F389742

General Info

Members Datasets Scaffolds Average Seq Length
290 165 580 309

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10013313|Ga0114129_100133137
Length 342
Sequence MTRRRSLRELWRAGSAVARDRMASRFGAAVLGVAIAAPHAAGDHTDRLLNAPPTIPHVRDDAGEWHAPFIYPWRLVSQLEQRYEEDRSTRVPLVWLSHGRLVESSDDARAPLMLLGADSFGRDVFSRVLFGARLSLGLAAAAALGAMLLGSIVGAAAGYLGGLWDDVLMRVTDFVMVLPAIYVALALRAVLPLVLPPRTLFAMLVGIFAVVGAPFIARGVRAIVRSERRLDYASAAEALGASDVRLLARHLLPATRGFIVVQLTLLVPAFIVAEATLSYVGLGFPDPMASWGTMLHDASSNLRVFADFPWLLSPAVAMFLVVFSLNLVLQRAGAAVVYNERP

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
112 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
113 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
114 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
115 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
116 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
117 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
121 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
122 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
123 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
124 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
125 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
126 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
127 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
128 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
129 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
130 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
131 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
132 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
133 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
134 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
135 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
138 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
139 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
140 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
150 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
151 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
152 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
153 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
154 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
155 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
156 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
157 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
158 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
159 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
160 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
161 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
162 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
163 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
164 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
165 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.72
Rhizosphere 98.28
Stem 0
Stem Tuber 0
Unclassified 12.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10013313 3300009147 Bacteria 11724
2 JGI24751J29686_10004531 3300002459 Unclassified 2824
3 Ga0070658_10143050 3300005327 Bacteria 1999
4 Ga0070683_100262182 3300005329 Bacteria 1644
