F389330

General Info

Members Datasets Scaffolds Average Seq Length
289 182 578 218

Family's Representative Sequence

Representative Sequence 3300044658|Ga0466972_0046330|Ga0466972_0046330_950_1741
Length 263
Sequence MFATARRAARRPIERPDVRGSWPDEGGVEHLVVGTLRSDTEPATSSGGRVPMSKAIAGVEVPETAATAEASRLIRETTGPLLYHHSRRVFFFGRIHAHRLGVTPDPELLYLAAMFHDTGLVTPFSDVEQRFEVDGADHGRRFLLEHGFSTAAADTVWTAIALHTTPGIPDRMGPEIATTYLGVLTDVLGFGLDELPSAHVEEILAIHPRGDFKNDFLRAYLEGLKNRPETTNGTVNSDVLEHFLPGFRRTTTVERILGSAWPS

Samples

Sample ID Description Type Environment
1 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
74 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
75 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
116 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
117 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
118 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
119 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
120 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
121 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
122 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
123 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
124 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
125 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
126 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
127 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
128 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
129 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
130 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
131 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
132 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
133 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
134 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
137 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
138 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
145 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
146 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
147 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
148 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
149 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
153 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
154 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
155 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
165 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
166 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
167 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
168 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
169 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
171 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
172 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
173 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
174 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
175 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
176 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
179 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
180 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
