F389248
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 289 | 140 | 289 | 268 |
Family's Representative Sequence
| Representative Sequence | 3300026078|Ga0207702_10023516|Ga0207702_100235169 |
| Length | 234 |
| Sequence | MMFSYTQLSQYLTCPRRYRLRYLEGWREKDTRAAVLFGRGFELALGAYFRREDPGDVLFREWALYKNELLQFSNQDTWDRMLEQGIMLLTRFCQDNRIQVADPQKNLQIKISRQIAGNEFVGYVDGIGKLDGKQRLLEWKTSSYRYPEKPAELLTLDPQLVCYSWLTGIAEVAQVVFVRKRMVEVQYLETTIANAQRVEFGQLVEDTIRRIEAGHFLPHSGIRFPQNPCLSCPY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 27 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 43 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 44 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 45 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 46 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 47 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 51 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 52 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 73 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 121 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 122 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 123 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 124 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 125 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 126 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 127 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 128 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 129 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 132 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 133 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 134 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 135 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 136 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 137 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 138 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 139 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 140 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.65 |
| Metatranscriptomes | 0.35 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 6.23 |
| Rhizosphere | 93.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1002278 | 3300001976 | Viruses | 2563 |
| 2 | JGI24751J29686_10007902 | 3300002459 | Unclassified | 2174 |
| 3 | Ga0065712_10093442 | 3300005290 | Unclassified | 2292 |
| 4 | Ga0070683_100002123 | 3300005329 | Bacteria | 15651 |
| 5 | Ga0070683_100030202 | 3300005329 | Bacteria | 4915 |
| 6 | Ga0070670_100016220 | 3300005331 | Bacteria | 6396 |
| 7 | Ga0070670_100034927 | 3300005331 | Bacteria | 4327 |
| 8 | Ga0068869_100000409 | 3300005334 | Bacteria | 23378 |
| 9 | Ga0068869_100002923 | 3300005334 | Bacteria | 10365 |
| 10 | Ga0068869_100189148 | 3300005334 | Bacteria | 1618 |
| 11 | Ga0070666_10033227 | 3300005335 | Bacteria | 3412 |
| 12 | Ga0068868_100307165 | 3300005338 | Unclassified | 1349 |
| 13 | Ga0068868_100330740 | 3300005338 | Unclassified | 1300 |
| 14 | Ga0070689_100006429 | 3300005340 | Bacteria | 8129 |
| 15 | Ga0070689_100040215 | 3300005340 | Bacteria | 3584 |
| 16 | Ga0070687_100010174 | 3300005343 | Bacteria | 4056 |
| 17 | Ga0070661_100001327 | 3300005344 | Bacteria | 17332 |
| 18 | Ga0070661_100005018 | 3300005344 | Bacteria | 9120 |
| 19 | Ga0070669_100011144 | 3300005353 | Bacteria | 6381 |
| 20 | Ga0070675_100025351 | 3300005354 | Bacteria | 4754 |
| 21 | Ga0070675_100120243 | 3300005354 | Unclassified | 2231 |
| 22 | Ga0070671_100007177 | 3300005355 | Bacteria | 8906 |
| 23 | Ga0070671_100017553 | 3300005355 | Bacteria | 5799 |
| 24 | Ga0070671_100379146 | 3300005355 | Unclassified | 1208 |
| 25 | Ga0070673_100000589 | 3300005364 | Bacteria | 19744 |
| 26 | Ga0070688_100002679 | 3300005365 | Bacteria | 9041 |
| 27 | Ga0070688_100218329 | 3300005365 | Bacteria | 1342 |
| 28 | Ga0070667_100013226 | 3300005367 | Bacteria | 6819 |
| 29 | Ga0070714_100061064 | 3300005435 | Bacteria | 3236 |
| 30 | Ga0070713_100098134 | 3300005436 | Unclassified | 2533 |
| 31 | Ga0070713_100224646 | 3300005436 | Bacteria | 1705 |
| 32 | Ga0070713_100239198 | 3300005436 | Bacteria | 1653 |
