F390859

General Info

Members Datasets Scaffolds Average Seq Length
292 172 584 231

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100036091|Ga0075431_1000360913
Length 230
Sequence MQIGALGDIHGAFDTVEELMTRHPDVPLWVQVGDIASNEGTYFTPSRPLYWIKGNNEDFDVVAASIGGHPPAPTLHYLSNGGPHQVGPWRVAALGGTFAPSWYHTPAAALPPSRGRRGSASLKLGKSRDDKRRHFVREEVYACKALNGIDLFMTHEAPRPFYPAGRRIDAGKTVINEVIASMRPRLHLFGHHHEFTDSVRQGVRSIGLDIVTKSYLLIDAETFRCERLDT

Samples

Sample ID Description Type Environment
1 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
115 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
116 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
117 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
118 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
119 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
120 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
121 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
122 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
123 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
124 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
125 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
128 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
129 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
130 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
131 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
132 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
135 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
136 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
137 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
138 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
139 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
140 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
141 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
142 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
143 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
144 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
145 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
146 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
147 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
148 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
149 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
150 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
151 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
152 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
153 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
154 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
157 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
158 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
159 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
163 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
164 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
165 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
166 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
167 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
168 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
169 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
170 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
171 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
172 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.08
Rhizosphere 96.92
Stem 0
Stem Tuber 0
Unclassified 12.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075431_100036091 3300006847 Bacteria 5092