5 Ga0070690_100165907 3300005330 Bacteria 1517
6 Ga0070670_100069963 3300005331 Unclassified 3013
7 Ga0070670_100141236 3300005331 Bacteria 2082
8 Ga0070670_100413308 3300005331 Unclassified 1192
9 Ga0068869_100358091 3300005334 Bacteria 1191
10 Ga0070666_10021124 3300005335 Bacteria 4218
11 Ga0070666_10039740 3300005335 Bacteria 3137
12 Ga0070680_100154855 3300005336 Bacteria 1925
13 Ga0068868_100055067 3300005338 Bacteria 3137
14 Ga0068868_100090329 3300005338 Bacteria 2467
15 Ga0070660_100027361 3300005339 Unclassified 4255
16 Ga0070660_100086180 3300005339 Bacteria 2471
17 Ga0070689_100064003 3300005340 Bacteria 2862
18 Ga0070661_100093415 3300005344 Unclassified 2229
19 Ga0070675_100217227 3300005354 Unclassified 1664
20 Ga0070671_100017286 3300005355 Bacteria 5840
21 Ga0070671_100324964 3300005355 Bacteria 1311
22 Ga0070674_100145081 3300005356 Bacteria 1786
23 Ga0070673_100009743 3300005364 Bacteria 6466
24 Ga0070673_100050898 3300005364 Bacteria 3241
25 Ga0070688_100017459 3300005365 Bacteria 4119
26 Ga0070667_100007464 3300005367 Bacteria 9077
27 Ga0070667_100085830 3300005367 Bacteria 2700
28 Ga0070700_100083084 3300005441 Bacteria 2072
29 Ga0070694_100004088 3300005444 Bacteria 8756
30 Ga0070708_100012790 3300005445 Bacteria 6857
31 Ga0070708_100040540 3300005445 Bacteria 4078
32 Ga0070678_100032564 3300005456 Bacteria 3609
33 Ga0070678_100239069 3300005456 Bacteria 1518
34 Ga0070662_100082024 3300005457 Bacteria 2404
35 Ga0070681_10088168 3300005458 Unclassified 3055
36 Ga0070681_10312343 3300005458 Unclassified 1481
37 Ga0070681_10355543 3300005458 Bacteria 1375
38 Ga0068867_100133693 3300005459 Bacteria 1931
39 Ga0070685_10081028 3300005466 Bacteria 1946
40 Ga0070685_10154029 3300005466 Unclassified 1459
41 Ga0070707_100266270 3300005468 Bacteria 1667
42 Ga0070707_100294461 3300005468 Unclassified 1577
43 Ga0070698_100053476 3300005471 Bacteria 4104
44 Ga0070698_100055555 3300005471 Unclassified 4014
45 Ga0070698_100370996 3300005471 Bacteria 1363
46 Ga0070699_100004932 3300005518 Bacteria 11770
47 Ga0070679_100026918 3300005530 Bacteria 5654
48 Ga0070679_100094684 3300005530 Bacteria 2974
49 Ga0070684_100021423 3300005535 Bacteria 5379
50 Ga0070697_100007441 3300005536 Bacteria 8526
51 Ga0070697_100048525 3300005536 Bacteria 3443
52 Ga0070697_100301283 3300005536 Bacteria 1378
53 Ga0070672_100012848 3300005543 Bacteria 5898
54 Ga0070686_100000438 3300005544 Bacteria 25888
55 Ga0070665_100001991 3300005548 Bacteria 22972
56 Ga0070665_100014513 3300005548 Bacteria 7902
57 Ga0070704_100004948 3300005549 Bacteria 7735
58 Ga0070704_100071247 3300005549 Bacteria 2525
59 Ga0068855_100021620 3300005563 Bacteria 7716
60 Ga0068857_100024015 3300005577 Bacteria 5366
61 Ga0068854_100003823 3300005578 Bacteria 9425
62 Ga0068859_100155255 3300005617 Bacteria 2366
63 Ga0068859_100216936 3300005617 Unclassified 2001
64 Ga0068864_100082628 3300005618 Unclassified 2819
65 Ga0068864_100086117 3300005618 Bacteria 2764
66 Ga0068864_100247332 3300005618 Bacteria 1654
67 Ga0068866_10101778 3300005718 Bacteria 1586
68 Ga0068861_100038258 3300005719 Bacteria 3571
69 Ga0068861_100210484 3300005719 Bacteria 1637
70 Ga0068863_100019052 3300005841 Bacteria 6569