| 33 | Ga0070701_10101954 | 3300005438 | Unclassified | 1591 |
| 34 | Ga0070708_100010876 | 3300005445 | Bacteria | 7391 |
| 35 | Ga0070708_100017626 | 3300005445 | Bacteria | 5962 |
| 36 | Ga0070708_100036377 | 3300005445 | Unclassified | 4294 |
| 37 | Ga0070708_100061880 | 3300005445 | Bacteria | 3345 |
| 38 | Ga0070708_100108447 | 3300005445 | Bacteria | 2550 |
| 39 | Ga0070708_100112167 | 3300005445 | Unclassified | 2507 |
| 40 | Ga0070708_100136122 | 3300005445 | Bacteria | 2276 |
| 41 | Ga0070708_100174583 | 3300005445 | Bacteria | 2007 |
| 42 | Ga0070708_100318713 | 3300005445 | Unclassified | 1464 |
| 43 | Ga0070708_100335121 | 3300005445 | Archaea | 1426 |
| 44 | Ga0070708_100436992 | 3300005445 | Unclassified | 1234 |
| 45 | Ga0070708_100474370 | 3300005445 | Bacteria | 1180 |
| 46 | Ga0070663_100001276 | 3300005455 | Bacteria | 13788 |
| 47 | Ga0070663_100006247 | 3300005455 | Bacteria | 7143 |
| 48 | Ga0070663_100106632 | 3300005455 | Bacteria | 2099 |
| 49 | Ga0070678_100039990 | 3300005456 | Unclassified | 3314 |
| 50 | Ga0070662_100447606 | 3300005457 | Unclassified | 1072 |
| 51 | Ga0070681_10590634 | 3300005458 | Unclassified | 1025 |
| 52 | Ga0068867_100480690 | 3300005459 | Bacteria | 1064 |
| 53 | Ga0070685_10003008 | 3300005466 | Bacteria | 8595 |
| 54 | Ga0070685_10021576 | 3300005466 | Bacteria | 3501 |
| 55 | Ga0070706_100001557 | 3300005467 | Bacteria | 23929 |
| 56 | Ga0070706_100045984 | 3300005467 | Unclassified | 4030 |
| 57 | Ga0070706_100197405 | 3300005467 | Bacteria | 1880 |
| 58 | Ga0070706_100211573 | 3300005467 | Bacteria | 1811 |
| 59 | Ga0070706_100354769 | 3300005467 | Bacteria | 1367 |
| 60 | Ga0070706_100529619 | 3300005467 | Unclassified | 1096 |
| 61 | Ga0070706_100574900 | 3300005467 | Unclassified | 1048 |
| 62 | Ga0070707_100004133 | 3300005468 | Bacteria | 13605 |
| 63 | Ga0070707_100142261 | 3300005468 | Unclassified | 2335 |
| 64 | Ga0070707_100238569 | 3300005468 | Bacteria | 1770 |
| 65 | Ga0070707_100455839 | 3300005468 | Unclassified | 1239 |
| 66 | Ga0070698_100001653 | 3300005471 | Bacteria | 24861 |
| 67 | Ga0070698_100267439 | 3300005471 | Bacteria | 1641 |
| 68 | Ga0070699_100071496 | 3300005518 | Bacteria | 3017 |
| 69 | Ga0070699_100092128 | 3300005518 | Bacteria | 2651 |
| 70 | Ga0070699_100121967 | 3300005518 | Bacteria | 2293 |
| 71 | Ga0070699_100440608 | 3300005518 | Bacteria | 1180 |
| 72 | Ga0070684_100000936 | 3300005535 | Bacteria | 20753 |
| 73 | Ga0070684_100011359 | 3300005535 | Bacteria | 7092 |
| 74 | Ga0070697_100012716 | 3300005536 | Bacteria | 6589 |
| 75 | Ga0070697_100037401 | 3300005536 | Bacteria | 3921 |
| 76 | Ga0070697_100046666 | 3300005536 | Unclassified | 3511 |
| 77 | Ga0070697_100125678 | 3300005536 | Bacteria | 2148 |
| 78 | Ga0070697_100354615 | 3300005536 | Bacteria | 1267 |
| 79 | Ga0070697_100409281 | 3300005536 | Unclassified | 1178 |
| 80 | Ga0070697_100435275 | 3300005536 | Bacteria | 1141 |
| 81 | Ga0070697_100692917 | 3300005536 | Bacteria | 899 |
| 82 | Ga0068853_100152117 | 3300005539 | Unclassified | 2083 |
| 83 | Ga0070672_100000364 | 3300005543 | Bacteria | 26086 |
| 84 | Ga0070665_100010125 | 3300005548 | Bacteria | 9536 |
| 85 | Ga0070665_100027710 | 3300005548 | Bacteria | 5704 |
| 86 | Ga0070665_100553918 | 3300005548 | Bacteria | 1162 |
| 87 | Ga0070664_100002544 | 3300005564 | Bacteria | 14706 |
| 88 | Ga0070664_100088765 | 3300005564 | Bacteria | 2673 |
| 89 | Ga0068857_100001315 | 3300005577 | Bacteria | 19544 |
| 90 | Ga0068857_100039101 | 3300005577 | Bacteria | 4201 |
| 91 | Ga0068856_100002220 | 3300005614 | Bacteria | 20098 |
| 92 | Ga0068856_100315106 | 3300005614 | Bacteria | 1582 |
| 93 | Ga0068856_100516038 | 3300005614 | Unclassified | 1216 |
| 94 | Ga0068859_100003313 | 3300005617 | Bacteria | 16365 |
| 95 | Ga0068859_100027742 | 3300005617 | Bacteria | 5679 |
| 96 | Ga0068864_100000879 | 3300005618 | Bacteria | 25306 |
| 97 | Ga0068864_100001704 | 3300005618 | Bacteria | 18071 |
| 98 | Ga0068851_10064091 | 3300005834 | Bacteria | 1888 |
| 99 | Ga0068863_100001146 | 3300005841 | Bacteria | 26467 |
