F390218

General Info

Members Datasets Scaffolds Average Seq Length
291 164 582 461

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10064573|Ga0070681_100645732
Length 521
Sequence LGSTCFDTHSKDHKIQQLTGLIELWILRPELRSRLLLRRSARVILKAMSKNPSHGSAGVQRLAIAIMAAGKGTRLKSKYPKVLHEVGGKPLLAHVIAAGTQVVPPADVYVIIGYESDRVRKAVADTGVRFVLQQPQRGTGHALMCAGKNLAGYDHVIVLSGDAPLISPETIRRLRDFHLQKKAAMTILSAKLEEPTGYGRLIRKTKGDEVAAVVEENSCTPAQRKLREINSGFYAFAVKPLLENLQKLKTDNPHGEYYLTDMASVLGKAKERVVATPTDNPSEILGSNTRAELVDLDRKMRRDKCIELMAEGVTIFYPETCVIDSDVEVGADTTIEPFVQLLGKTHIGTDCRVRSYSVIQNSAIEDGVVIRTGCVLDGTRVAKDAVLGPYSHLRPGSDIGEGAHVGNFVEIKKVRLGKGSKANHLTYLGDADIGAGVNIGAGTITCNYDGVNKYTTTIEDGVFVGSDSTLVAPVRLGKGSYVGAASCITEDVPPQSLALGRSKQIVKEGWAKEKQARQADH