182 2808606394 Promicromonospora sp. C35 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.96
Metatranscriptomes 0.35
Isolates 0.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.3
Nodule 0
Rhizoplane 10.38
Rhizosphere 77.16
Stem 0
Stem Tuber 0
Unclassified 0.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466972_0046330 3300044658 Bacteria 2105
2 JGI24744J21845_10002778 3300002077 Bacteria 3577
3 rootH2_10029840 3300003320 Bacteria 5122
4 rootH1_10135813 3300003323 Bacteria 4155
5 rootH1_10211978 3300003323 Bacteria 2528
6 Ga0070676_10751377 3300005328 Bacteria 716
7 Ga0070690_100084162 3300005330 Bacteria 2085
8 Ga0070666_10492874 3300005335 Bacteria 888
9 Ga0070682_100121544 3300005337 Bacteria 1754
10 Ga0068868_100027379 3300005338 Bacteria 4349
11 Ga0068868_100246012 3300005338 Bacteria 1504
12 Ga0070691_10015796 3300005341 Bacteria 3469
13 Ga0070687_100011195 3300005343 Bacteria 3914
14 Ga0070661_100190723 3300005344 Bacteria 1563
15 Ga0070668_100167875 3300005347 Bacteria 1785
16 Ga0070671_100204533 3300005355 Bacteria 1675
17 Ga0070674_100089573 3300005356 Bacteria 2217
18 Ga0070674_100160033 3300005356 Bacteria 1708
19 Ga0070709_10123756 3300005434 Bacteria 1757
20 Ga0070713_100054445 3300005436 Bacteria 3319
21 Ga0070713_100162978 3300005436 Bacteria 1992
22 Ga0070713_100612769 3300005436 Bacteria 1035
23 Ga0070710_10014900 3300005437 Bacteria 3921
24 Ga0070701_10385733 3300005438 Bacteria 884
25 Ga0070705_100040540 3300005440 Bacteria 2648
26 Ga0070705_100095360 3300005440 Bacteria 1865
27 Ga0070705_100627644 3300005440 Bacteria 835
28 Ga0070700_100083938 3300005441 Bacteria 2063
29 Ga0070700_100733442 3300005441 Bacteria 789
30 Ga0070663_100098777 3300005455 Bacteria 2175
31 Ga0070663_100339348 3300005455 Bacteria 1213
32 Ga0070678_100015773 3300005456 Bacteria 4811
33 Ga0070678_100189094 3300005456 Bacteria 1691
34 Ga0068867_100035401 3300005459 Bacteria 3621
35 Ga0068867_100266305 3300005459 Bacteria 1399
36 Ga0070684_100914873 3300005535 Bacteria 822
37 Ga0068853_100054787 3300005539 Bacteria 3437
38 Ga0070672_100062561 3300005543 Bacteria 2937
39 Ga0070695_100025284 3300005545 Bacteria 3666
40 Ga0070695_100233830 3300005545 Bacteria 1330
41 Ga0070693_100117565 3300005547 Bacteria 1645
42 Ga0070693_100424566 3300005547 Bacteria 927
43 Ga0070665_100016527 3300005548 Bacteria 7399
44 Ga0070704_100017931 3300005549 Bacteria 4515
45 Ga0070704_100369490 3300005549 Bacteria 1216
46 Ga0068854_100021776 3300005578 Bacteria 4355
47 Ga0068856_100481622 3300005614 Bacteria 1262
48 Ga0070702_100012118 3300005615 Bacteria 4308
49 Ga0068859_100070749 3300005617 Bacteria 3524
50 Ga0068864_100357855 3300005618 Bacteria 1379
51 Ga0068866_10007655 3300005718 Bacteria 4528
52 Ga0068866_10056357 3300005718 Bacteria 2021
53 Ga0068866_10130809 3300005718 Bacteria 1427
54 Ga0068851_10145803 3300005834 Bacteria 1291
55 Ga0068863_100071879 3300005841 Bacteria 3273
56 Ga0068860_100030897 3300005843 Bacteria 5150
57 Ga0068860_100162913 3300005843 Bacteria 2151
58 Ga0068862_100072031 3300005844 Bacteria 2984
59 Ga0081455_10130978 3300005937 Bacteria 1961
60 Ga0081455_10175656 3300005937 Bacteria 1627
61 Ga0081455_10405467 3300005937 Bacteria 945