| 100 | Ga0068863_100002863 | 3300005841 | Bacteria | 17081 |
| 101 | Ga0068863_100006619 | 3300005841 | Bacteria | 11374 |
| 102 | Ga0068858_100008599 | 3300005842 | Bacteria | 9805 |
| 103 | Ga0068858_100062001 | 3300005842 | Bacteria | 3457 |
| 104 | Ga0068858_100609196 | 3300005842 | Unclassified | 1060 |
| 105 | Ga0068860_100014700 | 3300005843 | Bacteria | 7656 |
| 106 | Ga0068860_100059515 | 3300005843 | Bacteria | 3631 |
| 107 | Ga0068862_100003035 | 3300005844 | Bacteria | 14617 |
| 108 | Ga0068862_100012726 | 3300005844 | Bacteria | 6965 |
| 109 | Ga0070717_10012540 | 3300006028 | Bacteria | 6465 |
| 110 | Ga0070717_10036785 | 3300006028 | Bacteria | 3972 |
| 111 | Ga0070717_10114071 | 3300006028 | Bacteria | 2308 |
| 112 | Ga0070717_10201854 | 3300006028 | Bacteria | 1742 |
| 113 | Ga0070712_100056559 | 3300006175 | Bacteria | 2752 |
| 114 | Ga0070712_100431642 | 3300006175 | Bacteria | 1094 |
| 115 | Ga0070712_100449574 | 3300006175 | Bacteria | 1072 |
| 116 | Ga0097621_100008738 | 3300006237 | Bacteria | 7318 |
| 117 | Ga0068871_100009017 | 3300006358 | Bacteria | 7205 |
| 118 | Ga0068871_100324888 | 3300006358 | Unclassified | 1356 |
| 119 | Ga0068865_100187704 | 3300006881 | Unclassified | 1596 |
| 120 | Ga0097620_100003313 | 3300006931 | Bacteria | 16365 |
| 121 | Ga0097620_100027739 | 3300006931 | Bacteria | 5679 |
| 122 | Ga0105240_10088248 | 3300009093 | Bacteria | 3795 |
| 123 | Ga0105247_10035107 | 3300009101 | Bacteria | 3055 |
| 124 | Ga0105247_10061835 | 3300009101 | Unclassified | 2322 |
| 125 | Ga0114129_11325628 | 3300009147 | Unclassified | 891 |
| 126 | Ga0105242_10774792 | 3300009176 | Unclassified | 947 |
| 127 | Ga0105248_10012614 | 3300009177 | Bacteria | 9325 |
| 128 | Ga0105248_10409932 | 3300009177 | Bacteria | 1526 |
| 129 | Ga0105249_10276624 | 3300009553 | Unclassified | 1675 |
| 130 | Ga0105239_10145945 | 3300010375 | Unclassified | 2639 |
| 131 | Ga0105239_10464960 | 3300010375 | Unclassified | 1436 |
| 132 | Ga0105246_10001222 | 3300011119 | Bacteria | 15046 |
| 133 | Ga0105246_10023978 | 3300011119 | Bacteria | 3955 |
| 134 | Ga0105246_10281870 | 3300011119 | Unclassified | 1333 |
| 135 | Ga0157371_10164485 | 3300013102 | Unclassified | 1585 |
| 136 | Ga0157369_10019781 | 3300013105 | Bacteria | 7535 |
| 137 | Ga0157369_10042779 | 3300013105 | Unclassified | 4942 |
| 138 | Ga0157369_10700927 | 3300013105 | Unclassified | 1043 |
| 139 | Ga0157374_10000388 | 3300013296 | Bacteria | 40353 |
| 140 | Ga0157374_10013013 | 3300013296 | Bacteria | 7255 |
| 141 | Ga0157374_10021785 | 3300013296 | Bacteria | 5708 |
| 142 | Ga0157374_10026180 | 3300013296 | Bacteria | 5246 |
| 143 | Ga0157374_10050333 | 3300013296 | Bacteria | 3872 |
| 144 | Ga0157374_10087878 | 3300013296 | Bacteria | 2960 |
| 145 | Ga0157378_10028929 | 3300013297 | Unclassified | 4891 |
| 146 | Ga0157378_10497746 | 3300013297 | Unclassified | 1217 |
| 147 | Ga0163162_10049309 | 3300013306 | Unclassified | 4220 |
| 148 | Ga0163162_10286009 | 3300013306 | Bacteria | 1781 |
| 149 | Ga0163162_10688525 | 3300013306 | Bacteria | 1144 |
| 150 | Ga0163162_11172923 | 3300013306 | Unclassified | 871 |
| 151 | Ga0157372_10020137 | 3300013307 | Bacteria | 7194 |
| 152 | Ga0157372_11009094 | 3300013307 | Unclassified | 964 |
| 153 | Ga0157375_10010780 | 3300013308 | Bacteria | 8052 |
| 154 | Ga0157375_10051478 | 3300013308 | Bacteria | 4044 |
| 155 | Ga0157375_10464231 | 3300013308 | Unclassified | 1431 |
| 156 | Ga0157375_10913255 | 3300013308 | Unclassified | 1021 |
| 157 | Ga0157375_11337352 | 3300013308 | Unclassified | 843 |
| 158 | Ga0163163_10020791 | 3300014325 | Bacteria | 6187 |
| 159 | Ga0163163_10041481 | 3300014325 | Unclassified | 4500 |
| 160 | Ga0163163_10184772 | 3300014325 | Bacteria | 2132 |
| 161 | Ga0163163_10795209 | 3300014325 | Unclassified | 1009 |
| 162 | Ga0157377_10010765 | 3300014745 | Bacteria | 4538 |
| 163 | Ga0157377_10033455 | 3300014745 | Bacteria | 2807 |
| 164 | Ga0157377_10117136 | 3300014745 | Bacteria | 1609 |
| 165 | Ga0157379_10001205 | 3300014968 | Bacteria | 21029 |
| 166 | Ga0157379_10043679 | 3300014968 | Bacteria | 4001 |