Samples

Sample ID Description Type Environment
1 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
79 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
80 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
81 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
120 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
122 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
123 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
124 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
125 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
126 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
127 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
129 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
130 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
134 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
135 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
136 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
137 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
138 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
139 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
142 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
143 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
144 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
145 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
146 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
147 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
148 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
149 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
150 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
162 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
163 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
164 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.9
Rhizosphere 91.41
Stem 0
Stem Tuber 0
Unclassified 1.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070681_10064573 3300005458 Bacteria 3631
2 Ga0070683_100031998 3300005329 Bacteria 4787
3 Ga0070690_100006782 3300005330 Bacteria 6512
4 Ga0070670_100004747 3300005331 Bacteria 11410
5 Ga0068869_100004218 3300005334 Bacteria 8917
6 Ga0070666_10010790 3300005335 Bacteria 5719
7 Ga0070680_100050411 3300005336 Bacteria 3395
8 Ga0070680_100093970 3300005336 Bacteria 2485
9 Ga0068868_100000628 3300005338 Bacteria 23749
10 Ga0070660_100015581 3300005339 Bacteria 5493
11 Ga0070660_100061906 3300005339 Bacteria 2906
12 Ga0070661_100022951 3300005344 Bacteria 4469
13 Ga0070659_100010808 3300005366 Bacteria 6733
14 Ga0070659_100179464 3300005366 Bacteria 1737
15 Ga0070667_100018917 3300005367 Bacteria 5711
16 Ga0070709_10015254 3300005434 Bacteria 4367
17 Ga0070709_10055094 3300005434 Bacteria 2509
18 Ga0070714_100000720 3300005435 Bacteria 23467
19 Ga0070714_100015390 3300005435 Bacteria 6155
20 Ga0070714_100026065 3300005435 Bacteria 4829
21 Ga0070714_100031369 3300005435 Bacteria 4433
22 Ga0070714_100050458 3300005435 Bacteria 3545
23 Ga0070714_100071436 3300005435 Bacteria 3001
24 Ga0070714_100091641 3300005435 Bacteria 2663
25 Ga0070714_100150309 3300005435 Bacteria 2098
26 Ga0070714_100230222 3300005435 Bacteria 1707
27 Ga0070713_100002097 3300005436 Bacteria 12891
28 Ga0070713_100006081 3300005436 Bacteria 8321
29 Ga0070713_100022611 3300005436 Bacteria 4861
30 Ga0070713_100097812 3300005436 Bacteria 2537
31 Ga0070713_100194734 3300005436 Bacteria 1828
32 Ga0070710_10007362 3300005437 Bacteria 5328
33 Ga0070710_10043138 3300005437 Bacteria 2497
34 Ga0070711_100000623 3300005439 Bacteria 18462
35 Ga0070711_100136962 3300005439 Bacteria 1831
36 Ga0070694_100020426 3300005444 Bacteria 4222
37 Ga0070708_100018605 3300005445 Bacteria 5815
38 Ga0070708_100020532 3300005445 Bacteria 5571
39 Ga0070708_100040008 3300005445 Bacteria 4105