62 Ga0075365_10006239 3300006038 Bacteria 6538
63 Ga0075363_100000139 3300006048 Bacteria 17720
64 Ga0075363_100009631 3300006048 Bacteria 4549
65 Ga0075363_100255859 3300006048 Bacteria 1009
66 Ga0075363_100263161 3300006048 Bacteria 995
67 Ga0075364_10072060 3300006051 Bacteria 2277
68 Ga0075364_10383137 3300006051 Bacteria 959
69 Ga0070715_10006380 3300006163 Bacteria 4007
70 Ga0070715_10149638 3300006163 Bacteria 1142
71 Ga0070716_100032334 3300006173 Bacteria 2853
72 Ga0070716_100039537 3300006173 Bacteria 2619
73 Ga0070712_100015068 3300006175 Bacteria 4971
74 Ga0075362_10071834 3300006177 Bacteria 1582
75 Ga0075367_10030563 3300006178 Bacteria 3089
76 Ga0075369_10077346 3300006186 Bacteria 1472
77 Ga0075366_10189488 3300006195 Bacteria 1250
78 Ga0075370_10036349 3300006353 Bacteria 2766
79 Ga0097620_100070750 3300006931 Bacteria 3524
80 Ga0105240_11184612 3300009093 Bacteria 810
81 Ga0111539_10348722 3300009094 Bacteria 1723
82 Ga0105245_10289484 3300009098 Bacteria 1604
83 Ga0105245_11071311 3300009098 Bacteria 852
84 Ga0105247_10191861 3300009101 Bacteria 1368
85 Ga0105243_10022411 3300009148 Bacteria 4800
86 Ga0105243_10179937 3300009148 Bacteria 1838
87 Ga0105242_10024915 3300009176 Bacteria 4729
88 Ga0105242_10152084 3300009176 Bacteria 2019
89 Ga0105248_10056226 3300009177 Bacteria 4414
90 Ga0105249_10003837 3300009553 Bacteria 12971
91 Ga0105249_10215427 3300009553 Bacteria 1887
92 Ga0105249_10328170 3300009553 Bacteria 1543
93 Ga0105239_10722960 3300010375 Bacteria 1139
94 Ga0157378_10121759 3300013297 Bacteria 2405
95 Ga0157378_10327520 3300013297 Bacteria 1490
96 Ga0157378_10337761 3300013297 Bacteria 1468
97 Ga0163162_10054480 3300013306 Bacteria 4023
98 Ga0163162_10184534 3300013306 Bacteria 2213
99 Ga0157372_10254470 3300013307 Bacteria 2039
100 Ga0157375_10012734 3300013308 Bacteria 7466
101 Ga0163163_10349526 3300014325 Bacteria 1534
102 Ga0157380_10138675 3300014326 Bacteria 2086
103 Ga0157377_10291675 3300014745 Bacteria 1073
104 Ga0157379_10045135 3300014968 Bacteria 3935
105 Ga0157379_10202389 3300014968 Bacteria 1796
106 Ga0157379_10323359 3300014968 Bacteria 1408
107 Ga0157379_10333637 3300014968 Bacteria 1386
108 Ga0157376_10033030 3300014969 Bacteria 4162
109 Ga0157376_10456141 3300014969 Bacteria 1248
110 Ga0209758_1004507 3300025297 Bacteria 11550
111 Ga0207426_1012247 3300025302 Bacteria 3229
112 Ga0209051_1040975 3300025303 Bacteria 1653
113 Ga0207642_10011383 3300025899 Bacteria 3171
114 Ga0207642_10100934 3300025899 Bacteria 1448
115 Ga0207688_10053356 3300025901 Bacteria 2267
116 Ga0207647_10115031 3300025904 Bacteria 1589
117 Ga0207685_10012158 3300025905 Bacteria 2617
118 Ga0207699_10107513 3300025906 Bacteria 1782
119 Ga0207645_10012988 3300025907 Bacteria 5630
120 Ga0207707_10200904 3300025912 Bacteria 1738
121 Ga0207671_10068943 3300025914 Bacteria 2636
122 Ga0207693_10046393 3300025915 Bacteria 3413
123 Ga0207693_10064252 3300025915 Bacteria 2874
124 Ga0207660_10335489 3300025917 Bacteria 1209
125 Ga0207662_10088214 3300025918 Bacteria 1904
126 Ga0207657_10136671 3300025919 Bacteria 2005
127 Ga0207649_10261775 3300025920 Bacteria 1250