| 167 | Ga0157376_10012767 | 3300014969 | Bacteria | 6247 |
| 168 | Ga0157376_10205719 | 3300014969 | Unclassified | 1814 |
| 169 | Ga0157376_10303320 | 3300014969 | Bacteria | 1512 |
| 170 | Ga0182007_10068451 | 3300015262 | Unclassified | 1163 |
| 171 | Ga0207656_10051857 | 3300025321 | Bacteria | 1775 |
| 172 | Ga0207692_10319731 | 3300025898 | Unclassified | 949 |
| 173 | Ga0207642_10112721 | 3300025899 | Bacteria | 1388 |
| 174 | Ga0207710_10192572 | 3300025900 | Unclassified | 1004 |
| 175 | Ga0207680_10059405 | 3300025903 | Unclassified | 2323 |
| 176 | Ga0207647_10011317 | 3300025904 | Bacteria | 6263 |
| 177 | Ga0207685_10090774 | 3300025905 | Bacteria | 1286 |
| 178 | Ga0207684_10001403 | 3300025910 | Bacteria | 26185 |
| 179 | Ga0207684_10041352 | 3300025910 | Bacteria | 3909 |
| 180 | Ga0207684_10050511 | 3300025910 | Unclassified | 3528 |
| 181 | Ga0207684_10163380 | 3300025910 | Bacteria | 1918 |
| 182 | Ga0207684_10458593 | 3300025910 | Unclassified | 1094 |
| 183 | Ga0207695_10056714 | 3300025913 | Bacteria | 4075 |
| 184 | Ga0207693_10036264 | 3300025915 | Bacteria | 3887 |
| 185 | Ga0207693_10366543 | 3300025915 | Bacteria | 1127 |
| 186 | Ga0207693_10393941 | 3300025915 | Bacteria | 1083 |
| 187 | Ga0207662_10145316 | 3300025918 | Unclassified | 1505 |
| 188 | Ga0207657_10152234 | 3300025919 | Bacteria | 1883 |
| 189 | Ga0207657_10182423 | 3300025919 | Bacteria | 1696 |
| 190 | Ga0207649_10000513 | 3300025920 | Bacteria | 27268 |
| 191 | Ga0207646_10000037 | 3300025922 | Bacteria | 196362 |
| 192 | Ga0207646_10001071 | 3300025922 | Bacteria | 34859 |
| 193 | Ga0207646_10051996 | 3300025922 | Bacteria | 3665 |
| 194 | Ga0207646_10111113 | 3300025922 | Unclassified | 2460 |
| 195 | Ga0207646_10172462 | 3300025922 | Unclassified | 1953 |
| 196 | Ga0207646_10220908 | 3300025922 | Bacteria | 1712 |
| 197 | Ga0207646_10259067 | 3300025922 | Unclassified | 1572 |
| 198 | Ga0207646_10362414 | 3300025922 | Bacteria | 1309 |
| 199 | Ga0207646_10377468 | 3300025922 | Unclassified | 1281 |
| 200 | Ga0207681_10166123 | 3300025923 | Unclassified | 1669 |
| 201 | Ga0207650_10000059 | 3300025925 | Bacteria | 151427 |
| 202 | Ga0207650_10082396 | 3300025925 | Unclassified | 2442 |
| 203 | Ga0207659_10014083 | 3300025926 | Bacteria | 5149 |
| 204 | Ga0207659_10095123 | 3300025926 | Unclassified | 2234 |
| 205 | Ga0207687_10253637 | 3300025927 | Bacteria | 1400 |
| 206 | Ga0207700_10134961 | 3300025928 | Unclassified | 2020 |
| 207 | Ga0207700_10261734 | 3300025928 | Bacteria | 1481 |
| 208 | Ga0207700_10303051 | 3300025928 | Unclassified | 1380 |
| 209 | Ga0207700_10373528 | 3300025928 | Bacteria | 1245 |
| 210 | Ga0207664_10177361 | 3300025929 | Bacteria | 1828 |
| 211 | Ga0207644_10020075 | 3300025931 | Unclassified | 4539 |
| 212 | Ga0207690_10018279 | 3300025932 | Unclassified | 4298 |
| 213 | Ga0207706_10170569 | 3300025933 | Unclassified | 1912 |
| 214 | Ga0207704_10068208 | 3300025938 | Unclassified | 2241 |
| 215 | Ga0207665_10062223 | 3300025939 | Unclassified | 2532 |
| 216 | Ga0207665_10142066 | 3300025939 | Bacteria | 1713 |
| 217 | Ga0207665_10181874 | 3300025939 | Archaea | 1523 |
| 218 | Ga0207691_10013168 | 3300025940 | Bacteria | 7920 |
| 219 | Ga0207691_10018001 | 3300025940 | Bacteria | 6689 |
| 220 | Ga0207711_10005842 | 3300025941 | Bacteria | 10394 |
| 221 | Ga0207711_10007700 | 3300025941 | Bacteria | 9004 |
| 222 | Ga0207689_10017588 | 3300025942 | Bacteria | 6043 |
| 223 | Ga0207689_10110301 | 3300025942 | Bacteria | 2261 |
| 224 | Ga0207661_10004533 | 3300025944 | Bacteria | 9733 |
| 225 | Ga0207679_10001027 | 3300025945 | Bacteria | 17836 |
| 226 | Ga0207679_10300940 | 3300025945 | Unclassified | 1382 |
| 227 | Ga0207667_10615219 | 3300025949 | Bacteria | 1094 |
| 228 | Ga0207651_10003853 | 3300025960 | Bacteria | 7443 |
| 229 | Ga0207712_10163650 | 3300025961 | Unclassified | 1732 |
| 230 | Ga0207658_10028520 | 3300025986 | Bacteria | 3931 |
| 231 | Ga0207677_10026864 | 3300026023 | Bacteria | 3616 |
| 232 | Ga0207703_10010559 | 3300026035 | Bacteria | 7219 |
| 233 | Ga0207703_10588764 | 3300026035 | Bacteria | 1051 |
| 234 | Ga0207639_10583471 | 3300026041 | Unclassified | 1029 |