40 Ga0070708_100100261 3300005445 Bacteria 2650
41 Ga0070663_100031909 3300005455 Bacteria 3625
42 Ga0070662_100001509 3300005457 Bacteria 14305
43 Ga0070681_10000506 3300005458 Bacteria 31860
44 Ga0070681_10002815 3300005458 Bacteria 16054
45 Ga0070681_10056421 3300005458 Bacteria 3909
46 Ga0070681_10118090 3300005458 Bacteria 2589
47 Ga0068867_100035860 3300005459 Unclassified 3599
48 Ga0070706_100000454 3300005467 Bacteria 48917
49 Ga0070706_100028333 3300005467 Bacteria 5157
50 Ga0070706_100052403 3300005467 Bacteria 3766
51 Ga0070706_100085433 3300005467 Bacteria 2924
52 Ga0070707_100235180 3300005468 Bacteria 1783
53 Ga0070699_100003496 3300005518 Bacteria 13888
54 Ga0070699_100048467 3300005518 Bacteria 3677
55 Ga0070679_100014489 3300005530 Bacteria 7574
56 Ga0070679_100140052 3300005530 Unclassified 2399
57 Ga0070684_100025140 3300005535 Bacteria 5001
58 Ga0070697_100001523 3300005536 Bacteria 17629
59 Ga0070697_100003194 3300005536 Bacteria 12584
60 Ga0070697_100005012 3300005536 Bacteria 10171
61 Ga0068853_100147197 3300005539 Bacteria 2117
62 Ga0070695_100013438 3300005545 Bacteria 4920
63 Ga0070693_100009042 3300005547 Bacteria 4943
64 Ga0070665_100089306 3300005548 Bacteria 3087
65 Ga0068855_100000212 3300005563 Bacteria 73927
66 Ga0068855_100006540 3300005563 Bacteria 14172
67 Ga0068855_100102628 3300005563 Bacteria 3292
68 Ga0070664_100002091 3300005564 Bacteria 15967
69 Ga0070664_100018900 3300005564 Bacteria 5666
70 Ga0070664_100042255 3300005564 Bacteria 3848
71 Ga0068857_100000164 3300005577 Bacteria 41522
72 Ga0068857_100016915 3300005577 Bacteria 6389
73 Ga0068857_100046747 3300005577 Bacteria 3841
74 Ga0068854_100023354 3300005578 Bacteria 4223
75 Ga0068854_100119663 3300005578 Bacteria 1997
76 Ga0068854_100122987 3300005578 Bacteria 1972
77 Ga0068856_100001677 3300005614 Bacteria 23200
78 Ga0068856_100040595 3300005614 Bacteria 4571
79 Ga0068856_100048394 3300005614 Bacteria 4189
80 Ga0068856_100198519 3300005614 Bacteria 2021
81 Ga0068852_100071849 3300005616 Bacteria 3040
82 Ga0068852_100075681 3300005616 Bacteria 2970
83 Ga0068859_100000780 3300005617 Bacteria 32169
84 Ga0068859_100015249 3300005617 Bacteria 7717
85 Ga0068864_100006501 3300005618 Bacteria 9577
86 Ga0068864_100126154 3300005618 Bacteria 2294
87 Ga0068866_10002395 3300005718 Bacteria 7765
88 Ga0068851_10007945 3300005834 Bacteria 4891
89 Ga0068863_100117773 3300005841 Bacteria 2531
90 Ga0068858_100001038 3300005842 Bacteria 28685
91 Ga0068858_100046025 3300005842 Bacteria 4045
92 Ga0068860_100013116 3300005843 Bacteria 8134
93 Ga0068860_100167308 3300005843 Bacteria 2123
94 Ga0068862_100007880 3300005844 Bacteria 8813
95 Ga0081540_1028552 3300005983 Bacteria 3130
96 Ga0070717_10000272 3300006028 Bacteria 35378
97 Ga0070717_10005108 3300006028 Bacteria 9573
98 Ga0070717_10013249 3300006028 Bacteria 6311
99 Ga0070717_10028882 3300006028 Bacteria 4444
100 Ga0070717_10058623 3300006028 Bacteria 3184
101 Ga0070716_100046743 3300006173 Bacteria 2438
102 Ga0070716_100050763 3300006173 Bacteria 2356
103 Ga0070712_100000952 3300006175 Bacteria 17401
104 Ga0070712_100050843 3300006175 Bacteria 2886
105 Ga0097621_100000314 3300006237 Bacteria 32871
106 Ga0097621_100007716 3300006237 Bacteria 7714
107 Ga0097621_100093245 3300006237 Bacteria 2523
108 Ga0068871_100009452 3300006358 Bacteria 7067
109 Ga0068871_100032919 3300006358 Bacteria 4099
110 Ga0075434_100003959 3300006871 Bacteria 13266
111 Ga0075434_100039922 3300006871 Bacteria 4648
112 Ga0068865_100057940 3300006881 Bacteria 2704
113 Ga0075436_100003222 3300006914 Bacteria 11191
114 Ga0075436_100096397 3300006914 Bacteria 2058
115 Ga0097620_100000780 3300006931 Bacteria 32169
116 Ga0097620_100015248 3300006931 Bacteria 7717
117 Ga0075435_100011997 3300007076 Bacteria 6403