2 JGI24751J29686_10000856 3300002459 Bacteria 7022
3 Ga0070676_10135858 3300005328 Bacteria 1560
4 Ga0070670_100102187 3300005331 Bacteria 2469
5 Ga0070670_100238290 3300005331 Bacteria 1584
6 Ga0070677_10009041 3300005333 Bacteria 3371
7 Ga0070677_10102371 3300005333 Bacteria 1265
8 Ga0068869_100173034 3300005334 Bacteria 1688
9 Ga0070680_100268052 3300005336 Bacteria 1446
10 Ga0068868_100155370 3300005338 Bacteria 1886
11 Ga0070660_100017155 3300005339 Bacteria 5272
12 Ga0070660_100121906 3300005339 Unclassified 2081
13 Ga0070661_100228313 3300005344 Unclassified 1430
14 Ga0070661_100286105 3300005344 Bacteria 1280
15 Ga0070669_100505933 3300005353 Unclassified 1002
16 Ga0070674_100161813 3300005356 Bacteria 1699
17 Ga0070673_100048075 3300005364 Bacteria 3323
18 Ga0070673_100078824 3300005364 Bacteria 2666
19 Ga0070688_100069731 3300005365 Bacteria 2246
20 Ga0070659_100044575 3300005366 Bacteria 3473
21 Ga0070667_100045749 3300005367 Bacteria 3680
22 Ga0070714_100013421 3300005435 Bacteria 6565
23 Ga0070713_100048250 3300005436 Bacteria 3505
24 Ga0070700_100568022 3300005441 Bacteria 884
25 Ga0070708_100227541 3300005445 Bacteria 1750
26 Ga0070708_100296346 3300005445 Bacteria 1523
27 Ga0070678_100008337 3300005456 Bacteria 6205
28 Ga0070681_10050161 3300005458 Bacteria 4165
29 Ga0068867_100370962 3300005459 Bacteria 1200
30 Ga0070707_100158729 3300005468 Bacteria 2203
31 Ga0070707_100276056 3300005468 Bacteria 1634
32 Ga0070707_100279086 3300005468 Bacteria 1624
33 Ga0070698_100029533 3300005471 Bacteria 5692
34 Ga0070699_100034683 3300005518 Bacteria 4361
35 Ga0070699_100038901 3300005518 Bacteria 4118
36 Ga0070679_100227154 3300005530 Unclassified 1826
37 Ga0070679_100428022 3300005530 Bacteria 1269
38 Ga0070697_100008835 3300005536 Bacteria 7861
39 Ga0070697_100180741 3300005536 Unclassified 1788
40 Ga0070697_100332605 3300005536 Bacteria 1310
41 Ga0070672_100007337 3300005543 Bacteria 7476
42 Ga0070672_100417517 3300005543 Unclassified 1152
43 Ga0070686_100098003 3300005544 Bacteria 1975
44 Ga0070695_100008367 3300005545 Bacteria 6138
45 Ga0070696_100381399 3300005546 Bacteria 1099
46 Ga0070696_100426092 3300005546 Bacteria 1043
47 Ga0070665_100046500 3300005548 Bacteria 4359
48 Ga0070665_100191500 3300005548 Bacteria 2046
49 Ga0070704_100022355 3300005549 Bacteria 4114
50 Ga0068855_100005177 3300005563 Bacteria 15904
51 Ga0070702_100152084 3300005615 Bacteria 1487
52 Ga0068859_100018610 3300005617 Bacteria 6982
53 Ga0068859_100207423 3300005617 Bacteria 2045
54 Ga0068859_100247456 3300005617 Unclassified 1873
55 Ga0068859_100496521 3300005617 Bacteria 1315
56 Ga0068864_100004403 3300005618 Bacteria 11565
57 Ga0068861_100081132 3300005719 Bacteria 2539
58 Ga0068861_100217215 3300005719 Bacteria 1614
59 Ga0068863_100004415 3300005841 Bacteria 13870
60 Ga0068863_100258991 3300005841 Bacteria 1681
61 Ga0068858_100001751 3300005842 Bacteria 22129
62 Ga0068858_100181131 3300005842 Bacteria 1990
63 Ga0068858_100435048 3300005842 Bacteria 1263
64 Ga0068860_100106282 3300005843 Bacteria 2681
65 Ga0068860_100335952 3300005843 Bacteria 1485
66 Ga0068862_100035797 3300005844 Bacteria 4206
67 Ga0068862_100109724 3300005844 Bacteria 2421
68 Ga0081455_10312667 3300005937 Bacteria 1122
69 Ga0070716_100319162 3300006173 Bacteria 1088
70 Ga0097621_100094178 3300006237 Bacteria 2511
71 Ga0097621_100307103 3300006237 Unclassified 1402
72 Ga0097621_100467635 3300006237 Bacteria 1138
73 Ga0068871_100150351 3300006358 Bacteria 1985