| 235 | Ga0207639_10721706 | 3300026041 | Bacteria | 925 |
| 236 | Ga0207678_10013492 | 3300026067 | Bacteria | 7174 |
| 237 | Ga0207702_10023516 | 3300026078 | Bacteria | 5111 |
| 238 | Ga0207702_10794528 | 3300026078 | Archaea | 935 |
| 239 | Ga0207641_10000025 | 3300026088 | Bacteria | 247727 |
| 240 | Ga0207641_10014807 | 3300026088 | Bacteria | 6393 |
| 241 | Ga0207641_10373062 | 3300026088 | Bacteria | 1365 |
| 242 | Ga0207676_10000160 | 3300026095 | Bacteria | 58979 |
| 243 | Ga0207676_10443981 | 3300026095 | Unclassified | 1222 |
| 244 | Ga0207674_10000162 | 3300026116 | Bacteria | 79631 |
| 245 | Ga0207683_10041785 | 3300026121 | Unclassified | 4004 |
| 246 | Ga0207683_10046590 | 3300026121 | Unclassified | 3795 |
| 247 | Ga0207698_10057925 | 3300026142 | Unclassified | 3000 |
| 248 | Ga0268266_10001493 | 3300028379 | Bacteria | 27650 |
| 249 | Ga0268266_10002593 | 3300028379 | Bacteria | 19155 |
| 250 | Ga0268266_10091645 | 3300028379 | Viruses | 2665 |
| 251 | Ga0268265_10002498 | 3300028380 | Bacteria | 13798 |
| 252 | Ga0268265_10004079 | 3300028380 | Bacteria | 10261 |
| 253 | Ga0268264_10011195 | 3300028381 | Bacteria | 7410 |
| 254 | Ga0268264_10026196 | 3300028381 | Unclassified | 4762 |
| 255 | Ga0265338_10029879 | 3300028800 | Bacteria | 5391 |
| 256 | Ga0265338_10038732 | 3300028800 | Viruses | 4510 |
| 257 | Ga0265760_10000625 | 3300031090 | Bacteria | 10021 |
| 258 | Ga0265316_10009648 | 3300031344 | Bacteria | 8870 |
| 259 | Ga0265314_10091401 | 3300031711 | Bacteria | 1981 |
| 260 | Ga0307405_10160164 | 3300031731 | Unclassified | 1593 |
| 261 | Ga0307410_10331104 | 3300031852 | Bacteria | 1211 |
| 262 | Ga0373931_0012338 | 3300035691 | Viruses | 4139 |
| 263 | Ga0373931_0201421 | 3300035691 | Unclassified | 1189 |
| 264 | Ga0373935_0192189 | 3300035692 | Bacteria | 1407 |
| 265 | Ga0373937_0130413 | 3300036401 | Unclassified | 2348 |
| 266 | Ga0495629_0435084 | 3300046459 | Bacteria | 889 |
| 267 | Ga0495580_0002650 | 3300046472 | Bacteria | 15548 |
| 268 | Ga0495580_0024937 | 3300046472 | Bacteria | 4372 |
| 269 | Ga0495580_0028792 | 3300046472 | Bacteria | 4036 |
| 270 | Ga0495580_0214911 | 3300046472 | Unclassified | 1322 |
| 271 | Ga0496101_0357052 | 3300048904 | Unclassified | 1149 |
| 272 | Ga0496105_0542443 | 3300048908 | Unclassified | 909 |
| 273 | Ga0496108_0000203 | 3300048911 | Bacteria | 54921 |
| 274 | Ga0496108_0292345 | 3300048911 | Bacteria | 1419 |
| 275 | Ga0496109_0000099 | 3300048912 | Bacteria | 89901 |
| 276 | Ga0496109_0541164 | 3300048912 | Unclassified | 1099 |
| 277 | Ga0496110_0000189 | 3300048913 | Bacteria | 38583 |
| 278 | Ga0496110_0563813 | 3300048913 | Bacteria | 1035 |
| 279 | Ga0496111_0018686 | 3300048914 | Unclassified | 4805 |
| 280 | Ga0496111_0092356 | 3300048914 | Bacteria | 2219 |
| 281 | Ga0496112_0000048 | 3300048915 | Bacteria | 84789 |
| 282 | Ga0496112_0090889 | 3300048915 | Bacteria | 3022 |
| 283 | Ga0496112_0136515 | 3300048915 | Bacteria | 2422 |
| 284 | Ga0496112_0446795 | 3300048915 | Bacteria | 1231 |
| 285 | Ga0496112_0705958 | 3300048915 | Unclassified | 936 |
| 286 | Ga0496113_0000655 | 3300048916 | Bacteria | 17490 |
| 287 | Ga0496113_0168928 | 3300048916 | Bacteria | 1732 |
| 288 | Ga0496115_0448958 | 3300048918 | Bacteria | 1042 |
| 289 | nmdc:mga08x19_241863_c1 | 3300050514 | Bacteria | 1244 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005467 | Ga0070706_100529619 | Ga0070706_1005296192 | 232 |
| 2 | 3300005535 | Ga0070684_100000936 | Ga0070684_1000009365 | 232 |
| 3 | 3300006028 | Ga0070717_10012540 | Ga0070717_100125407 | 232 |
| 4 | 3300025910 | Ga0207684_10458593 | Ga0207684_104585932 | 232 |
| 5 | 3300025915 | Ga0207693_10393941 | Ga0207693_103939412 | 232 |
| 6 | 3300026078 | Ga0207702_10023516 | Ga0207702_100235169 | 234 |
| 7 | 3300005536 | Ga0070697_100125678 | Ga0070697_1001256783 | 243 |
| 8 | 3300006358 | Ga0068871_100324888 | Ga0068871_1003248882 | 256 |
| 9 | 3300005435 | Ga0070714_100061064 | Ga0070714_1000610644 | 265 |
| 10 | 3300005467 | Ga0070706_100354769 | Ga0070706_1003547692 | 265 |