118 Ga0105240_10008664 3300009093 Bacteria 14523
119 Ga0105240_10023147 3300009093 Bacteria 8225
120 Ga0105240_10064458 3300009093 Bacteria 4553
121 Ga0105240_10099200 3300009093 Bacteria 3545
122 Ga0105245_10009192 3300009098 Bacteria 8617
123 Ga0105245_10098815 3300009098 Bacteria 2697
124 Ga0105243_10036830 3300009148 Bacteria 3800
125 Ga0105241_10001302 3300009174 Bacteria 18979
126 Ga0105241_10100531 3300009174 Bacteria 2298
127 Ga0105242_10112965 3300009176 Bacteria 2319
128 Ga0105237_10146507 3300009545 Bacteria 2356
129 Ga0105238_10000064 3300009551 Bacteria 122380
130 Ga0105238_10037684 3300009551 Bacteria 4914
131 Ga0105238_10060285 3300009551 Bacteria 3800
132 Ga0105239_10113189 3300010375 Bacteria 3009
133 Ga0105239_10149004 3300010375 Bacteria 2611
134 Ga0105246_10019784 3300011119 Bacteria 4311
135 Ga0157373_10008148 3300013100 Bacteria 7793
136 Ga0157371_10010976 3300013102 Bacteria 7020
137 Ga0157371_10046815 3300013102 Bacteria 3075
138 Ga0157370_10123509 3300013104 Bacteria 2417
139 Ga0157369_10000522 3300013105 Bacteria 50647
140 Ga0157369_10059214 3300013105 Bacteria 4130
141 Ga0157369_10147146 3300013105 Bacteria 2490
142 Ga0157369_10216278 3300013105 Bacteria 2007
143 Ga0157369_10315135 3300013105 Bacteria 1626
144 Ga0157374_10000245 3300013296 Bacteria 50434
145 Ga0157374_10000577 3300013296 Bacteria 32518
146 Ga0157374_10009924 3300013296 Bacteria 8174
147 Ga0157378_10000172 3300013297 Bacteria 61182
148 Ga0157378_10037586 3300013297 Bacteria 4289
149 Ga0163162_10001366 3300013306 Bacteria 22706
150 Ga0163162_10004521 3300013306 Bacteria 13394
151 Ga0157372_10000450 3300013307 Bacteria 45152
152 Ga0157372_10003823 3300013307 Bacteria 16183
153 Ga0157372_10011617 3300013307 Bacteria 9375
154 Ga0157372_10019409 3300013307 Bacteria 7328
155 Ga0157372_10028310 3300013307 Bacteria 6115
156 Ga0157372_10055088 3300013307 Bacteria 4439
157 Ga0157372_10085591 3300013307 Bacteria 3576
158 Ga0157372_10175491 3300013307 Bacteria 2480
159 Ga0163163_10108990 3300014325 Bacteria 2797
160 Ga0163163_10199275 3300014325 Bacteria 2050
161 Ga0157379_10007032 3300014968 Bacteria 9724
162 Ga0157376_10177290 3300014969 Bacteria 1945
163 Ga0182007_10030507 3300015262 Bacteria 1842
164 Ga0182005_1019125 3300015265 Unclassified 1890
165 Ga0224569_100249 3300022732 Bacteria 4472
166 Ga0207692_10003591 3300025898 Bacteria 6072
167 Ga0207680_10064607 3300025903 Bacteria 2244
168 Ga0207699_10016487 3300025906 Bacteria 3867
169 Ga0207699_10046180 3300025906 Bacteria 2546
170 Ga0207699_10085733 3300025906 Bacteria 1965
171 Ga0207699_10087225 3300025906 Bacteria 1951
172 Ga0207699_10158739 3300025906 Bacteria 1503
173 Ga0207684_10000832 3300025910 Bacteria 35561
174 Ga0207684_10002803 3300025910 Bacteria 17331
175 Ga0207654_10070456 3300025911 Bacteria 2076
176 Ga0207654_10102751 3300025911 Bacteria 1764
177 Ga0207707_10001125 3300025912 Bacteria 25351
178 Ga0207707_10003464 3300025912 Bacteria 13980
179 Ga0207695_10035278 3300025913 Bacteria 5427
180 Ga0207695_10048504 3300025913 Bacteria 4484
181 Ga0207695_10075851 3300025913 Bacteria 3420
182 Ga0207693_10001731 3300025915 Bacteria 19165
183 Ga0207693_10089481 3300025915 Bacteria 2413
184 Ga0207663_10007198 3300025916 Bacteria 5758
185 Ga0207660_10192773 3300025917 Bacteria 1588
186 Ga0207657_10002947 3300025919 Bacteria 18257
187 Ga0207657_10004279 3300025919 Bacteria 15127
188 Ga0207649_10075798 3300025920 Bacteria 2162
189 Ga0207652_10048726 3300025921 Bacteria 3623
190 Ga0207646_10001288 3300025922 Bacteria 31297
191 Ga0207694_10000892 3300025924 Bacteria 26471
192 Ga0207687_10007288 3300025927 Bacteria 7297
193 Ga0207687_10020028 3300025927 Bacteria 4436
194 Ga0207700_10165732 3300025928 Bacteria 1839
195 Ga0207664_10000607 3300025929 Bacteria 24798