74 Ga0068871_100151045 3300006358 Bacteria 1981
75 Ga0068871_100330787 3300006358 Bacteria 1344
76 Ga0068871_100668226 3300006358 Unclassified 950
77 Ga0075428_100110369 3300006844 Bacteria 2996
78 Ga0075428_100789167 3300006844 Bacteria 1010
79 Ga0075433_10050828 3300006852 Bacteria 3609
80 Ga0075433_10565840 3300006852 Bacteria 999
81 Ga0075434_100018819 3300006871 Bacteria 6675
82 Ga0075434_100318436 3300006871 Bacteria 1576
83 Ga0075434_100355936 3300006871 Bacteria 1485
84 Ga0075429_100517430 3300006880 Bacteria 1046
85 Ga0068865_100025311 3300006881 Bacteria 3902
86 Ga0068865_100438963 3300006881 Bacteria 1077
87 Ga0075436_100011747 3300006914 Bacteria 6012
88 Ga0075436_100025091 3300006914 Bacteria 4099
89 Ga0075436_100063311 3300006914 Bacteria 2557
90 Ga0097620_100018610 3300006931 Bacteria 6982
91 Ga0097620_100207421 3300006931 Bacteria 2045
92 Ga0097620_100247443 3300006931 Unclassified 1873
93 Ga0097620_100496527 3300006931 Bacteria 1315
94 Ga0075435_100253127 3300007076 Bacteria 1499
95 Ga0105240_10129706 3300009093 Bacteria 3026
96 Ga0111539_10001132 3300009094 Bacteria 35254
97 Ga0111539_10112308 3300009094 Bacteria 3197
98 Ga0111539_10120499 3300009094 Bacteria 3074
99 Ga0111539_10336970 3300009094 Bacteria 1756
100 Ga0105245_10011261 3300009098 Bacteria 7787
101 Ga0105247_10015641 3300009101 Bacteria 4542
102 Ga0105247_10234050 3300009101 Bacteria 1249
103 Ga0114129_10001751 3300009147 Bacteria 29559
104 Ga0114129_10005947 3300009147 Bacteria 17271
105 Ga0114129_10096863 3300009147 Bacteria 4084
106 Ga0114129_10177398 3300009147 Bacteria 2901
107 Ga0114129_10337640 3300009147 Bacteria 1999
108 Ga0114129_10427020 3300009147 Unclassified 1742
109 Ga0105243_10304014 3300009148 Bacteria 1447
110 Ga0105243_11315461 3300009148 Unclassified 740
111 Ga0105242_10019085 3300009176 Bacteria 5371
112 Ga0105242_10459070 3300009176 Bacteria 1202
113 Ga0105248_10008294 3300009177 Bacteria 11413
114 Ga0105248_10046583 3300009177 Bacteria 4860
115 Ga0105248_10081854 3300009177 Bacteria 3629
116 Ga0105248_10121305 3300009177 Bacteria 2949
117 Ga0105248_10411273 3300009177 Bacteria 1523
118 Ga0105248_10654788 3300009177 Bacteria 1185
119 Ga0105248_10866464 3300009177 Unclassified 1020
120 Ga0105237_10263871 3300009545 Unclassified 1725
121 Ga0105238_10011787 3300009551 Bacteria 8811
122 Ga0105238_10177363 3300009551 Bacteria 2108
123 Ga0105249_10517750 3300009553 Bacteria 1240
124 Ga0105249_10658818 3300009553 Bacteria 1105
125 Ga0157378_10028517 3300013297 Bacteria 4927
126 Ga0157378_10115165 3300013297 Bacteria 2470
127 Ga0157378_10332591 3300013297 Bacteria 1479
128 Ga0157378_10811583 3300013297 Bacteria 962
129 Ga0157375_10077525 3300013308 Bacteria 3354
130 Ga0157375_10487325 3300013308 Bacteria 1398
131 Ga0163163_10352122 3300014325 Bacteria 1529
132 Ga0157380_10124645 3300014326 Bacteria 2188
133 Ga0157380_10166333 3300014326 Bacteria 1922
134 Ga0157380_10547097 3300014326 Bacteria 1135
135 Ga0157377_10106647 3300014745 Bacteria 1678
136 Ga0157379_10017606 3300014968 Bacteria 6291
137 Ga0157379_10168957 3300014968 Bacteria 1974
138 Ga0157379_10206527 3300014968 Bacteria 1777
139 Ga0157376_10031519 3300014969 Bacteria 4247
140 Ga0157376_10107280 3300014969 Bacteria 2451
141 Ga0207656_10134964 3300025321 Bacteria 1159
142 Ga0207682_10037319 3300025893 Bacteria 1968
143 Ga0207642_10112270 3300025899 Unclassified 1390
144 Ga0207710_10017759 3300025900 Bacteria 3019
145 Ga0207680_10151491 3300025903 Bacteria 1546