| 11 | 3300005614 | Ga0068856_100002220 | Ga0068856_1000022209 | 265 |
| 12 | 3300025922 | Ga0207646_10377468 | Ga0207646_103774681 | 265 |
| 13 | 3300050514 | nmdc:mga08x19_241863_c1 | nmdc:mga08x19_241863_c1_25_825 | 265 |
| 14 | 3300002459 | JGI24751J29686_10007902 | JGI24751J29686_100079022 | 266 |
| 15 | 3300005329 | Ga0070683_100002123 | Ga0070683_1000021235 | 266 |
| 16 | 3300005331 | Ga0070670_100034927 | Ga0070670_1000349275 | 266 |
| 17 | 3300005334 | Ga0068869_100002923 | Ga0068869_1000029239 | 266 |
| 18 | 3300005334 | Ga0068869_100189148 | Ga0068869_1001891482 | 266 |
| 19 | 3300005335 | Ga0070666_10033227 | Ga0070666_100332273 | 266 |
| 20 | 3300005338 | Ga0068868_100307165 | Ga0068868_1003071652 | 266 |
| 21 | 3300005338 | Ga0068868_100330740 | Ga0068868_1003307402 | 266 |
| 22 | 3300005340 | Ga0070689_100006429 | Ga0070689_1000064296 | 266 |
| 23 | 3300005343 | Ga0070687_100010174 | Ga0070687_1000101743 | 266 |
| 24 | 3300005344 | Ga0070661_100005018 | Ga0070661_1000050185 | 266 |
| 25 | 3300005353 | Ga0070669_100011144 | Ga0070669_1000111443 | 266 |
| 26 | 3300005354 | Ga0070675_100120243 | Ga0070675_1001202433 | 266 |
| 27 | 3300005355 | Ga0070671_100017553 | Ga0070671_1000175534 | 266 |
| 28 | 3300005355 | Ga0070671_100379146 | Ga0070671_1003791462 | 266 |
| 29 | 3300005364 | Ga0070673_100000589 | Ga0070673_10000058910 | 266 |
| 30 | 3300005365 | Ga0070688_100002679 | Ga0070688_1000026799 | 266 |
| 31 | 3300005365 | Ga0070688_100218329 | Ga0070688_1002183292 | 266 |
| 32 | 3300005367 | Ga0070667_100013226 | Ga0070667_1000132265 | 266 |
| 33 | 3300005436 | Ga0070713_100098134 | Ga0070713_1000981342 | 266 |
| 34 | 3300005436 | Ga0070713_100224646 | Ga0070713_1002246462 | 266 |
| 35 | 3300005436 | Ga0070713_100239198 | Ga0070713_1002391982 | 266 |
| 36 | 3300005438 | Ga0070701_10101954 | Ga0070701_101019543 | 266 |
| 37 | 3300005445 | Ga0070708_100010876 | Ga0070708_1000108764 | 266 |
| 38 | 3300005445 | Ga0070708_100017626 | Ga0070708_1000176262 | 266 |
| 39 | 3300005445 | Ga0070708_100036377 | Ga0070708_1000363773 | 266 |
| 40 | 3300005445 | Ga0070708_100061880 | Ga0070708_1000618805 | 266 |
| 41 | 3300005445 | Ga0070708_100108447 | Ga0070708_1001084473 | 266 |
| 42 | 3300005445 | Ga0070708_100112167 | Ga0070708_1001121673 | 266 |
| 43 | 3300005445 | Ga0070708_100136122 | Ga0070708_1001361223 | 266 |
| 44 | 3300005445 | Ga0070708_100174583 | Ga0070708_1001745833 | 266 |
| 45 | 3300005445 | Ga0070708_100318713 | Ga0070708_1003187132 | 266 |
| 46 | 3300005445 | Ga0070708_100335121 | Ga0070708_1003351212 | 266 |
| 47 | 3300005445 | Ga0070708_100436992 | Ga0070708_1004369921 | 266 |
| 48 | 3300005445 | Ga0070708_100474370 | Ga0070708_1004743702 | 266 |
| 49 | 3300005455 | Ga0070663_100001276 | Ga0070663_1000012765 | 266 |
| 50 | 3300005456 | Ga0070678_100039990 | Ga0070678_1000399904 | 266 |
| 51 | 3300005457 | Ga0070662_100447606 | Ga0070662_1004476062 | 266 |
| 52 | 3300005458 | Ga0070681_10590634 | Ga0070681_105906341 | 266 |
| 53 | 3300005459 | Ga0068867_100480690 | Ga0068867_1004806901 | 266 |
| 54 | 3300005466 | Ga0070685_10003008 | Ga0070685_100030085 | 266 |
| 55 | 3300005466 | Ga0070685_10021576 | Ga0070685_100215764 | 266 |
| 56 | 3300005467 | Ga0070706_100001557 | Ga0070706_1000015573 | 266 |
| 57 | 3300005467 | Ga0070706_100045984 | Ga0070706_1000459846 | 266 |
| 58 | 3300005467 | Ga0070706_100197405 | Ga0070706_1001974053 | 266 |
| 59 | 3300005467 | Ga0070706_100211573 | Ga0070706_1002115732 | 266 |
| 60 | 3300005467 | Ga0070706_100574900 | Ga0070706_1005749002 | 266 |
| 61 | 3300005468 | Ga0070707_100004133 | Ga0070707_10000413314 | 266 |
| 62 | 3300005468 | Ga0070707_100142261 | Ga0070707_1001422612 | 266 |
| 63 | 3300005468 | Ga0070707_100238569 | Ga0070707_1002385692 | 266 |
| 64 | 3300005468 | Ga0070707_100455839 | Ga0070707_1004558392 | 266 |
| 65 | 3300005471 | Ga0070698_100001653 | Ga0070698_10000165326 | 266 |
| 66 | 3300005471 | Ga0070698_100267439 | Ga0070698_1002674391 | 266 |
| 67 | 3300005518 | Ga0070699_100071496 | Ga0070699_1000714965 | 266 |
| 68 | 3300005518 | Ga0070699_100092128 | Ga0070699_1000921282 | 266 |
| 69 | 3300005518 | Ga0070699_100121967 | Ga0070699_1001219672 | 266 |