71 Ga0068863_100145339 3300005841 Bacteria 2268
72 Ga0068863_100185522 3300005841 Bacteria 1998
73 Ga0068858_100005482 3300005842 Bacteria 12423
74 Ga0068858_100012231 3300005842 Bacteria 8092
75 Ga0068858_100024531 3300005842 Bacteria 5618
76 Ga0068858_100029904 3300005842 Bacteria 5060
77 Ga0068858_100079822 3300005842 Bacteria 3040
78 Ga0068858_100393064 3300005842 Bacteria 1331
79 Ga0068860_100228469 3300005843 Bacteria 1808
80 Ga0068862_100241485 3300005844 Bacteria 1643
81 Ga0081539_10031374 3300005985 Bacteria 3276
82 Ga0097621_100027020 3300006237 Bacteria 4509
83 Ga0097621_100080465 3300006237 Bacteria 2710
84 Ga0097621_100118165 3300006237 Bacteria 2247
85 Ga0097621_100160393 3300006237 Bacteria 1933
86 Ga0097621_100181235 3300006237 Bacteria 1820
87 Ga0068871_100052831 3300006358 Bacteria 3292
88 Ga0068871_100057993 3300006358 Bacteria 3152
89 Ga0068871_100200999 3300006358 Bacteria 1720
90 Ga0075428_100037116 3300006844 Bacteria 5366
91 Ga0075431_100182414 3300006847 Bacteria 2154
92 Ga0075433_10069999 3300006852 Bacteria 3082
93 Ga0075433_10102437 3300006852 Bacteria 2535
94 Ga0075433_10139787 3300006852 Bacteria 2152
95 Ga0075433_10142996 3300006852 Unclassified 2126
96 Ga0075434_100062539 3300006871 Bacteria 3705
97 Ga0075434_100091244 3300006871 Bacteria 3048
98 Ga0075434_100112725 3300006871 Bacteria 2731
99 Ga0075434_100180196 3300006871 Bacteria 2133
100 Ga0068865_100019586 3300006881 Bacteria 4380
101 Ga0068865_100216513 3300006881 Bacteria 1495
102 Ga0068865_100394708 3300006881 Bacteria 1132
103 Ga0075436_100020019 3300006914 Bacteria 4592
104 Ga0075436_100235082 3300006914 Bacteria 1302
105 Ga0097620_100155265 3300006931 Bacteria 2366
106 Ga0097620_100216936 3300006931 Unclassified 2001
107 Ga0075435_100007918 3300007076 Bacteria 7606
108 Ga0075435_100013130 3300007076 Bacteria 6153
109 Ga0105251_10070820 3300009011 Bacteria 1623
110 Ga0111539_10081269 3300009094 Bacteria 3812
111 Ga0111539_10242130 3300009094 Bacteria 2100
112 Ga0105247_10066500 3300009101 Unclassified 2245
113 Ga0114129_10004696 3300009147 Bacteria 19292
114 Ga0114129_10010283 3300009147 Bacteria 13353
115 Ga0114129_10017696 3300009147 Bacteria 10146
116 Ga0114129_10022516 3300009147 Bacteria 8940
117 Ga0114129_10024159 3300009147 Bacteria 8614
118 Ga0105241_10046017 3300009174 Bacteria 3312
119 Ga0105241_10275300 3300009174 Unclassified 1435
120 Ga0105242_10001515 3300009176 Bacteria 18256
121 Ga0105242_10125995 3300009176 Unclassified 2204
122 Ga0105242_10153572 3300009176 Bacteria 2009
123 Ga0105242_10211402 3300009176 Bacteria 1729
124 Ga0105248_10006812 3300009177 Bacteria 12526
125 Ga0105248_10007185 3300009177 Bacteria 12219
126 Ga0105248_10038187 3300009177 Bacteria 5374
127 Ga0105248_10228416 3300009177 Bacteria 2095
128 Ga0157374_10009832 3300013296 Bacteria 8208
129 Ga0157378_10020033 3300013297 Bacteria 5882
130 Ga0157375_10039662 3300013308 Bacteria 4534
131 Ga0163163_10002458 3300014325 Bacteria 15660
132 Ga0163163_10032464 3300014325 Bacteria 5042
133 Ga0163163_10035834 3300014325 Bacteria 4816
134 Ga0157379_10013938 3300014968 Bacteria 7046
135 Ga0157379_10016217 3300014968 Bacteria 6555
136 Ga0157379_10017590 3300014968 Bacteria 6293