128 Ga0207649_10605027 3300025920 Bacteria 843
129 Ga0207694_10620138 3300025924 Bacteria 910
130 Ga0207687_10006081 3300025927 Bacteria 7989
131 Ga0207687_10261030 3300025927 Bacteria 1381
132 Ga0207700_10090104 3300025928 Bacteria 2419
133 Ga0207700_10112603 3300025928 Bacteria 2192
134 Ga0207700_10599009 3300025928 Bacteria 981
135 Ga0207664_10465941 3300025929 Bacteria 1129
136 Ga0207690_10259152 3300025932 Bacteria 1347
137 Ga0207706_10122480 3300025933 Bacteria 2287
138 Ga0207686_10010268 3300025934 Bacteria 5094
139 Ga0207709_10023170 3300025935 Bacteria 3531
140 Ga0207670_10110375 3300025936 Bacteria 1981
141 Ga0207669_10010763 3300025937 Bacteria 4418
142 Ga0207704_10013751 3300025938 Bacteria 4064
143 Ga0207704_10347602 3300025938 Bacteria 1153
144 Ga0207665_10023699 3300025939 Bacteria 4042
145 Ga0207665_10026049 3300025939 Bacteria 3858
146 Ga0207665_10030796 3300025939 Bacteria 3548
147 Ga0207712_10027657 3300025961 Bacteria 3788
148 Ga0207712_10486743 3300025961 Bacteria 1052
149 Ga0207668_10246870 3300025972 Bacteria 1447
150 Ga0207668_10368935 3300025972 Bacteria 1205
151 Ga0207668_10808442 3300025972 Bacteria 830
152 Ga0207677_10045283 3300026023 Bacteria 2937
153 Ga0207677_10161212 3300026023 Bacteria 1743
154 Ga0207703_10446219 3300026035 Bacteria 1208
155 Ga0207639_10041553 3300026041 Bacteria 3441
156 Ga0207639_10258695 3300026041 Bacteria 1521
157 Ga0207678_10008301 3300026067 Bacteria 9151
158 Ga0207678_10096170 3300026067 Bacteria 2531
159 Ga0207708_10014757 3300026075 Bacteria 5847
160 Ga0207648_10083304 3300026089 Bacteria 2790
161 Ga0207675_100048836 3300026118 Bacteria 3950
162 Ga0207683_10040020 3300026121 Bacteria 4089
163 Ga0207683_10357061 3300026121 Bacteria 1342
164 Ga0207698_10429095 3300026142 Bacteria 1270
165 Ga0207698_10458954 3300026142 Bacteria 1232
166 Ga0207428_10110472 3300027907 Bacteria 2117
167 Ga0268266_10007157 3300028379 Bacteria 10109
168 Ga0268266_10280625 3300028379 Bacteria 1549
169 Ga0268266_10634796 3300028379 Bacteria 1027
170 Ga0268264_10011738 3300028381 Bacteria 7224
171 Ga0307511_10000527 3300030521 Bacteria 40894
172 Ga0307509_10193172 3300031507 Bacteria 1884
173 Ga0373931_0020077 3300035691 Bacteria 3341
174 Ga0395900_0045339 3300037418 Bacteria 4529
175 Ga0395900_0796176 3300037418 Bacteria 873
176 Ga0439465_0002194 3300041413 Bacteria 6402
177 Ga0439465_0075323 3300041413 Bacteria 1136
178 Ga0451847_0509015 3300041503 Bacteria 816
179 Ga0439442_058375 3300042002 Bacteria 816
180 Ga0439448_0150740 3300042005 Bacteria 807
181 Ga0439434_0060896 3300042435 Bacteria 1180
182 Ga0439434_0087792 3300042435 Bacteria 992
183 Ga0466969_0011207 3300044656 Bacteria 4745
184 Ga0466969_0078003 3300044656 Bacteria 1584
185 Ga0466972_0038445 3300044658 Bacteria 2337
186 Ga0466972_0273905 3300044658 Unclassified 789
187 Ga0466965_0000001 3300044683 Bacteria 317826
188 Ga0466965_0006787 3300044683 Bacteria 5226
189 Ga0466965_0022995 3300044683 Bacteria 3007
190 Ga0466966_0005588 3300044684 Bacteria 8265
191 Ga0466966_0191254 3300044684 Bacteria 1240
192 Ga0466961_0000884 3300044693 Bacteria 18652
193 Ga0466964_0339472 3300044706 Bacteria 769
194 Ga0466968_0001766 3300044735 Bacteria 7797
