048915 Bacteria 13641
279 Ga0496112_0034612 3300048915 Bacteria 4916
280 Ga0496113_0029345 3300048916 Bacteria 3970
281 Ga0496115_0151930 3300048918 Bacteria 1912
282 nmdc:mga08x19_199533_c1 3300050514 Bacteria 1371
283 Ga0495612_0270155 3300053078 Unclassified 759
284 Ga0587066_018127 3300059490 Bacteria 1130
285 Ga0587066_052551 3300059490 Unclassified 807
286 Ga0587070_048266 3300059491 Bacteria 841
287 Ga0587077_033345 3300059493 Bacteria 995
288 Ga0587083_0024661 3300059505 Bacteria 1146
289 Ga0587083_0050055 3300059505 Bacteria 908
290 Ga0587067_016862 3300059640 Bacteria 1205
291 Ga0587069_013833 3300059642 Bacteria 1116
292 Ga0587076_020877 3300059645 Bacteria 1079
293 Ga0466959_0044138
294 Ga0058863_10073722
295 Ga0058861_10097013
296 Ga0065715_10003717
297 Ga0070680_100035734
298 Ga0070680_100050587
299 Ga0070680_100298661
300 Ga0070682_100129707
301 Ga0070687_100001672
302 Ga0070692_10092719
303 Ga0070709_10181815
304 Ga0070714_100000031
305 Ga0070714_100032761
306 Ga0070714_100780540
307 Ga0070714_101246956
308 Ga0070713_100001574
309 Ga0070713_100002775
310 Ga0070713_100004242
311 Ga0070713_100026872
312 Ga0070713_100044543
313 Ga0070713_100180123
314 Ga0070713_100304768
315 Ga0070713_100352618
316 Ga0070710_10095518
317 Ga0070710_10160090
318 Ga0070711_100008970
319 Ga0070711_100019872
320 Ga0070711_100029650
321 Ga0070711_100577862
322 Ga0070708_100003340
323 Ga0070708_100017023
324 Ga0070708_100327605
325 Ga0070708_100496304
326 Ga0070681_10004893
327 Ga0070681_10129895
328 Ga0070681_10274682
329 Ga0070706_100041055
330 Ga0070706_100224370
331 Ga0070707_100102563
332 Ga0070707_100475452
333 Ga0070699_100020126
334 Ga0070679_100006981
335 Ga0070679_100007054
336 Ga0070679_100012586
337 Ga0070684_100036678
338 Ga0068853_100245616
339 Ga0070693_100056125
340 Ga0068855_100059810
341 Ga0068855_100074691
342 Ga0068855_100337203
343 Ga0068854_100025155
344 Ga0068856_100000410
345 Ga0068856_100512170
346 Ga0068852_100025109
347 Ga0068852_100030012
348 Ga0068852_100099382
349 Ga0068866_10006316
350 Ga0070717_10008634
351 Ga0070717_10010308
352 Ga0070717_10013932
353 Ga0070717_10024454
354 Ga0070717_10034415
355 Ga0070717_10049453
356 Ga0070717_10120046
357 Ga0070717_10141166
358 Ga0070717_10179835
359 Ga0070717_10227275
360 Ga0070717_10245965
361 Ga0070717_10553785
362 Ga0070715_10175378
363 Ga0070716_100173579
364 Ga0070716_100219257
365 Ga0070716_100485677
366 Ga0070712_100001771
367 Ga0070712_100003621
368 Ga0075434_100803269
369 Ga0068865_100012955
370 Ga0075436_100241001
371 Ga0105240_10095763
372 Ga0105242_10834282
373 Ga0105237_10031400
374 Ga0105237_10170475
375 Ga0105238_10054347
376 Ga0105238_10165170
377 Ga0157373_10039785
378 Ga0157373_10101401
379 Ga0157370_10103287
380 Ga0157370_10188164
381 Ga0157369_10030947
382 Ga0157369_10086211
383 Ga0157369_10126899
384 Ga0157369_10200044
385 Ga0157369_10267799
386 Ga0157374_10234975
387 Ga0157374_10277663
388 Ga0163162_10693830
389 Ga0157372_10111651
390 Ga0157372_10113447
391 Ga0157372_10159437
392 Ga0157372_10220692
393 Ga0157376_10005780
394 Ga0206352_10278597
395 Ga0224712_10036292
396 Ga0224712_10053698
397 Ga0207682_10005060
398 Ga0207692_10122725
399 Ga0207692_10225569
400 Ga0207642_10206939
401 Ga0207685_10151123
402 Ga0207699_10016058
403 Ga0207699_10508374
404 Ga0207684_10033009
405 Ga0207684_10182444
406 Ga0207654_10368727
407 Ga0207707_10114385
408 Ga0207707_10261551
409 Ga0207707_10320236
410 Ga0207695_10028981
411 Ga0207695_10330232
412 Ga0207671_10251053
413 Ga0207693_10009111
414 Ga0207693_10016931
415 Ga0207693_10109736
416 Ga0207663_10038544
417 Ga0207663_10044185
418 Ga0207663_10219622
419 Ga0207660_10003975
420 Ga0207660_10134744