196 Ga0207664_10064248 3300025929 Bacteria 2935
197 Ga0207664_10118854 3300025929 Bacteria 2209
198 Ga0207706_10000868 3300025933 Bacteria 31136
199 Ga0207709_10021467 3300025935 Bacteria 3656
200 Ga0207704_10048448 3300025938 Unclassified 2548
201 Ga0207665_10015033 3300025939 Bacteria 5082
202 Ga0207665_10049480 3300025939 Bacteria 2824
203 Ga0207665_10102708 3300025939 Bacteria 1998
204 Ga0207711_10004875 3300025941 Bacteria 11390
205 Ga0207689_10015618 3300025942 Bacteria 6431
206 Ga0207661_10016515 3300025944 Bacteria 5448
207 Ga0207679_10010631 3300025945 Bacteria 5931
208 Ga0207667_10000370 3300025949 Bacteria 60796
209 Ga0207667_10074524 3300025949 Bacteria 3526
210 Ga0207677_10005627 3300026023 Bacteria 6810
211 Ga0207703_10004544 3300026035 Bacteria 11377
212 Ga0207703_10038715 3300026035 Bacteria 3808
213 Ga0207639_10226113 3300026041 Bacteria 1619
214 Ga0207639_10233385 3300026041 Bacteria 1596
215 Ga0207678_10002447 3300026067 Bacteria 16873
216 Ga0207702_10001288 3300026078 Bacteria 25108
217 Ga0207702_10005752 3300026078 Bacteria 10792
218 Ga0207641_10108563 3300026088 Bacteria 2456
219 Ga0207648_10112853 3300026089 Bacteria 2386
220 Ga0207676_10004725 3300026095 Bacteria 9652
221 Ga0207674_10000190 3300026116 Bacteria 75394
222 Ga0207674_10025985 3300026116 Bacteria 6231
223 Ga0207674_10058791 3300026116 Bacteria 3893
224 Ga0207675_100009597 3300026118 Bacteria 9053
225 Ga0207698_10056614 3300026142 Bacteria 3028
226 Ga0207698_10234383 3300026142 Bacteria 1668
227 Ga0265338_10013492 3300028800 Bacteria 9216
228 Ga0265762_1000032 3300030760 Bacteria 15937
229 Ga0265325_10009870 3300031241 Bacteria 5558
230 Ga0373926_0000578 3300035083 Bacteria 9861
231 Ga0373934_0004368 3300035086 Bacteria 5225
232 Ga0373923_0058327 3300035111 Bacteria 1634
233 Ga0373945_0015083 3300035116 Bacteria 2597
234 Ga0373931_0006449 3300035691 Bacteria 5484
235 Ga0373931_0038968 3300035691 Bacteria 2489
236 Ga0373935_0079067 3300035692 Bacteria 2134
237 Ga0373927_0101956 3300035695 Bacteria 1867
238 Ga0373933_0007343 3300035724 Bacteria 6011
239 Ga0373947_0008556 3300035725 Bacteria 5896
240 Ga0373937_0088802 3300036401 Bacteria 2862
241 Ga0373925_0003968 3300037068 Bacteria 11283
242 Ga0436364_0449247 3300037853 Bacteria 5309
243 Ga0436363_1613636 3300039450 Bacteria 3407
244 Ga0436362_1017484 3300039453 Bacteria 4646
245 Ga0466966_0178451 3300044684 Bacteria 1289
246 Ga0466963_0004980 3300044694 Bacteria 7752
247 Ga0466963_0139088 3300044694 Bacteria 1681
248 Ga0466959_0004765 3300045049 Bacteria 9145
249 Ga0466959_0047711 3300045049 Bacteria 3150
250 Ga0466958_0058098 3300045836 Bacteria 2352
251 Ga0466967_0019618 3300045976 Bacteria 5442
252 Ga0466967_0044496 3300045976 Bacteria 3851
253 Ga0495580_0002144 3300046472 Bacteria 17318
254 Ga0495580_0003018 3300046472 Bacteria 14420
255 Ga0495580_0036348 3300046472 Bacteria 3536
256 Ga0495580_0044375 3300046472 Bacteria 3162
257 Ga0495630_0102213 3300046517 Bacteria 2168
258 Ga0495666_0025711 3300046526 Bacteria 2907
259 Ga0495665_0004229 3300046531 Bacteria 7750
260 Ga0495624_0060669 3300046690 Bacteria 2371
261 Ga0495581_0022847 3300047315 Bacteria 3623
262 Ga0495674_0021138 3300047319 Bacteria 6021
263 Ga0495602_0033021 3300048088 Bacteria 4863
264 Ga0496100_0037726 3300048903 Bacteria 3057
265 Ga0496100_0054345 3300048903 Bacteria 2612
266 Ga0496100_0086381 3300048903 Bacteria 2131
267 Ga0496100_0134085 3300048903 Bacteria 1748
268 Ga0496101_0208887 3300048904 Bacteria 1512
269 Ga0496102_0010132 3300048905 Bacteria 8106
270 Ga0496102_0082116 3300048905 Bacteria 2972
271 Ga0496102_0174723 3300048905 Bacteria 2022
272 Ga0496103_0060156 3300048906 Bacteria 2361
273 Ga0496104_0068501 3300048907 Bacteria 3372
274 Ga0496104_0072768 3300048907 Bacteria 3269
275 Ga0496105_0209579 3300048908 Bacteria 1589