146 Ga0207699_10509437 3300025906 Unclassified 869
147 Ga0207705_10606050 3300025909 Bacteria 851
148 Ga0207707_10008784 3300025912 Bacteria 8769
149 Ga0207707_10057133 3300025912 Bacteria 3396
150 Ga0207695_10314493 3300025913 Bacteria 1456
151 Ga0207657_10002928 3300025919 Bacteria 18323
152 Ga0207657_10044122 3300025919 Bacteria 3922
153 Ga0207649_10233834 3300025920 Unclassified 1316
154 Ga0207652_10178124 3300025921 Unclassified 1910
155 Ga0207652_10183161 3300025921 Bacteria 1883
156 Ga0207652_10302894 3300025921 Bacteria 1443
157 Ga0207646_10084527 3300025922 Bacteria 2840
158 Ga0207646_10466231 3300025922 Bacteria 1139
159 Ga0207681_10087416 3300025923 Bacteria 2218
160 Ga0207650_10045596 3300025925 Bacteria 3225
161 Ga0207650_10139400 3300025925 Bacteria 1905
162 Ga0207650_10207132 3300025925 Bacteria 1574
163 Ga0207700_10040738 3300025928 Bacteria 3392
164 Ga0207664_10008024 3300025929 Bacteria 7341
165 Ga0207690_10038262 3300025932 Bacteria 3120
166 Ga0207709_10731217 3300025935 Bacteria 794
167 Ga0207669_10180635 3300025937 Bacteria 1512
168 Ga0207704_10017216 3300025938 Bacteria 3739
169 Ga0207665_10207731 3300025939 Bacteria 1429
170 Ga0207691_10124832 3300025940 Bacteria 2278
171 Ga0207711_10019874 3300025941 Bacteria 5597
172 Ga0207711_10105727 3300025941 Bacteria 2496
173 Ga0207711_10107467 3300025941 Bacteria 2477
174 Ga0207711_10287723 3300025941 Bacteria 1514
175 Ga0207689_10062663 3300025942 Bacteria 3058
176 Ga0207661_10441757 3300025944 Bacteria 1184
177 Ga0207651_10068980 3300025960 Bacteria 2495
178 Ga0207658_10031321 3300025986 Bacteria 3775
179 Ga0207703_10002125 3300026035 Bacteria 17428
180 Ga0207703_10033687 3300026035 Unclassified 4063
181 Ga0207703_10081800 3300026035 Bacteria 2693
182 Ga0207703_10615515 3300026035 Bacteria 1028
183 Ga0207678_10519184 3300026067 Unclassified 1039
184 Ga0207708_10108069 3300026075 Bacteria 2157
185 Ga0207641_10000667 3300026088 Bacteria 37425
186 Ga0207641_10099595 3300026088 Bacteria 2558
187 Ga0207648_10042827 3300026089 Bacteria 3975
188 Ga0207648_10054319 3300026089 Bacteria 3499
189 Ga0207676_10053129 3300026095 Bacteria 3170
190 Ga0207675_100047397 3300026118 Bacteria 4012
191 Ga0207675_100105726 3300026118 Bacteria 2653
192 Ga0207683_10341516 3300026121 Bacteria 1373
193 Ga0207428_10009844 3300027907 Bacteria 8562
194 Ga0207428_10046277 3300027907 Bacteria 3499
195 Ga0207428_10103938 3300027907 Bacteria 2192
196 Ga0268266_10009242 3300028379 Bacteria 8694
197 Ga0268266_10027219 3300028379 Bacteria 4864
198 Ga0268265_10013417 3300028380 Bacteria 5568
199 Ga0268264_10044754 3300028381 Bacteria 3673
200 Ga0268264_10412828 3300028381 Bacteria 1300
201 Ga0265332_10028652 3300031238 Bacteria 2436
202 Ga0307412_10505525 3300031911 Unclassified 1007
203 Ga0373939_0112640 3300035114 Unclassified 949
204 Ga0373941_0074672 3300035115 Bacteria 1133
205 Ga0373954_0073601 3300035118 Bacteria 1626
206 Ga0373956_0077900 3300035119 Bacteria 1518
207 Ga0373943_0003044 3300035170 Bacteria 7617
208 Ga0373946_0004691 3300035171 Bacteria 4909
209 Ga0373955_0148058 3300035172 Bacteria 1380
210 Ga0373955_0308166 3300035172 Unclassified 955
211 Ga0373924_0035310 3300035410 Unclassified 2027
212 Ga0373924_0237418 3300035410 Unclassified 806
213 Ga0373935_0012031 3300035692 Bacteria 5201
214 Ga0373935_0404558 3300035692 Unclassified 981
215 Ga0373947_0053045 3300035725 Bacteria 2444
216 Ga0373947_0117072 3300035725 Bacteria 1690
217 Ga0373937_0147126 3300036401 Bacteria 2206