137 Ga0157379_10019925 3300014968 Bacteria 5926
138 Ga0157376_10016221 3300014969 Bacteria 5648
139 Ga0157376_10078614 3300014969 Bacteria 2825
140 Ga0157376_10483515 3300014969 Unclassified 1214
141 Ga0207642_10111299 3300025899 Bacteria 1394
142 Ga0207642_10290092 3300025899 Bacteria 945
143 Ga0207710_10006981 3300025900 Bacteria 4801
144 Ga0207680_10010928 3300025903 Bacteria 4564
145 Ga0207680_10027699 3300025903 Bacteria 3160
146 Ga0207643_10103193 3300025908 Bacteria 1674
147 Ga0207705_10174716 3300025909 Bacteria 1618
148 Ga0207707_10006143 3300025912 Bacteria 10495
149 Ga0207707_10127983 3300025912 Unclassified 2221
150 Ga0207707_10134821 3300025912 Bacteria 2159
151 Ga0207660_10165565 3300025917 Bacteria 1709
152 Ga0207662_10070553 3300025918 Bacteria 2113
153 Ga0207657_10008190 3300025919 Bacteria 10650
154 Ga0207657_10050733 3300025919 Unclassified 3609
155 Ga0207649_10067554 3300025920 Unclassified 2270
156 Ga0207652_10030350 3300025921 Bacteria 4526
157 Ga0207652_10136885 3300025921 Bacteria 2188
158 Ga0207646_10053989 3300025922 Bacteria 3595
159 Ga0207646_10087936 3300025922 Bacteria 2780
160 Ga0207646_10129785 3300025922 Bacteria 2268
161 Ga0207694_10162698 3300025924 Bacteria 1803
162 Ga0207650_10052866 3300025925 Unclassified 3010
163 Ga0207650_10156122 3300025925 Bacteria 1804
164 Ga0207659_10033433 3300025926 Bacteria 3539
165 Ga0207687_10007297 3300025927 Bacteria 7292
166 Ga0207687_10155164 3300025927 Bacteria 1751
167 Ga0207644_10030117 3300025931 Bacteria 3770
168 Ga0207686_10010624 3300025934 Bacteria 5017
169 Ga0207709_10132693 3300025935 Bacteria 1699
170 Ga0207704_10172268 3300025938 Bacteria 1554
171 Ga0207691_10003429 3300025940 Bacteria 15418
172 Ga0207691_10056480 3300025940 Bacteria 3575
173 Ga0207691_10193609 3300025940 Bacteria 1772
174 Ga0207711_10021583 3300025941 Bacteria 5378
175 Ga0207711_10067198 3300025941 Unclassified 3102
176 Ga0207711_10215734 3300025941 Bacteria 1754
177 Ga0207689_10267252 3300025942 Bacteria 1416
178 Ga0207661_10224839 3300025944 Unclassified 1660
179 Ga0207668_10018522 3300025972 Bacteria 4385
180 Ga0207658_10064024 3300025986 Bacteria 2757
181 Ga0207677_10038083 3300026023 Bacteria 3149
182 Ga0207677_10232107 3300026023 Bacteria 1487
183 Ga0207703_10004608 3300026035 Bacteria 11281
184 Ga0207703_10019809 3300026035 Bacteria 5258
185 Ga0207703_10032522 3300026035 Unclassified 4129
186 Ga0207703_10041510 3300026035 Unclassified 3686
187 Ga0207703_10146382 3300026035 Bacteria 2055
188 Ga0207703_10366709 3300026035 Bacteria 1329
189 Ga0207708_10067911 3300026075 Bacteria 2728
190 Ga0207641_10004577 3300026088 Bacteria 11952
191 Ga0207641_10240713 3300026088 Unclassified 1686
192 Ga0207676_10036984 3300026095 Unclassified 3717
193 Ga0207676_10048960 3300026095 Unclassified 3284
194 Ga0207676_10237775 3300026095 Bacteria 1632
195 Ga0207674_10065960 3300026116 Unclassified 3648
196 Ga0207675_100031179 3300026118 Bacteria 4965
197 Ga0207675_100108030 3300026118 Bacteria 2624
198 Ga0207683_10066983 3300026121 Bacteria 3167
199 Ga0207683_10284105 3300026121 Bacteria 1512
200 Ga0207698_10507199 3300026142 Bacteria 1175
201 Ga0207428_10060534 3300027907 Bacteria 3000
202 Ga0207428_10259981 3300027907 Bacteria 1293