276 Ga0496106_0031873 3300048909 Bacteria 3928
277 Ga0496107_0025905 3300048910 Bacteria 4156
278 Ga0496107_0197320 3300048910 Bacteria 1496
279 Ga0496108_0168505 3300048911 Bacteria 1894
280 Ga0496109_0073692 3300048912 Bacteria 3137
281 Ga0496111_0002648 3300048914 Bacteria 10857
282 Ga0496112_0011225 3300048915 Bacteria 8171
283 Ga0496112_0023445 3300048915 Bacteria 5897
284 Ga0496112_0061576 3300048915 Bacteria 3700
285 Ga0496112_0198508 3300048915 Bacteria 1966
286 Ga0496113_0066195 3300048916 Bacteria 2736
287 nmdc:mga0n895_5318_c1 3300050512 Bacteria 10727
288 nmdc:mga0rr50_181_c1 3300050513 Bacteria 34112
289 nmdc:mga0rr50_23931_c1 3300050513 Bacteria 4223
290 nmdc:mga08x19_2368_c1 3300050514 Bacteria 11425
291 nmdc:mga08x19_2632_c1 3300050514 Bacteria 10862
292 Ga0070681_10064573
293 Ga0070683_100031998
294 Ga0070690_100006782
295 Ga0070670_100004747
296 Ga0068869_100004218
297 Ga0070666_10010790
298 Ga0070680_100050411
299 Ga0070680_100093970
300 Ga0068868_100000628
301 Ga0070660_100015581
302 Ga0070660_100061906
303 Ga0070661_100022951
304 Ga0070659_100010808
305 Ga0070659_100179464
306 Ga0070667_100018917
307 Ga0070709_10015254
308 Ga0070709_10055094
309 Ga0070714_100000720
310 Ga0070714_100015390
311 Ga0070714_100026065
312 Ga0070714_100031369
313 Ga0070714_100050458
314 Ga0070714_100071436
315 Ga0070714_100091641
316 Ga0070714_100150309
317 Ga0070714_100230222
318 Ga0070713_100002097
319 Ga0070713_100006081
320 Ga0070713_100022611
321 Ga0070713_100097812
322 Ga0070713_100194734
323 Ga0070710_10007362
324 Ga0070710_10043138
325 Ga0070711_100000623
326 Ga0070711_100136962
327 Ga0070694_100020426
328 Ga0070708_100018605
329 Ga0070708_100020532
330 Ga0070708_100040008
331 Ga0070708_100100261
332 Ga0070663_100031909
333 Ga0070662_100001509
334 Ga0070681_10000506
335 Ga0070681_10002815
336 Ga0070681_10056421
337 Ga0070681_10118090
338 Ga0068867_100035860
339 Ga0070706_100000454
340 Ga0070706_100028333
341 Ga0070706_100052403
342 Ga0070706_100085433
343 Ga0070707_100235180
344 Ga0070699_100003496
345 Ga0070699_100048467
346 Ga0070679_100014489
347 Ga0070679_100140052
348 Ga0070684_100025140
349 Ga0070697_100001523
350 Ga0070697_100003194
351 Ga0070697_100005012
352 Ga0068853_100147197
353 Ga0070695_100013438
354 Ga0070693_100009042
355 Ga0070665_100089306
356 Ga0068855_100000212
357 Ga0068855_100006540
358 Ga0068855_100102628
359 Ga0070664_100002091
360 Ga0070664_100018900
361 Ga0070664_100042255
362 Ga0068857_100000164
363 Ga0068857_100016915
364 Ga0068857_100046747
365 Ga0068854_100023354
366 Ga0068854_100119663
367 Ga0068854_100122987
368 Ga0068856_100001677
369 Ga0068856_100040595
370 Ga0068856_100048394
371 Ga0068856_100198519
372 Ga0068852_100071849
373 Ga0068852_100075681
374 Ga0068859_100000780
375 Ga0068859_100015249
376 Ga0068864_100006501
377 Ga0068864_100126154
378 Ga0068866_10002395
379 Ga0068851_10007945
380 Ga0068863_100117773
381 Ga0068858_100001038
382 Ga0068858_100046025
383 Ga0068860_100013116
384 Ga0068860_100167308
385 Ga0068862_100007880
386 Ga0081540_1028552
387 Ga0070717_10000272
388 Ga0070717_10005108
389 Ga0070717_10013249
390 Ga0070717_10028882
391 Ga0070717_10058623
392 Ga0070716_100046743
393 Ga0070716_100050763
394 Ga0070712_100000952
395 Ga0070712_100050843
396 Ga0097621_100000314
397 Ga0097621_100007716
398 Ga0097621_100093245
399 Ga0068871_100009452
400 Ga0068871_100032919
401 Ga0075434_100003959
402 Ga0075434_100039922
403 Ga0068865_100057940
404 Ga0075436_100003222
405 Ga0075436_100096397
406 Ga0097620_100000780
407 Ga0097620_100015248
408 Ga0075435_100011997
409 Ga0105240_10008664
410 Ga0105240_10023147
411 Ga0105240_10064458
412 Ga0105240_10099200
413 Ga0105245_10009192
414 Ga0105245_10098815
415 Ga0105243_10036830
416 Ga0105241_10001302
417 Ga0105241_10100531
418 Ga0105242_10112965