195 Ga0466968_0015427 3300044735 Bacteria 3028
196 Ga0466970_0010581 3300044765 Bacteria 4686
197 Ga0466970_0022593 3300044765 Bacteria 3283
198 Ga0466970_0038798 3300044765 Bacteria 2527
199 Ga0466970_0077650 3300044765 Bacteria 1790
200 Ga0466970_0096810 3300044765 Bacteria 1605
201 Ga0466970_0192793 3300044765 Bacteria 1133
202 Ga0466970_0248985 3300044765 Bacteria 995
203 Ga0466970_0383318 3300044765 Bacteria 800
204 Ga0466957_0150094 3300044842 Bacteria 1506
205 Ga0466957_0178597 3300044842 Bacteria 1386
206 Ga0466957_0305332 3300044842 Bacteria 1070
207 Ga0466960_0010979 3300044901 Bacteria 3773
208 Ga0466959_0000570 3300045049 Bacteria 21505
209 Ga0466959_0034325 3300045049 Bacteria 3752
210 Ga0466959_0034596 3300045049 Bacteria 3737
211 Ga0466959_0160666 3300045049 Bacteria 1580
212 Ga0466958_0057271 3300045836 Bacteria 2369
213 Ga0466958_0080598 3300045836 Bacteria 2003
214 Ga0466958_0099967 3300045836 Bacteria 1803
215 Ga0466967_0070895 3300045976 Bacteria 3119
216 Ga0466967_0105710 3300045976 Bacteria 2579
217 Ga0466967_0774199 3300045976 Bacteria 952
218 Ga0495686_0009660 3300047472 Bacteria 6929
219 Ga0496100_0000778 3300048903 Bacteria 15210
220 Ga0496100_0017807 3300048903 Bacteria 4202
221 Ga0496101_0001459 3300048904 Bacteria 14115
222 Ga0496101_0058276 3300048904 Bacteria 2796
223 Ga0496101_0570416 3300048904 Bacteria 895
224 Ga0496102_0004198 3300048905 Bacteria 12183
225 Ga0496102_0157647 3300048905 Bacteria 2134
226 Ga0496103_0010700 3300048906 Bacteria 5428
227 Ga0496103_0340072 3300048906 Bacteria 965
228 Ga0496104_0003825 3300048907 Bacteria 13032
229 Ga0496104_0107856 3300048907 Bacteria 2669
230 Ga0496104_0807678 3300048907 Bacteria 844
231 Ga0496105_0010848 3300048908 Bacteria 7174
232 Ga0496105_0195476 3300048908 Bacteria 1653
233 Ga0496106_0035489 3300048909 Bacteria 3728
234 Ga0496106_0213722 3300048909 Bacteria 1537
235 Ga0496107_0000357 3300048910 Bacteria 24928
236 Ga0496107_0034063 3300048910 Bacteria 3645
237 Ga0496108_0214728 3300048911 Bacteria 1670
238 Ga0496109_0202288 3300048912 Bacteria 1867
239 Ga0496110_0128139 3300048913 Bacteria 2290
240 Ga0496112_0006963 3300048915 Bacteria 9983
241 Ga0496112_0645324 3300048915 Bacteria 988
242 Ga0496112_0839785 3300048915 Bacteria 842
243 Ga0496113_0123593 3300048916 Bacteria 2025
244 Ga0496114_0000539 3300048917 Bacteria 27935
245 Ga0496114_0006137 3300048917 Bacteria 9454
246 Ga0496114_0376220 3300048917 Bacteria 1257
247 Ga0496115_0044548 3300048918 Bacteria 3540
248 Ga0496115_0061414 3300048918 Bacteria 3029
249 Ga0496117_0034501 3300048920 Bacteria 3811
250 Ga0496121_0241224 3300048924 Bacteria 1259
251 Ga0496126_0057877 3300048929 Bacteria 3496
252 Ga0496126_0911291 3300048929 Bacteria 666
253 Ga0501032_0001507 3300049569 Bacteria 18605
254 Ga0501034_0002401 3300049571 Bacteria 22695
255 Ga0501034_0023463 3300049571 Bacteria 6286
256 Ga0501036_0005535 3300049572 Bacteria 10247
257 Ga0501037_0000806 3300049573 Bacteria 23445
258 Ga0501038_0006552 3300049574 Bacteria 10768
259 Ga0501038_0211266 3300049574 Bacteria 1552
260 Ga0501039_0007285 3300049575 Bacteria 8426
261 Ga0501039_0044462 3300049575 Bacteria 3430