218 Ga0373937_0654251 3300036401 Bacteria 996
219 Ga0373925_0015321 3300037068 Bacteria 5545
220 Ga0373925_0198497 3300037068 Unclassified 1595
221 Ga0439434_0180569 3300042435 Bacteria 707
222 Ga0439459_0082565 3300042438 Unclassified 761
223 Ga0450916_000848 3300042530 Bacteria 2876
224 Ga0466963_0405109 3300044694 Unclassified 962
225 Ga0451576_1630382 3300045051 Archaea 669
226 Ga0466967_0242653 3300045976 Bacteria 1719
227 Ga0495592_0053565 3300046454 Bacteria 2992
228 Ga0495592_0138655 3300046454 Bacteria 1694
229 Ga0495651_0207629 3300046462 Bacteria 1366
230 Ga0495651_0244148 3300046462 Unclassified 1230
231 Ga0495653_0296121 3300046463 Bacteria 1057
232 Ga0495580_0529414 3300046472 Unclassified 784
233 Ga0495582_0145632 3300046473 Bacteria 1344
234 Ga0495639_0110952 3300046475 Bacteria 1302
235 Ga0495639_0218727 3300046475 Archaea 936
236 Ga0495630_0033704 3300046517 Bacteria 3820
237 Ga0495586_0128596 3300046535 Bacteria 1418
238 Ga0495587_0038631 3300046536 Bacteria 2861
239 Ga0495645_0191460 3300046543 Bacteria 1393
240 Ga0495657_0173228 3300046675 Unclassified 1328
241 Ga0495657_0208416 3300046675 Bacteria 1189
242 Ga0495647_0046087 3300046681 Bacteria 1678
243 Ga0495658_0060470 3300046683 Bacteria 2173
244 Ga0495658_0188706 3300046683 Bacteria 1281
245 Ga0495658_0193038 3300046683 Unclassified 1267
246 Ga0495669_0000683 3300046684 Bacteria 14786
247 Ga0495604_0058046 3300047317 Bacteria 2973
248 Ga0495604_0437775 3300047317 Bacteria 856
249 Ga0495674_0011154 3300047319 Bacteria 8484
250 Ga0495680_0483683 3300047322 Bacteria 843
251 Ga0495684_0000226 3300047471 Bacteria 44097
252 Ga0495602_0475825 3300048088 Bacteria 877
253 Ga0496100_0036166 3300048903 Bacteria 3112
254 Ga0496100_0134087 3300048903 Bacteria 1748
255 Ga0496101_0001396 3300048904 Bacteria 14449
256 Ga0496104_0101272 3300048907 Bacteria 2758
257 Ga0496108_0370645 3300048911 Bacteria 1250
258 Ga0496108_0469935 3300048911 Bacteria 1099
259 Ga0496108_0594879 3300048911 Unclassified 964
260 Ga0496111_0377866 3300048914 Bacteria 1048
261 Ga0496114_0016205 3300048917 Bacteria 6001
262 Ga0501031_0145282 3300049568 Bacteria 1550
263 Ga0501034_0041205 3300049571 Bacteria 4672
264 Ga0501034_0176840 3300049571 Bacteria 2100
265 Ga0501047_0072325 3300049581 Bacteria 3319
266 Ga0501044_0004662 3300049823 Bacteria 15342
267 nmdc:mga05p37_112953_c1 3300050507 Bacteria 3340
268 nmdc:mga05p37_1500_c2 3300050507 Bacteria 23791
269 nmdc:mga05p37_27476_c1 3300050507 Bacteria 6927
270 nmdc:mga05p37_332002_c1 3300050507 Bacteria 1796
271 nmdc:mga05p37_504477_c1 3300050507 Unclassified 1388
272 nmdc:mga05p37_65145_c1 3300050507 Bacteria 4484
273 nmdc:mga06r32_79522_c1 3300050510 Bacteria 3189
274 nmdc:mga08y16_314115_c1 3300050511 Bacteria 1614
275 nmdc:mga08y16_3405_c1 3300050511 Bacteria 16499
276 nmdc:mga08y16_8175_c1 3300050511 Bacteria 10946
277 nmdc:mga0n895_37310_c1 3300050512 Bacteria 4701
278 nmdc:mga0n895_853396_c1 3300050512 Bacteria 898
279 nmdc:mga0n895_985696_c1 3300050512 Bacteria 825
280 nmdc:mga0rr50_45923_c1 3300050513 Bacteria 3214
281 nmdc:mga0rr50_619294_c1 3300050513 Bacteria 923
282 nmdc:mga08x19_106676_c1 3300050514 Bacteria 1864
283 nmdc:mga08x19_197341_c1 3300050514 Bacteria 1379
284 nmdc:mga0a205_210941_c1 3300050515 Bacteria 1830
285 nmdc:mga0a205_47438_c1 3300050515 Bacteria 4145
286 nmdc:mga0a205_633289_c1 3300050515 Bacteria 921
287 Ga0495601_0024894 3300053077 Bacteria 3687
288 Ga0495601_0027119 3300053077 Bacteria 3541
289 Ga0495595_0018924 3300053084 Bacteria 2982