419 Ga0105237_10146507
420 Ga0105238_10000064
421 Ga0105238_10037684
422 Ga0105238_10060285
423 Ga0105239_10113189
424 Ga0105239_10149004
425 Ga0105246_10019784
426 Ga0157373_10008148
427 Ga0157371_10010976
428 Ga0157371_10046815
429 Ga0157370_10123509
430 Ga0157369_10000522
431 Ga0157369_10059214
432 Ga0157369_10147146
433 Ga0157369_10216278
434 Ga0157369_10315135
435 Ga0157374_10000245
436 Ga0157374_10000577
437 Ga0157374_10009924
438 Ga0157378_10000172
439 Ga0157378_10037586
440 Ga0163162_10001366
441 Ga0163162_10004521
442 Ga0157372_10000450
443 Ga0157372_10003823
444 Ga0157372_10011617
445 Ga0157372_10019409
446 Ga0157372_10028310
447 Ga0157372_10055088
448 Ga0157372_10085591
449 Ga0157372_10175491
450 Ga0163163_10108990
451 Ga0163163_10199275
452 Ga0157379_10007032
453 Ga0157376_10177290
454 Ga0182007_10030507
455 Ga0182005_1019125
456 Ga0224569_100249
457 Ga0207692_10003591
458 Ga0207680_10064607
459 Ga0207699_10016487
460 Ga0207699_10046180
461 Ga0207699_10085733
462 Ga0207699_10087225
463 Ga0207699_10158739
464 Ga0207684_10000832
465 Ga0207684_10002803
466 Ga0207654_10070456
467 Ga0207654_10102751
468 Ga0207707_10001125
469 Ga0207707_10003464
470 Ga0207695_10035278
471 Ga0207695_10048504
472 Ga0207695_10075851
473 Ga0207693_10001731
474 Ga0207693_10089481
475 Ga0207663_10007198
476 Ga0207660_10192773
477 Ga0207657_10002947
478 Ga0207657_10004279
479 Ga0207649_10075798
480 Ga0207652_10048726
481 Ga0207646_10001288
482 Ga0207694_10000892
483 Ga0207687_10007288
484 Ga0207687_10020028
485 Ga0207700_10165732
486 Ga0207664_10000607
487 Ga0207664_10064248
488 Ga0207664_10118854
489 Ga0207706_10000868
490 Ga0207709_10021467
491 Ga0207704_10048448
492 Ga0207665_10015033
493 Ga0207665_10049480
494 Ga0207665_10102708
495 Ga0207711_10004875
496 Ga0207689_10015618
497 Ga0207661_10016515
498 Ga0207679_10010631
499 Ga0207667_10000370
500 Ga0207667_10074524
501 Ga0207677_10005627
502 Ga0207703_10004544
503 Ga0207703_10038715
504 Ga0207639_10226113
505 Ga0207639_10233385
506 Ga0207678_10002447
507 Ga0207702_10001288
508 Ga0207702_10005752
509 Ga0207641_10108563
510 Ga0207648_10112853
511 Ga0207676_10004725
512 Ga0207674_10000190
513 Ga0207674_10025985
514 Ga0207674_10058791
515 Ga0207675_100009597
516 Ga0207698_10056614
517 Ga0207698_10234383
518 Ga0265338_10013492
519 Ga0265762_1000032
520 Ga0265325_10009870
521 Ga0373926_0000578
522 Ga0373934_0004368
523 Ga0373923_0058327
524 Ga0373945_0015083
525 Ga0373931_0006449
526 Ga0373931_0038968
527 Ga0373935_0079067
528 Ga0373927_0101956
529 Ga0373933_0007343
530 Ga0373947_0008556
531 Ga0373937_0088802
532 Ga0373925_0003968
533 Ga0436364_0449247
534 Ga0436363_1613636
535 Ga0436362_1017484
536 Ga0466966_0178451
537 Ga0466963_0004980
538 Ga0466963_0139088
539 Ga0466959_0004765
540 Ga0466959_0047711
541 Ga0466958_0058098
542 Ga0466967_0019618
543 Ga0466967_0044496
544 Ga0495580_0002144
545 Ga0495580_0003018
546 Ga0495580_0036348
547 Ga0495580_0044375
548 Ga0495630_0102213
549 Ga0495666_0025711
550 Ga0495665_0004229
551 Ga0495624_0060669
552 Ga0495581_0022847
553 Ga0495674_0021138
554 Ga0495602_0033021
555 Ga0496100_0037726
556 Ga0496100_0054345
557 Ga0496100_0086381
558 Ga0496100_0134085
559 Ga0496101_0208887
560 Ga0496102_0010132
561 Ga0496102_0082116
562 Ga0496102_0174723
563 Ga0496103_0060156
564 Ga0496104_0068501
565 Ga0496104_0072768
566 Ga0496105_0209579
567 Ga0496106_0031873
568 Ga0496107_0025905
569 Ga0496107_0197320
570 Ga0496108_0168505
571 Ga0496109_0073692
572 Ga0496111_0002648
573 Ga0496112_0011225
574 Ga0496112_0023445
575 Ga0496112_0061576
576 Ga0496112_0198508
577 Ga0496113_0066195
578 nmdc:mga0n895_5318_c1
579 nmdc:mga0rr50_181_c1
580 nmdc:mga0rr50_23931_c1
581 nmdc:mga08x19_2368_c1
582 nmdc:mga08x19_2632_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00132