203 Ga0268266_10005647 3300028379 Bacteria 11602
204 Ga0268266_10039235 3300028379 Bacteria 4033
205 Ga0268266_10157288 3300028379 Bacteria 2054
206 Ga0268266_10191228 3300028379 Bacteria 1869
207 Ga0268265_10046590 3300028380 Bacteria 3242
208 Ga0268264_10080221 3300028381 Bacteria 2786
209 Ga0268264_10195294 3300028381 Unclassified 1847
210 Ga0265332_10041908 3300031238 Bacteria 1980
211 Ga0373939_0061250 3300035114 Unclassified 1199
212 Ga0373953_0074226 3300035117 Bacteria 1407
213 Ga0373943_0292627 3300035170 Bacteria 923
214 Ga0373946_0177764 3300035171 Bacteria 1009
215 Ga0373955_0138656 3300035172 Bacteria 1425
216 Ga0373947_0022822 3300035725 Unclassified 3632
217 Ga0373947_0259880 3300035725 Bacteria 1150
218 Ga0373937_0036863 3300036401 Bacteria 4456
219 Ga0373937_0253764 3300036401 Bacteria 1658
220 Ga0373937_0501514 3300036401 Bacteria 1153
221 Ga0466967_0194352 3300045976 Bacteria 1919
222 Ga0495582_0131411 3300046473 Bacteria 1415
223 Ga0495639_0048548 3300046475 Bacteria 1925
224 Ga0495608_0004384 3300046511 Bacteria 10113
225 Ga0495618_0082028 3300046514 Bacteria 2060
226 Ga0495630_0003648 3300046517 Bacteria 10728
227 Ga0495640_0178176 3300046533 Bacteria 1356
228 Ga0495640_0208495 3300046533 Bacteria 1236
229 Ga0495587_0034072 3300046536 Bacteria 3072
230 Ga0495645_0006072 3300046543 Bacteria 8356
231 Ga0495635_0057669 3300046663 Bacteria 2672
232 Ga0495635_0087073 3300046663 Bacteria 2137
233 Ga0495658_0177258 3300046683 Bacteria 1321
234 Ga0495658_0239371 3300046683 Bacteria 1139
235 Ga0495613_0001538 3300046689 Bacteria 17542
236 Ga0495600_0053261 3300046809 Bacteria 2643
237 Ga0495604_0006270 3300047317 Bacteria 9438
238 Ga0495674_0047060 3300047319 Bacteria 3826
239 Ga0495675_0071365 3300047444 Bacteria 2192
240 Ga0495684_0000212 3300047471 Bacteria 45252
241 Ga0495684_0260881 3300047471 Bacteria 1257
242 Ga0496104_0187473 3300048907 Bacteria 1979
243 Ga0496109_0392038 3300048912 Bacteria 1312
244 Ga0496112_0047264 3300048915 Unclassified 4221
245 Ga0496112_0312636 3300048915 Bacteria 1516
246 Ga0496113_0017431 3300048916 Bacteria 4986
247 Ga0501031_0170086 3300049568 Bacteria 1424
248 Ga0501036_0011245 3300049572 Bacteria 7405
249 Ga0501037_0147271 3300049573 Bacteria 1684
250 Ga0501038_0285396 3300049574 Bacteria 1298
251 Ga0501040_0042450 3300049576 Bacteria 3097
252 Ga0501041_0000627 3300049577 Bacteria 18426
253 Ga0501042_0004975 3300049578 Bacteria 8513
254 Ga0501043_0062489 3300049579 Bacteria 2924
255 Ga0501048_0063570 3300049582 Bacteria 2610
256 Ga0501075_0013186 3300049591 Bacteria 5894
257 Ga0501076_0005495 3300049592 Bacteria 9126
258 Ga0501079_0005624 3300049741 Bacteria 9355
259 Ga0501081_0002135 3300049743 Bacteria 12379
260 Ga0501045_0015273 3300049824 Bacteria 5450
261 Ga0501045_0284471 3300049824 Bacteria 1231
262 nmdc:mga05p37_11380_c1 3300050507 Bacteria 8001
263 nmdc:mga05p37_509468_c1 3300050507 Bacteria 1379
264 nmdc:mga05p37_57137_c1 3300050507 Bacteria 4806
265 nmdc:mga05p37_6416_c1 3300050507 Bacteria 13865
266 nmdc:mga05p37_8233_c1 3300050507 Bacteria 12332
267 nmdc:mga08y16_50206_c1 3300050511 Bacteria 4366
268 nmdc:mga0n895_17789_c1 3300050512 Bacteria 6561
269 nmdc:mga0n895_258006_c1 3300050512 Bacteria 1769