421 Ga0207660_10855461
422 Ga0207652_10017488
423 Ga0207652_10184789
424 Ga0207652_10372916
425 Ga0207652_10890832
426 Ga0207646_10402873
427 Ga0207694_10152294
428 Ga0207694_10246717
429 Ga0207687_10006392
430 Ga0207687_10093033
431 Ga0207700_10003638
432 Ga0207700_10003942
433 Ga0207700_10006793
434 Ga0207700_10019216
435 Ga0207700_10021093
436 Ga0207700_10258511
437 Ga0207700_10270473
438 Ga0207664_10000045
439 Ga0207664_10023009
440 Ga0207664_10036959
441 Ga0207664_10090866
442 Ga0207664_10135515
443 Ga0207665_10074372
444 Ga0207665_10226378
445 Ga0207661_10188826
446 Ga0207667_10073216
447 Ga0207667_10427915
448 Ga0207667_10432627
449 Ga0207667_10589182
450 Ga0207640_10032032
451 Ga0207640_10096248
452 Ga0207640_10126198
453 Ga0207677_10023171
454 Ga0207639_10038421
455 Ga0207639_10562237
456 Ga0207702_10000932
457 Ga0207702_10065213
458 Ga0207698_10306701
459 Ga0207698_10671978
460 Ga0265356_1000750
461 Ga0265357_1001308
462 Ga0265355_1005691
463 Ga0265338_10009412
464 Ga0265338_10035442
465 Ga0265760_10000370
466 Ga0265760_10135294
467 Ga0265325_10031981
468 Ga0265339_10030929
469 Ga0265339_10049076
470 Ga0265339_10087886
471 Ga0265314_10109331
472 Ga0373926_0019301
473 Ga0373926_0027761
474 Ga0373926_0053714
475 Ga0373944_0009160
476 Ga0373944_0160107
477 Ga0373923_0009214
478 Ga0373923_0117764
479 Ga0373936_0000633
480 Ga0373936_0200223
481 Ga0373945_0001385
482 Ga0373945_0010568
483 Ga0373953_0161961
484 Ga0373954_0007479
485 Ga0373954_0249968
486 Ga0373956_0035597
487 Ga0373956_0042143
488 Ga0373956_0206554
489 Ga0373957_0005694
490 Ga0373943_0000037
491 Ga0373943_0059852
492 Ga0373946_0001083
493 Ga0373946_0054306
494 Ga0373946_0080336
495 Ga0373955_0029578
496 Ga0373955_0119935
497 Ga0373924_0000275
498 Ga0373935_0009168
499 Ga0373935_0020248
500 Ga0373935_0049252
501 Ga0373927_0000588
502 Ga0373927_0053717
503 Ga0373927_0057821
504 Ga0373927_0057868
505 Ga0373927_0188596
506 Ga0373927_0225208
507 Ga0373933_0034336
508 Ga0373933_0194575
509 Ga0373933_0482429
510 Ga0373947_0000500
511 Ga0373947_0045144
512 Ga0373947_0119122
513 Ga0373947_0151032
514 Ga0373947_0221382
515 Ga0373947_0420228
516 Ga0373937_0014137
517 Ga0373937_0046754
518 Ga0373937_0288782
519 Ga0373925_0002017
520 Ga0373925_0002957
521 Ga0373925_0109976
522 Ga0373925_0254682
523 Ga0373925_0601541
524 Ga0373925_0892579
525 Ga0395898_0482109
526 Ga0395898_0879426
527 Ga0436364_0685345
528 Ga0466963_0016392
529 Ga0466957_0000211
530 Ga0466958_0093546
531 Ga0466967_0028425
532 Ga0466967_0057188
533 Ga0495651_0045709
534 Ga0495651_0118684
535 Ga0495653_0467328
536 Ga0495580_0012339
537 Ga0495580_0183683
538 Ga0495580_0253486
539 Ga0495580_0558768
540 Ga0495582_0021283
541 Ga0495639_0030106
542 Ga0495664_0010894
543 Ga0495594_0061512
544 Ga0495628_0022514
545 Ga0495630_0173145
546 Ga0495666_0035092
547 Ga0495652_0187130
548 Ga0495665_0060748
549 Ga0495665_0246537
550 Ga0495667_0041207
551 Ga0495635_0088033
552 Ga0495658_0084200
553 Ga0495658_0160871
554 Ga0495581_0050536
555 Ga0495581_0119531
556 Ga0495674_0603996
557 Ga0495680_0235761
558 Ga0495684_0231426
559 Ga0495593_0061274
560 Ga0495602_0233545
561 Ga0495602_0242667
562 Ga0495602_0531804
563 Ga0496102_0278637
564 Ga0496102_0321246
565 Ga0496103_0030367
566 Ga0496104_0071248
567 Ga0496104_0252540
568 Ga0496105_0009596
569 Ga0496111_0007434
570 Ga0496112_0003090
571 Ga0496112_0034612
572 Ga0496113_0029345
573 Ga0496115_0151930
574 nmdc:mga08x19_199533_c1
575 Ga0495612_0270155
576 Ga0587066_018127
577 Ga0587066_052551
578 Ga0587070_048266
579 Ga0587077_033345
580 Ga0587083_0024661
581 Ga0587083_0050055
582 Ga0587067_016862
583 Ga0587069_013833
584 Ga0587076_020877