Hexapep

Bacterial transferase hexapeptide (six repeats)

378

413

0.94

PF12804

NTP_transf_3

MobA-like NTP transferase domain

64

256

0.82

PF00483

NTP_transferase

Nucleotidyl transferase

63

280

0.8

PF02348

CTP_transf_3

Cytidylyltransferase

63

248

0.79

PF01128

IspD

2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase

62

194

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
5u2k-assembly1.cif.gz_A crystal structure of galactoside o-acetyltransferase complex with coa (h3 space group) 0.8923 331 438
3ect-assembly1.cif.gz_A crystal structure of the hexapeptide-repeat containing-acetyltransferase vca0836 from vibrio cholerae 0.8886 330 438
3nz2-assembly5.cif.gz_I crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor 0.8857 330 438
3srt-assembly2.cif.gz_B the crystal structure of a maltose o-acetyltransferase from clostridium difficile 630 0.8748 330 438
6ag8-assembly1.cif.gz_C crystal structure of maltose o-acetyltransferase from e. coli 0.8692 330 438
ID Description Score Start End Superfamily
1g97A01 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9345 21 272 3.90.550.10
1g97A01 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9309 21 272 3.90.550.10
af_P9WMN3_2_263_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9187 17 272 3.90.550.10
4fceA01 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9039 21 247 3.90.550.10
5vmkC01 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9024 21 247 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A1F5REM2-F1-model_v4 MobA-like NTP transferase domain-containing protein 0.9572 21 263 GO:0016779
AF-A0A5S5MFU7-F1-model_v4 NTP transferase domain-containing protein 0.9551 20 267 GO:0016020
GO:0016779
AF-E3CCL4-F1-model_v4 Putative UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase 0.952 21 240 GO:0009058
GO:0016779
AF-A0A1V5MI17-F1-model_v4 Bifunctional protein GlmU 0.9514 20 265 GO:0016779
AF-A0A7C4UH14-F1-model_v4 Bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase 0.9504 21 317 GO:0009058
GO:0016746
GO:0016779

Map