270 nmdc:mga0n895_29300_c1 3300050512 Bacteria 5248
271 nmdc:mga0n895_477732_c1 3300050512 Bacteria 1257
272 nmdc:mga0rr50_15836_c1 3300050513 Bacteria 4988
273 nmdc:mga0rr50_741_c1 3300050513 Bacteria 9089
274 nmdc:mga0rr50_85534_c1 3300050513 Bacteria 2444
275 nmdc:mga08x19_107976_c1 3300050514 Bacteria 1853
276 nmdc:mga08x19_15563_c1 3300050514 Bacteria 4629
277 nmdc:mga08x19_212131_c1 3300050514 Bacteria 1329
278 nmdc:mga08x19_35402_c1 3300050514 Bacteria 3159
279 nmdc:mga0a205_322342_c1 3300050515 Bacteria 1416
280 nmdc:mga0a205_354650_c1 3300050515 Bacteria 1334
281 nmdc:mga0a205_43674_c1 3300050515 Bacteria 4321
282 nmdc:mga0a205_44942_c1 3300050515 Bacteria 4259
283 nmdc:mga0a205_80212_c1 3300050515 Bacteria 3154
284 Ga0495601_0124815 3300053077 Bacteria 1674
285 Ga0495595_0046472 3300053084 Bacteria 2000
286 Ga0495619_0044719 3300053085 Bacteria 2907
287 Ga0495619_0194508 3300053085 Bacteria 1404
288 Ga0501084_0034226 3300054114 Bacteria 4248
289 Ga0501082_0000660 3300060353 Bacteria 30402
290 Ga0530510_0003965 3300061734 Bacteria 10211
291 Ga0114129_10013313
292 JGI24751J29686_10004531
293 Ga0070658_10143050
294 Ga0070683_100262182
295 Ga0070690_100165907
296 Ga0070670_100069963
297 Ga0070670_100141236
298 Ga0070670_100413308
299 Ga0068869_100358091
300 Ga0070666_10021124
301 Ga0070666_10039740
302 Ga0070680_100154855
303 Ga0068868_100055067
304 Ga0068868_100090329
305 Ga0070660_100027361
306 Ga0070660_100086180
307 Ga0070689_100064003
308 Ga0070661_100093415
309 Ga0070675_100217227
310 Ga0070671_100017286
311 Ga0070671_100324964
312 Ga0070674_100145081
313 Ga0070673_100009743
314 Ga0070673_100050898
315 Ga0070688_100017459
316 Ga0070667_100007464
317 Ga0070667_100085830
318 Ga0070700_100083084
319 Ga0070694_100004088
320 Ga0070708_100012790
321 Ga0070708_100040540
322 Ga0070678_100032564
323 Ga0070678_100239069
324 Ga0070662_100082024
325 Ga0070681_10088168
326 Ga0070681_10312343
327 Ga0070681_10355543
328 Ga0068867_100133693
329 Ga0070685_10081028
330 Ga0070685_10154029
331 Ga0070707_100266270
332 Ga0070707_100294461
333 Ga0070698_100053476
334 Ga0070698_100055555
335 Ga0070698_100370996
336 Ga0070699_100004932
337 Ga0070679_100026918
338 Ga0070679_100094684
339 Ga0070684_100021423
340 Ga0070697_100007441
341 Ga0070697_100048525
342 Ga0070697_100301283
343 Ga0070672_100012848
344 Ga0070686_100000438
345 Ga0070665_100001991
346 Ga0070665_100014513
347 Ga0070704_100004948
348 Ga0070704_100071247
349 Ga0068855_100021620
350 Ga0068857_100024015
351 Ga0068854_100003823
352 Ga0068859_100155255
353 Ga0068859_100216936
354 Ga0068864_100082628
355 Ga0068864_100086117
356 Ga0068864_100247332
357 Ga0068866_10101778
358 Ga0068861_100038258
359 Ga0068861_100210484
360 Ga0068863_100019052
361 Ga0068863_100145339
362 Ga0068863_100185522
363 Ga0068858_100005482
364 Ga0068858_100012231
365 Ga0068858_100024531
366 Ga0068858_100029904
367 Ga0068858_100079822
368 Ga0068858_100393064
369 Ga0068860_100228469
370 Ga0068862_100241485
371 Ga0081539_10031374
372 Ga0097621_100027020
373 Ga0097621_100080465
374 Ga0097621_100118165
375 Ga0097621_100160393
376 Ga0097621_100181235
377 Ga0068871_100052831
378 Ga0068871_100057993
379 Ga0068871_100200999