290 Ga0495595_0088852 3300053084 Unclassified 1481
291 Ga0495619_0003775 3300053085 Bacteria 9743
292 Ga0495619_0197694 3300053085 Unclassified 1392
293 Ga0075431_100036091
294 JGI24751J29686_10000856
295 Ga0070676_10135858
296 Ga0070670_100102187
297 Ga0070670_100238290
298 Ga0070677_10009041
299 Ga0070677_10102371
300 Ga0068869_100173034
301 Ga0070680_100268052
302 Ga0068868_100155370
303 Ga0070660_100017155
304 Ga0070660_100121906
305 Ga0070661_100228313
306 Ga0070661_100286105
307 Ga0070669_100505933
308 Ga0070674_100161813
309 Ga0070673_100048075
310 Ga0070673_100078824
311 Ga0070688_100069731
312 Ga0070659_100044575
313 Ga0070667_100045749
314 Ga0070714_100013421
315 Ga0070713_100048250
316 Ga0070700_100568022
317 Ga0070708_100227541
318 Ga0070708_100296346
319 Ga0070678_100008337
320 Ga0070681_10050161
321 Ga0068867_100370962
322 Ga0070707_100158729
323 Ga0070707_100276056
324 Ga0070707_100279086
325 Ga0070698_100029533
326 Ga0070699_100034683
327 Ga0070699_100038901
328 Ga0070679_100227154
329 Ga0070679_100428022
330 Ga0070697_100008835
331 Ga0070697_100180741
332 Ga0070697_100332605
333 Ga0070672_100007337
334 Ga0070672_100417517
335 Ga0070686_100098003
336 Ga0070695_100008367
337 Ga0070696_100381399
338 Ga0070696_100426092
339 Ga0070665_100046500
340 Ga0070665_100191500
341 Ga0070704_100022355
342 Ga0068855_100005177
343 Ga0070702_100152084
344 Ga0068859_100018610
345 Ga0068859_100207423
346 Ga0068859_100247456
347 Ga0068859_100496521
348 Ga0068864_100004403
349 Ga0068861_100081132
350 Ga0068861_100217215
351 Ga0068863_100004415
352 Ga0068863_100258991
353 Ga0068858_100001751
354 Ga0068858_100181131
355 Ga0068858_100435048
356 Ga0068860_100106282
357 Ga0068860_100335952
358 Ga0068862_100035797
359 Ga0068862_100109724
360 Ga0081455_10312667
361 Ga0070716_100319162
362 Ga0097621_100094178
363 Ga0097621_100307103
364 Ga0097621_100467635
365 Ga0068871_100150351
366 Ga0068871_100151045
367 Ga0068871_100330787
368 Ga0068871_100668226
369 Ga0075428_100110369
370 Ga0075428_100789167
371 Ga0075433_10050828
372 Ga0075433_10565840
373 Ga0075434_100018819
374 Ga0075434_100318436
375 Ga0075434_100355936
376 Ga0075429_100517430
377 Ga0068865_100025311
378 Ga0068865_100438963
379 Ga0075436_100011747
380 Ga0075436_100025091
381 Ga0075436_100063311
382 Ga0097620_100018610
383 Ga0097620_100207421
384 Ga0097620_100247443
385 Ga0097620_100496527
386 Ga0075435_100253127
387 Ga0105240_10129706
388 Ga0111539_10001132
389 Ga0111539_10112308
390 Ga0111539_10120499
391 Ga0111539_10336970
392 Ga0105245_10011261
393 Ga0105247_10015641
394 Ga0105247_10234050
395 Ga0114129_10001751
396 Ga0114129_10005947
397 Ga0114129_10096863
398 Ga0114129_10177398
399 Ga0114129_10337640
400 Ga0114129_10427020
401 Ga0105243_10304014
402 Ga0105243_11315461
403 Ga0105242_10019085
404 Ga0105242_10459070
405 Ga0105248_10008294
406 Ga0105248_10046583
407 Ga0105248_10081854
408 Ga0105248_10121305
409 Ga0105248_10411273
410 Ga0105248_10654788
411 Ga0105248_10866464
412 Ga0105237_10263871
413 Ga0105238_10011787
414 Ga0105238_10177363
415 Ga0105249_10517750
416 Ga0105249_10658818
417 Ga0157378_10028517
418 Ga0157378_10115165
419 Ga0157378_10332591
420 Ga0157378_10811583
421 Ga0157375_10077525
422 Ga0157375_10487325
423 Ga0163163_10352122
424 Ga0157380_10124645
425 Ga0157380_10166333
426 Ga0157380_10547097
427 Ga0157377_10106647
428 Ga0157379_10017606
429 Ga0157379_10168957
430 Ga0157379_10206527
431 Ga0157376_10031519
432 Ga0157376_10107280
433 Ga0207656_10134964