262 Ga0501043_0000886 3300049579 Bacteria 26553
263 Ga0501043_0009047 3300049579 Bacteria 7836
264 Ga0501046_0463516 3300049580 Bacteria 910
265 Ga0501047_0106677 3300049581 Bacteria 2682
266 Ga0501047_0606194 3300049581 Bacteria 916
267 Ga0501067_0250520 3300049583 Bacteria 986
268 Ga0501070_0000803 3300049586 Bacteria 28511
269 Ga0501070_0005201 3300049586 Bacteria 11086
270 Ga0501071_0255545 3300049587 Bacteria 1323
271 Ga0501074_0000276 3300049590 Bacteria 29509
272 Ga0501080_0152139 3300049742 Bacteria 2138
273 Ga0501035_0002082 3300049822 Bacteria 19908
274 Ga0501044_0179337 3300049823 Bacteria 2086
275 Ga0501044_0198979 3300049823 Bacteria 1963
276 nmdc:mga03683_113252_c1 3300050489 Bacteria 1201
277 nmdc:mga03n38_149494_c1 3300050490 Bacteria 1174
278 nmdc:mga03n38_17659_c1 3300050490 Bacteria 2799
279 nmdc:mga03n38_73430_c1 3300050490 Bacteria 912
280 nmdc:mga00v17_60006_c1 3300050491 Bacteria 2335
281 nmdc:mga0yw44_64742_c1 3300050492 Bacteria 2251
282 nmdc:mga06z11_33922_c1 3300050494 Bacteria 2501
283 nmdc:mga07m45_27656_c1 3300050496 Bacteria 3126
284 nmdc:mga08y16_279287_c1 3300050511 Bacteria 1723
285 nmdc:mga0sz30_70112_c1 3300050516 Bacteria 1508
286 Ga0495655_0001804 3300053083 Bacteria 3335
287 Ga0587070_029618 3300059491 Bacteria 983
288 2739604843 2739367654 Bacteria 6049412
289 2809028022 2808606394 Bacteria 6248540
290 Ga0466972_0046330
291 JGI24744J21845_10002778
292 rootH2_10029840
293 rootH1_10135813
294 rootH1_10211978
295 Ga0070676_10751377
296 Ga0070690_100084162
297 Ga0070666_10492874
298 Ga0070682_100121544
299 Ga0068868_100027379
300 Ga0068868_100246012
301 Ga0070691_10015796
302 Ga0070687_100011195
303 Ga0070661_100190723
304 Ga0070668_100167875
305 Ga0070671_100204533
306 Ga0070674_100089573
307 Ga0070674_100160033
308 Ga0070709_10123756
309 Ga0070713_100054445
310 Ga0070713_100162978
311 Ga0070713_100612769
312 Ga0070710_10014900
313 Ga0070701_10385733
314 Ga0070705_100040540
315 Ga0070705_100095360
316 Ga0070705_100627644
317 Ga0070700_100083938
318 Ga0070700_100733442
319 Ga0070663_100098777
320 Ga0070663_100339348
321 Ga0070678_100015773
322 Ga0070678_100189094
323 Ga0068867_100035401
324 Ga0068867_100266305
325 Ga0070684_100914873
326 Ga0068853_100054787
327 Ga0070672_100062561
328 Ga0070695_100025284
329 Ga0070695_100233830
330 Ga0070693_100117565
331 Ga0070693_100424566
332 Ga0070665_100016527
333 Ga0070704_100017931
334 Ga0070704_100369490
335 Ga0068854_100021776
336 Ga0068856_100481622
337 Ga0070702_100012118
338 Ga0068859_100070749
339 Ga0068864_100357855
340 Ga0068866_10007655
341 Ga0068866_10056357
342 Ga0068866_10130809
343 Ga0068851_10145803
344 Ga0068863_100071879
345 Ga0068860_100030897
346 Ga0068860_100162913
347 Ga0068862_100072031
348 Ga0081455_10130978
349 Ga0081455_10175656
350 Ga0081455_10405467
351 Ga0075365_10006239
352 Ga0075363_100000139
353 Ga0075363_100009631
354 Ga0075363_100255859
355 Ga0075363_100263161
356 Ga0075364_10072060
357 Ga0075364_10383137
358 Ga0070715_10006380
359 Ga0070715_10149638
360 Ga0070716_100032334
361 Ga0070716_100039537
362 Ga0070712_100015068
363 Ga0075362_10071834
364 Ga0075367_10030563
365 Ga0075369_10077346
366 Ga0075366_10189488