380 Ga0075428_100037116
381 Ga0075431_100182414
382 Ga0075433_10069999
383 Ga0075433_10102437
384 Ga0075433_10139787
385 Ga0075433_10142996
386 Ga0075434_100062539
387 Ga0075434_100091244
388 Ga0075434_100112725
389 Ga0075434_100180196
390 Ga0068865_100019586
391 Ga0068865_100216513
392 Ga0068865_100394708
393 Ga0075436_100020019
394 Ga0075436_100235082
395 Ga0097620_100155265
396 Ga0097620_100216936
397 Ga0075435_100007918
398 Ga0075435_100013130
399 Ga0105251_10070820
400 Ga0111539_10081269
401 Ga0111539_10242130
402 Ga0105247_10066500
403 Ga0114129_10004696
404 Ga0114129_10010283
405 Ga0114129_10017696
406 Ga0114129_10022516
407 Ga0114129_10024159
408 Ga0105241_10046017
409 Ga0105241_10275300
410 Ga0105242_10001515
411 Ga0105242_10125995
412 Ga0105242_10153572
413 Ga0105242_10211402
414 Ga0105248_10006812
415 Ga0105248_10007185
416 Ga0105248_10038187
417 Ga0105248_10228416
418 Ga0157374_10009832
419 Ga0157378_10020033
420 Ga0157375_10039662
421 Ga0163163_10002458
422 Ga0163163_10032464
423 Ga0163163_10035834
424 Ga0157379_10013938
425 Ga0157379_10016217
426 Ga0157379_10017590
427 Ga0157379_10019925
428 Ga0157376_10016221
429 Ga0157376_10078614
430 Ga0157376_10483515
431 Ga0207642_10111299
432 Ga0207642_10290092
433 Ga0207710_10006981
434 Ga0207680_10010928
435 Ga0207680_10027699
436 Ga0207643_10103193
437 Ga0207705_10174716
438 Ga0207707_10006143
439 Ga0207707_10127983
440 Ga0207707_10134821
441 Ga0207660_10165565
442 Ga0207662_10070553
443 Ga0207657_10008190
444 Ga0207657_10050733
445 Ga0207649_10067554
446 Ga0207652_10030350
447 Ga0207652_10136885
448 Ga0207646_10053989
449 Ga0207646_10087936
450 Ga0207646_10129785
451 Ga0207694_10162698
452 Ga0207650_10052866
453 Ga0207650_10156122
454 Ga0207659_10033433
455 Ga0207687_10007297
456 Ga0207687_10155164
457 Ga0207644_10030117
458 Ga0207686_10010624
459 Ga0207709_10132693
460 Ga0207704_10172268
461 Ga0207691_10003429
462 Ga0207691_10056480
463 Ga0207691_10193609
464 Ga0207711_10021583
465 Ga0207711_10067198
466 Ga0207711_10215734
467 Ga0207689_10267252
468 Ga0207661_10224839
469 Ga0207668_10018522
470 Ga0207658_10064024
471 Ga0207677_10038083
472 Ga0207677_10232107
473 Ga0207703_10004608
474 Ga0207703_10019809
475 Ga0207703_10032522
476 Ga0207703_10041510
477 Ga0207703_10146382
478 Ga0207703_10366709
479 Ga0207708_10067911
480 Ga0207641_10004577
481 Ga0207641_10240713
482 Ga0207676_10036984
483 Ga0207676_10048960
484 Ga0207676_10237775
485 Ga0207674_10065960
486 Ga0207675_100031179
487 Ga0207675_100108030
488 Ga0207683_10066983
489 Ga0207683_10284105
490 Ga0207698_10507199
491 Ga0207428_10060534
492 Ga0207428_10259981
493 Ga0268266_10005647
494 Ga0268266_10039235
495 Ga0268266_10157288
496 Ga0268266_10191228
497 Ga0268265_10046590
498 Ga0268264_10080221
499 Ga0268264_10195294
500 Ga0265332_10041908
501 Ga0373939_0061250
502 Ga0373953_0074226
503 Ga0373943_0292627
504 Ga0373946_0177764
505 Ga0373955_0138656
506 Ga0373947_0022822
507 Ga0373947_0259880
508 Ga0373937_0036863
509 Ga0373937_0253764
510 Ga0373937_0501514
511 Ga0466967_0194352
512 Ga0495582_0131411
513 Ga0495639_0048548
514 Ga0495608_0004384
515 Ga0495618_0082028
516 Ga0495630_0003648
517 Ga0495640_0178176
518 Ga0495640_0208495