434 Ga0207682_10037319
435 Ga0207642_10112270
436 Ga0207710_10017759
437 Ga0207680_10151491
438 Ga0207699_10509437
439 Ga0207705_10606050
440 Ga0207707_10008784
441 Ga0207707_10057133
442 Ga0207695_10314493
443 Ga0207657_10002928
444 Ga0207657_10044122
445 Ga0207649_10233834
446 Ga0207652_10178124
447 Ga0207652_10183161
448 Ga0207652_10302894
449 Ga0207646_10084527
450 Ga0207646_10466231
451 Ga0207681_10087416
452 Ga0207650_10045596
453 Ga0207650_10139400
454 Ga0207650_10207132
455 Ga0207700_10040738
456 Ga0207664_10008024
457 Ga0207690_10038262
458 Ga0207709_10731217
459 Ga0207669_10180635
460 Ga0207704_10017216
461 Ga0207665_10207731
462 Ga0207691_10124832
463 Ga0207711_10019874
464 Ga0207711_10105727
465 Ga0207711_10107467
466 Ga0207711_10287723
467 Ga0207689_10062663
468 Ga0207661_10441757
469 Ga0207651_10068980
470 Ga0207658_10031321
471 Ga0207703_10002125
472 Ga0207703_10033687
473 Ga0207703_10081800
474 Ga0207703_10615515
475 Ga0207678_10519184
476 Ga0207708_10108069
477 Ga0207641_10000667
478 Ga0207641_10099595
479 Ga0207648_10042827
480 Ga0207648_10054319
481 Ga0207676_10053129
482 Ga0207675_100047397
483 Ga0207675_100105726
484 Ga0207683_10341516
485 Ga0207428_10009844
486 Ga0207428_10046277
487 Ga0207428_10103938
488 Ga0268266_10009242
489 Ga0268266_10027219
490 Ga0268265_10013417
491 Ga0268264_10044754
492 Ga0268264_10412828
493 Ga0265332_10028652
494 Ga0307412_10505525
495 Ga0373939_0112640
496 Ga0373941_0074672
497 Ga0373954_0073601
498 Ga0373956_0077900
499 Ga0373943_0003044
500 Ga0373946_0004691
501 Ga0373955_0148058
502 Ga0373955_0308166
503 Ga0373924_0035310
504 Ga0373924_0237418
505 Ga0373935_0012031
506 Ga0373935_0404558
507 Ga0373947_0053045
508 Ga0373947_0117072
509 Ga0373937_0147126
510 Ga0373937_0654251
511 Ga0373925_0015321
512 Ga0373925_0198497
513 Ga0439434_0180569
514 Ga0439459_0082565
515 Ga0450916_000848
516 Ga0466963_0405109
517 Ga0451576_1630382
518 Ga0466967_0242653
519 Ga0495592_0053565
520 Ga0495592_0138655
521 Ga0495651_0207629
522 Ga0495651_0244148
523 Ga0495653_0296121
524 Ga0495580_0529414
525 Ga0495582_0145632
526 Ga0495639_0110952
527 Ga0495639_0218727
528 Ga0495630_0033704
529 Ga0495586_0128596
530 Ga0495587_0038631
531 Ga0495645_0191460
532 Ga0495657_0173228
533 Ga0495657_0208416
534 Ga0495647_0046087
535 Ga0495658_0060470
536 Ga0495658_0188706
537 Ga0495658_0193038
538 Ga0495669_0000683
539 Ga0495604_0058046
540 Ga0495604_0437775
541 Ga0495674_0011154
542 Ga0495680_0483683
543 Ga0495684_0000226
544 Ga0495602_0475825
545 Ga0496100_0036166
546 Ga0496100_0134087
547 Ga0496101_0001396
548 Ga0496104_0101272
549 Ga0496108_0370645
550 Ga0496108_0469935
551 Ga0496108_0594879
552 Ga0496111_0377866
553 Ga0496114_0016205
554 Ga0501031_0145282
555 Ga0501034_0041205
556 Ga0501034_0176840
557 Ga0501047_0072325
558 Ga0501044_0004662
559 nmdc:mga05p37_112953_c1
560 nmdc:mga05p37_1500_c2
561 nmdc:mga05p37_27476_c1
562 nmdc:mga05p37_332002_c1
563 nmdc:mga05p37_504477_c1
564 nmdc:mga05p37_65145_c1
565 nmdc:mga06r32_79522_c1
566 nmdc:mga08y16_314115_c1
567 nmdc:mga08y16_3405_c1
568 nmdc:mga08y16_8175_c1
569 nmdc:mga0n895_37310_c1
570 nmdc:mga0n895_853396_c1
571 nmdc:mga0n895_985696_c1
572 nmdc:mga0rr50_45923_c1
573 nmdc:mga0rr50_619294_c1
574 nmdc:mga08x19_106676_c1
575 nmdc:mga08x19_197341_c1
576 nmdc:mga0a205_210941_c1
577 nmdc:mga0a205_47438_c1
578 nmdc:mga0a205_633289_c1
579 Ga0495601_0024894
580 Ga0495601_0027119
581 Ga0495595_0018924
582 Ga0495595_0088852
583 Ga0495619_0003775
584 Ga0495619_0197694