| 70 | 3300005518 | Ga0070699_100440608 | Ga0070699_1004406081 | 266 |
| 71 | 3300005536 | Ga0070697_100012716 | Ga0070697_1000127168 | 266 |
| 72 | 3300005536 | Ga0070697_100037401 | Ga0070697_1000374014 | 266 |
| 73 | 3300005536 | Ga0070697_100046666 | Ga0070697_1000466666 | 266 |
| 74 | 3300005536 | Ga0070697_100354615 | Ga0070697_1003546151 | 266 |
| 75 | 3300005536 | Ga0070697_100409281 | Ga0070697_1004092811 | 266 |
| 76 | 3300005536 | Ga0070697_100435275 | Ga0070697_1004352751 | 266 |
| 77 | 3300005536 | Ga0070697_100692917 | Ga0070697_1006929171 | 266 |
| 78 | 3300005539 | Ga0068853_100152117 | Ga0068853_1001521171 | 266 |
| 79 | 3300005543 | Ga0070672_100000364 | Ga0070672_10000036412 | 266 |
| 80 | 3300005548 | Ga0070665_100010125 | Ga0070665_1000101259 | 266 |
| 81 | 3300005548 | Ga0070665_100027710 | Ga0070665_1000277104 | 266 |
| 82 | 3300005548 | Ga0070665_100553918 | Ga0070665_1005539182 | 266 |
| 83 | 3300005564 | Ga0070664_100002544 | Ga0070664_1000025448 | 266 |
| 84 | 3300005564 | Ga0070664_100088765 | Ga0070664_1000887652 | 266 |
| 85 | 3300005577 | Ga0068857_100001315 | Ga0068857_1000013159 | 266 |
| 86 | 3300005577 | Ga0068857_100039101 | Ga0068857_1000391016 | 266 |
| 87 | 3300005614 | Ga0068856_100516038 | Ga0068856_1005160382 | 266 |
| 88 | 3300005617 | Ga0068859_100003313 | Ga0068859_1000033134 | 266 |
| 89 | 3300005618 | Ga0068864_100000879 | Ga0068864_1000008794 | 266 |
| 90 | 3300005618 | Ga0068864_100001704 | Ga0068864_1000017048 | 266 |
| 91 | 3300005834 | Ga0068851_10064091 | Ga0068851_100640913 | 266 |
| 92 | 3300005841 | Ga0068863_100001146 | Ga0068863_1000011466 | 266 |
| 93 | 3300005841 | Ga0068863_100002863 | Ga0068863_1000028636 | 266 |
| 94 | 3300005841 | Ga0068863_100006619 | Ga0068863_1000066196 | 266 |
| 95 | 3300005842 | Ga0068858_100008599 | Ga0068858_1000085998 | 266 |
| 96 | 3300005842 | Ga0068858_100609196 | Ga0068858_1006091962 | 266 |
| 97 | 3300005843 | Ga0068860_100014700 | Ga0068860_1000147006 | 266 |
| 98 | 3300005843 | Ga0068860_100059515 | Ga0068860_1000595154 | 266 |
| 99 | 3300005844 | Ga0068862_100003035 | Ga0068862_1000030355 | 266 |
| 100 | 3300006028 | Ga0070717_10036785 | Ga0070717_100367854 | 266 |
| 101 | 3300006028 | Ga0070717_10114071 | Ga0070717_101140713 | 266 |
| 102 | 3300006028 | Ga0070717_10201854 | Ga0070717_102018543 | 266 |
| 103 | 3300006175 | Ga0070712_100056559 | Ga0070712_1000565592 | 266 |
| 104 | 3300006175 | Ga0070712_100431642 | Ga0070712_1004316422 | 266 |
| 105 | 3300006175 | Ga0070712_100449574 | Ga0070712_1004495741 | 266 |
| 106 | 3300006237 | Ga0097621_100008738 | Ga0097621_1000087385 | 266 |
| 107 | 3300006358 | Ga0068871_100009017 | Ga0068871_1000090175 | 266 |
| 108 | 3300006881 | Ga0068865_100187704 | Ga0068865_1001877042 | 266 |
| 109 | 3300006931 | Ga0097620_100003313 | Ga0097620_1000033134 | 266 |
| 110 | 3300009093 | Ga0105240_10088248 | Ga0105240_100882483 | 266 |
| 111 | 3300009101 | Ga0105247_10061835 | Ga0105247_100618354 | 266 |
| 112 | 3300009147 | Ga0114129_11325628 | Ga0114129_113256281 | 266 |
| 113 | 3300009176 | Ga0105242_10774792 | Ga0105242_107747922 | 266 |
| 114 | 3300009177 | Ga0105248_10012614 | Ga0105248_100126144 | 266 |
| 115 | 3300009177 | Ga0105248_10409932 | Ga0105248_104099322 | 266 |
| 116 | 3300009553 | Ga0105249_10276624 | Ga0105249_102766242 | 266 |
| 117 | 3300010375 | Ga0105239_10145945 | Ga0105239_101459452 | 266 |
| 118 | 3300011119 | Ga0105246_10001222 | Ga0105246_100012222 | 266 |
| 119 | 3300011119 | Ga0105246_10281870 | Ga0105246_102818702 | 266 |
| 120 | 3300013102 | Ga0157371_10164485 | Ga0157371_101644851 | 266 |
| 121 | 3300013105 | Ga0157369_10019781 | Ga0157369_100197814 | 266 |
| 122 | 3300013105 | Ga0157369_10042779 | Ga0157369_100427793 | 266 |
| 123 | 3300013105 | Ga0157369_10700927 | Ga0157369_107009271 | 266 |
| 124 | 3300013296 | Ga0157374_10000388 | Ga0157374_1000038817 | 266 |
| 125 | 3300013296 | Ga0157374_10013013 | Ga0157374_100130135 | 266 |
| 126 | 3300013296 | Ga0157374_10050333 | Ga0157374_100503332 | 266 |
| 127 | 3300013296 | Ga0157374_10087878 | Ga0157374_100878784 | 266 |