519 Ga0495587_0034072
520 Ga0495645_0006072
521 Ga0495635_0057669
522 Ga0495635_0087073
523 Ga0495658_0177258
524 Ga0495658_0239371
525 Ga0495613_0001538
526 Ga0495600_0053261
527 Ga0495604_0006270
528 Ga0495674_0047060
529 Ga0495675_0071365
530 Ga0495684_0000212
531 Ga0495684_0260881
532 Ga0496104_0187473
533 Ga0496109_0392038
534 Ga0496112_0047264
535 Ga0496112_0312636
536 Ga0496113_0017431
537 Ga0501031_0170086
538 Ga0501036_0011245
539 Ga0501037_0147271
540 Ga0501038_0285396
541 Ga0501040_0042450
542 Ga0501041_0000627
543 Ga0501042_0004975
544 Ga0501043_0062489
545 Ga0501048_0063570
546 Ga0501075_0013186
547 Ga0501076_0005495
548 Ga0501079_0005624
549 Ga0501081_0002135
550 Ga0501045_0015273
551 Ga0501045_0284471
552 nmdc:mga05p37_11380_c1
553 nmdc:mga05p37_509468_c1
554 nmdc:mga05p37_57137_c1
555 nmdc:mga05p37_6416_c1
556 nmdc:mga05p37_8233_c1
557 nmdc:mga08y16_50206_c1
558 nmdc:mga0n895_17789_c1
559 nmdc:mga0n895_258006_c1
560 nmdc:mga0n895_29300_c1
561 nmdc:mga0n895_477732_c1
562 nmdc:mga0rr50_15836_c1
563 nmdc:mga0rr50_741_c1
564 nmdc:mga0rr50_85534_c1
565 nmdc:mga08x19_107976_c1
566 nmdc:mga08x19_15563_c1
567 nmdc:mga08x19_212131_c1
568 nmdc:mga08x19_35402_c1
569 nmdc:mga0a205_322342_c1
570 nmdc:mga0a205_354650_c1
571 nmdc:mga0a205_43674_c1
572 nmdc:mga0a205_44942_c1
573 nmdc:mga0a205_80212_c1
574 Ga0495601_0124815
575 Ga0495595_0046472
576 Ga0495619_0044719
577 Ga0495619_0194508
578 Ga0501084_0034226
579 Ga0501082_0000660
580 Ga0530510_0003965

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

125

337

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7arh-assembly1.cif.gz_C lolcde in complex with lipoprotein 0.2632 167 303
3fh6-assembly2.cif.gz_H crystal structure of the resting state maltose transporter from e. coli 0.2426 117 299
7ow8-assembly1.cif.gz_A cryoem structure of the abc transporter bmra e504a mutant in complex with atp-mg 0.2399 114 306
5ttp-assembly1.cif.gz_B cryo-em structure of msba-nanodisc with adp-vanadate 0.2316 118 310
7bg4-assembly1.cif.gz_B multidrug resistance transporter bmra mutant e504a bound with atp, mg, and rhodamine 6g solved by cryo-em 0.2033 114 299
ID Description Score Start End Superfamily
af_P0AFU0_122_352_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.4514 169 296 1.10.3720.10
af_P33915_131_335_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.4381 116 296 1.10.3720.10
af_P33915_131_335_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.3971 116 296 1.10.3720.10
af_Q2FYQ5_85_305_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.3777 124 307 1.10.3720.10
af_Q5HZA9_12_191_1.10.287.1260 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.357 234 299 1.10.287.1260
ID Description Score Start End GO Terms
AF-X1UKY6-F1-model_v4 Oligopeptide transport permease C-like N-terminal domain-containing protein 0.8713 10 123 GO:0005886
AF-A0A6N9C6U5-F1-model_v4 ABC transporter permease 0.8663 11 129 GO:0005886
AF-X0XIY9-F1-model_v4 Oligopeptide transport permease C-like N-terminal domain-containing protein 0.8566 10 143 GO:0005886
AF-A0A7C5I149-F1-model_v4 ABC transporter permease 0.8318 10 130 GO:0005886
AF-A0A3B9F942-F1-model_v4 ABC transporter substrate-binding protein 0.8148 12 127 GO:0005886

Map