367 Ga0075370_10036349
368 Ga0097620_100070750
369 Ga0105240_11184612
370 Ga0111539_10348722
371 Ga0105245_10289484
372 Ga0105245_11071311
373 Ga0105247_10191861
374 Ga0105243_10022411
375 Ga0105243_10179937
376 Ga0105242_10024915
377 Ga0105242_10152084
378 Ga0105248_10056226
379 Ga0105249_10003837
380 Ga0105249_10215427
381 Ga0105249_10328170
382 Ga0105239_10722960
383 Ga0157378_10121759
384 Ga0157378_10327520
385 Ga0157378_10337761
386 Ga0163162_10054480
387 Ga0163162_10184534
388 Ga0157372_10254470
389 Ga0157375_10012734
390 Ga0163163_10349526
391 Ga0157380_10138675
392 Ga0157377_10291675
393 Ga0157379_10045135
394 Ga0157379_10202389
395 Ga0157379_10323359
396 Ga0157379_10333637
397 Ga0157376_10033030
398 Ga0157376_10456141
399 Ga0209758_1004507
400 Ga0207426_1012247
401 Ga0209051_1040975
402 Ga0207642_10011383
403 Ga0207642_10100934
404 Ga0207688_10053356
405 Ga0207647_10115031
406 Ga0207685_10012158
407 Ga0207699_10107513
408 Ga0207645_10012988
409 Ga0207707_10200904
410 Ga0207671_10068943
411 Ga0207693_10046393
412 Ga0207693_10064252
413 Ga0207660_10335489
414 Ga0207662_10088214
415 Ga0207657_10136671
416 Ga0207649_10261775
417 Ga0207649_10605027
418 Ga0207694_10620138
419 Ga0207687_10006081
420 Ga0207687_10261030
421 Ga0207700_10090104
422 Ga0207700_10112603
423 Ga0207700_10599009
424 Ga0207664_10465941
425 Ga0207690_10259152
426 Ga0207706_10122480
427 Ga0207686_10010268
428 Ga0207709_10023170
429 Ga0207670_10110375
430 Ga0207669_10010763
431 Ga0207704_10013751
432 Ga0207704_10347602
433 Ga0207665_10023699
434 Ga0207665_10026049
435 Ga0207665_10030796
436 Ga0207712_10027657
437 Ga0207712_10486743
438 Ga0207668_10246870
439 Ga0207668_10368935
440 Ga0207668_10808442
441 Ga0207677_10045283
442 Ga0207677_10161212
443 Ga0207703_10446219
444 Ga0207639_10041553
445 Ga0207639_10258695
446 Ga0207678_10008301
447 Ga0207678_10096170
448 Ga0207708_10014757
449 Ga0207648_10083304
450 Ga0207675_100048836
451 Ga0207683_10040020
452 Ga0207683_10357061
453 Ga0207698_10429095
454 Ga0207698_10458954
455 Ga0207428_10110472
456 Ga0268266_10007157
457 Ga0268266_10280625
458 Ga0268266_10634796
459 Ga0268264_10011738
460 Ga0307511_10000527
461 Ga0307509_10193172
462 Ga0373931_0020077
463 Ga0395900_0045339
464 Ga0395900_0796176
465 Ga0439465_0002194
466 Ga0439465_0075323
467 Ga0451847_0509015
468 Ga0439442_058375
469 Ga0439448_0150740
470 Ga0439434_0060896
471 Ga0439434_0087792
472 Ga0466969_0011207
473 Ga0466969_0078003
474 Ga0466972_0038445
475 Ga0466972_0273905
476 Ga0466965_0000001
477 Ga0466965_0006787
478 Ga0466965_0022995
479 Ga0466966_0005588
480 Ga0466966_0191254
481 Ga0466961_0000884
482 Ga0466964_0339472
483 Ga0466968_0001766
484 Ga0466968_0015427
485 Ga0466970_0010581
486 Ga0466970_0022593
487 Ga0466970_0038798
488 Ga0466970_0077650
489 Ga0466970_0096810
490 Ga0466970_0192793
491 Ga0466970_0248985
492 Ga0466970_0383318
493 Ga0466957_0150094
494 Ga0466957_0178597
495 Ga0466957_0305332
496 Ga0466960_0010979
497 Ga0466959_0000570
498 Ga0466959_0034325
499 Ga0466959_0034596
500 Ga0466959_0160666
501 Ga0466958_0057271
502 Ga0466958_0080598
503 Ga0466958_0099967
504 Ga0466967_0070895
505 Ga0466967_0105710
506 Ga0466967_0774199