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12850

Metallophos_2

Calcineurin-like phosphoesterase superfamily domain

1

208

0.86

PF00149

Metallophos

Calcineurin-like phosphoesterase

1

195

0.66

Structural Annotation

Top 5 Hits

ID Description Score Start End
8puw-assembly1.cif.gz_B chaetomium thermophilum las1-grc3-complex 0.7897 171 190
1s3l-assembly1.cif.gz_A structural and functional characterization of a novel archaeal phosphodiesterase 0.6468 1 231
1s3l-assembly1.cif.gz_A structural and functional characterization of a novel archaeal phosphodiesterase 0.6435 1 231
1uf3-assembly1.cif.gz_C crystal structure of tt1561 of thermus thermophilus hb8 0.6409 2 230
2yvt-assembly1.cif.gz_A crystal structure of aq_1956 0.6405 2 230
ID Description Score Start End Superfamily
af_A0A1D6FYR6_710_903_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8042 214 230 2.130.10.10
af_Q9S9V1_53_198_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.7342 214 231 2.120.10.80
af_A0A0R0KVQ3_126_357_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.6668 214 231 2.120.10.80
af_A0A0P0XSB9_128_364_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6586 215 231 2.130.10.10
af_P98161_3112_3226_2.60.60.20 Mainly Beta;Sandwich;Lipoxygenase-1;PLAT/LH2 domain 0.6548 214 231 2.60.60.20
ID Description Score Start End GO Terms
AF-A0A7W0LHS6-F1-model_v4 Metallophosphoesterase 0.8498 134 231
AF-A0A7W0LHS6-F1-model_v4 Metallophosphoesterase 0.8415 134 231
AF-A0A3N5PFW4-F1-model_v4 Metallophosphoesterase 0.827 1 231 GO:0016787
AF-A0A7J4LYB8-F1-model_v4 Metallophosphoesterase 0.8262 142 230
AF-A0A3N5PFW4-F1-model_v4 Metallophosphoesterase 0.8235 1 231 GO:0016787

Map