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01794

Ferric_reduct

Ferric reductase like transmembrane component

48

163

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4g80-assembly1.cif.gz_S crystal structure of voltage sensing domain of ci-vsp with fragment antibody (wt, 3.8 a) 0.6811 33 166
4g80-assembly4.cif.gz_I crystal structure of voltage sensing domain of ci-vsp with fragment antibody (wt, 3.8 a) 0.6468 33 172
4g80-assembly1.cif.gz_S crystal structure of voltage sensing domain of ci-vsp with fragment antibody (wt, 3.8 a) 0.6465 33 166
8ucd-assembly1.cif.gz_C cryo-em structure of human steap1 in complex with amg 509 fab 0.6312 12 195
5o0t-assembly1.cif.gz_A crystal structure of trans-membrane domain of cylindrospermum stagnale nadph-oxidase 5 (nox5) 0.6258 7 191
ID Description Score Start End Superfamily
af_P76343_47_161_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.928 49 161 1.20.950.20
af_P76343_47_161_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.9049 49 161 1.20.950.20
af_A0A1D8PTC0_292_402_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.7479 53 160 1.20.950.20
af_Q59PA1_273_390_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.7167 49 162 1.20.950.20
af_A0A1D8PTC0_292_402_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.713 53 160 1.20.950.20
ID Description Score Start End GO Terms
AF-A0A321LHP4-F1-model_v4 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ (Flavocytochrome MsrQ) 0.9842 10 211 GO:0005886
GO:0009055
GO:0010181
GO:0016679
GO:0020037
GO:0030091
GO:0046872
AF-A0A7C4G328-F1-model_v4 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ (Flavocytochrome MsrQ) 0.9835 10 200 GO:0005886
GO:0009055
GO:0010181
GO:0016679
GO:0020037
GO:0030091
GO:0046872
AF-A0A7Y5LHR2-F1-model_v4 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ (Flavocytochrome MsrQ) 0.9812 13 194 GO:0005886
GO:0009055
GO:0010181
GO:0016679
GO:0020037
GO:0030091
GO:0046872
AF-A0A4R1B7T0-F1-model_v4 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ (Flavocytochrome MsrQ) 0.9805 13 195 GO:0005886
GO:0009055
GO:0010181
GO:0016679
GO:0020037
GO:0030091
GO:0046872
AF-A0A3S0W830-F1-model_v4 Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ (Flavocytochrome MsrQ) 0.9805 13 195 GO:0005886
GO:0009055
GO:0010181
GO:0016679
GO:0020037
GO:0030091
GO:0046872

Map