507 Ga0495686_0009660
508 Ga0496100_0000778
509 Ga0496100_0017807
510 Ga0496101_0001459
511 Ga0496101_0058276
512 Ga0496101_0570416
513 Ga0496102_0004198
514 Ga0496102_0157647
515 Ga0496103_0010700
516 Ga0496103_0340072
517 Ga0496104_0003825
518 Ga0496104_0107856
519 Ga0496104_0807678
520 Ga0496105_0010848
521 Ga0496105_0195476
522 Ga0496106_0035489
523 Ga0496106_0213722
524 Ga0496107_0000357
525 Ga0496107_0034063
526 Ga0496108_0214728
527 Ga0496109_0202288
528 Ga0496110_0128139
529 Ga0496112_0006963
530 Ga0496112_0645324
531 Ga0496112_0839785
532 Ga0496113_0123593
533 Ga0496114_0000539
534 Ga0496114_0006137
535 Ga0496114_0376220
536 Ga0496115_0044548
537 Ga0496115_0061414
538 Ga0496117_0034501
539 Ga0496121_0241224
540 Ga0496126_0057877
541 Ga0496126_0911291
542 Ga0501032_0001507
543 Ga0501034_0002401
544 Ga0501034_0023463
545 Ga0501036_0005535
546 Ga0501037_0000806
547 Ga0501038_0006552
548 Ga0501038_0211266
549 Ga0501039_0007285
550 Ga0501039_0044462
551 Ga0501043_0000886
552 Ga0501043_0009047
553 Ga0501046_0463516
554 Ga0501047_0106677
555 Ga0501047_0606194
556 Ga0501067_0250520
557 Ga0501070_0000803
558 Ga0501070_0005201
559 Ga0501071_0255545
560 Ga0501074_0000276
561 Ga0501080_0152139
562 Ga0501035_0002082
563 Ga0501044_0179337
564 Ga0501044_0198979
565 nmdc:mga03683_113252_c1
566 nmdc:mga03n38_149494_c1
567 nmdc:mga03n38_17659_c1
568 nmdc:mga03n38_73430_c1
569 nmdc:mga00v17_60006_c1
570 nmdc:mga0yw44_64742_c1
571 nmdc:mga06z11_33922_c1
572 nmdc:mga07m45_27656_c1
573 nmdc:mga08y16_279287_c1
574 nmdc:mga0sz30_70112_c1
575 Ga0495655_0001804
576 Ga0587070_029618
577 2739604843
578 2809028022

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01966

HD

HD domain

82

206

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6dka-assembly4.cif.gz_F yeast ddi2 cyanamide hydratase 0.6942 36 215
6dk9-assembly4.cif.gz_F yeast ddi2 cyanamide hydratase 0.6872 36 215
6dkd-assembly2.cif.gz_C yeast ddi2 cyanamide hydratase 0.6639 34 215
3wfp-assembly9.cif.gz_A trna processing enzyme (apo form 2) 0.6412 39 154
3wfr-assembly3.cif.gz_G trna processing enzyme complex 2 0.6402 38 154
ID Description Score Start End Superfamily
af_P0CH63_33_194_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.7637 36 162 1.10.3210.10
af_L7N672_164_416_1.10.3090.10 Mainly Alpha;Orthogonal Bundle;cca-adding enzyme, domain 2;cca-adding enzyme, domain 2 0.6584 38 138 1.10.3090.10
af_P27249_457_599_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.6575 33 139 1.10.3210.10
af_Q8GUM8_2_102_1.10.472.50 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;HD-domain/PDEase-like 0.6281 33 113 1.10.472.50
af_Q86JB3_16_237_1.10.3210.50 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432; 0.6161 33 146 1.10.3210.50
ID Description Score Start End GO Terms
AF-A0A069P2D5-F1-model_v4 Phosphohydrolase 0.9403 38 135 GO:0016787
AF-A0A7W1MXX7-F1-model_v4 HD domain-containing protein 0.9012 33 114
AF-A0A4R4ZEN9-F1-model_v4 HD domain-containing protein 0.8996 35 140 GO:0003677
GO:0006352
GO:0016987
AF-A0A069P2D5-F1-model_v4 Phosphohydrolase 0.8967 38 135 GO:0016787
AF-A0A1Q4AW52-F1-model_v4 HD domain-containing protein 0.8904 35 133

Map