| 128 | 3300013297 | Ga0157378_10028929 | Ga0157378_100289292 | 266 |
| 129 | 3300013297 | Ga0157378_10497746 | Ga0157378_104977462 | 266 |
| 130 | 3300013306 | Ga0163162_10049309 | Ga0163162_100493094 | 266 |
| 131 | 3300013306 | Ga0163162_10286009 | Ga0163162_102860092 | 266 |
| 132 | 3300013306 | Ga0163162_10688525 | Ga0163162_106885251 | 266 |
| 133 | 3300013306 | Ga0163162_11172923 | Ga0163162_111729231 | 266 |
| 134 | 3300013307 | Ga0157372_10020137 | Ga0157372_100201374 | 266 |
| 135 | 3300013307 | Ga0157372_11009094 | Ga0157372_110090941 | 266 |
| 136 | 3300013308 | Ga0157375_10010780 | Ga0157375_100107803 | 266 |
| 137 | 3300013308 | Ga0157375_10464231 | Ga0157375_104642312 | 266 |
| 138 | 3300013308 | Ga0157375_10913255 | Ga0157375_109132552 | 266 |
| 139 | 3300013308 | Ga0157375_11337352 | Ga0157375_113373521 | 266 |
| 140 | 3300014325 | Ga0163163_10041481 | Ga0163163_100414814 | 266 |
| 141 | 3300014325 | Ga0163163_10795209 | Ga0163163_107952092 | 266 |
| 142 | 3300014745 | Ga0157377_10010765 | Ga0157377_100107654 | 266 |
| 143 | 3300014745 | Ga0157377_10117136 | Ga0157377_101171362 | 266 |
| 144 | 3300014968 | Ga0157379_10001205 | Ga0157379_1000120510 | 266 |
| 145 | 3300014969 | Ga0157376_10012767 | Ga0157376_100127676 | 266 |
| 146 | 3300014969 | Ga0157376_10205719 | Ga0157376_102057192 | 266 |
| 147 | 3300025899 | Ga0207642_10112721 | Ga0207642_101127212 | 266 |
| 148 | 3300025900 | Ga0207710_10192572 | Ga0207710_101925722 | 266 |
| 149 | 3300025903 | Ga0207680_10059405 | Ga0207680_100594052 | 266 |
| 150 | 3300025904 | Ga0207647_10011317 | Ga0207647_100113175 | 266 |
| 151 | 3300025905 | Ga0207685_10090774 | Ga0207685_100907742 | 266 |
| 152 | 3300025910 | Ga0207684_10001403 | Ga0207684_100014039 | 266 |
| 153 | 3300025910 | Ga0207684_10041352 | Ga0207684_100413521 | 266 |
| 154 | 3300025910 | Ga0207684_10050511 | Ga0207684_100505112 | 266 |
| 155 | 3300025910 | Ga0207684_10163380 | Ga0207684_101633802 | 266 |
| 156 | 3300025913 | Ga0207695_10056714 | Ga0207695_100567144 | 266 |
| 157 | 3300025915 | Ga0207693_10036264 | Ga0207693_100362644 | 266 |
| 158 | 3300025915 | Ga0207693_10366543 | Ga0207693_103665432 | 266 |
| 159 | 3300025918 | Ga0207662_10145316 | Ga0207662_101453163 | 266 |
| 160 | 3300025919 | Ga0207657_10152234 | Ga0207657_101522343 | 266 |
| 161 | 3300025920 | Ga0207649_10000513 | Ga0207649_1000051315 | 266 |
| 162 | 3300025922 | Ga0207646_10000037 | Ga0207646_100000374 | 266 |
| 163 | 3300025922 | Ga0207646_10001071 | Ga0207646_1000107123 | 266 |
| 164 | 3300025922 | Ga0207646_10051996 | Ga0207646_100519965 | 266 |
| 165 | 3300025922 | Ga0207646_10111113 | Ga0207646_101111133 | 266 |
| 166 | 3300025922 | Ga0207646_10172462 | Ga0207646_101724623 | 266 |
| 167 | 3300025922 | Ga0207646_10220908 | Ga0207646_102209082 | 266 |
| 168 | 3300025922 | Ga0207646_10259067 | Ga0207646_102590673 | 266 |
| 169 | 3300025922 | Ga0207646_10362414 | Ga0207646_103624141 | 266 |
| 170 | 3300025923 | Ga0207681_10166123 | Ga0207681_101661232 | 266 |
| 171 | 3300025925 | Ga0207650_10000059 | Ga0207650_1000005952 | 266 |
| 172 | 3300025925 | Ga0207650_10082396 | Ga0207650_100823963 | 266 |
| 173 | 3300025926 | Ga0207659_10095123 | Ga0207659_100951233 | 266 |
| 174 | 3300025927 | Ga0207687_10253637 | Ga0207687_102536372 | 266 |
| 175 | 3300025928 | Ga0207700_10134961 | Ga0207700_101349612 | 266 |
| 176 | 3300025928 | Ga0207700_10261734 | Ga0207700_102617342 | 266 |
| 177 | 3300025928 | Ga0207700_10303051 | Ga0207700_103030512 | 266 |
| 178 | 3300025928 | Ga0207700_10373528 | Ga0207700_103735282 | 266 |
| 179 | 3300025929 | Ga0207664_10177361 | Ga0207664_101773613 | 266 |
| 180 | 3300025931 | Ga0207644_10020075 | Ga0207644_100200755 | 266 |
| 181 | 3300025932 | Ga0207690_10018279 | Ga0207690_100182796 | 266 |
| 182 | 3300025933 | Ga0207706_10170569 | Ga0207706_101705693 | 266 |
| 183 | 3300025938 | Ga0207704_10068208 | Ga0207704_100682082 | 266 |
| 184 | 3300025939 | Ga0207665_10062223 | Ga0207665_100622234 | 266 |
| 185 | 3300025939 | Ga0207665_10142066 | Ga0207665_101420661 | 266 |
| 186 | 3300025939 | Ga0207665_10181874 | Ga0207665_101818742 | 266 |
| 187 | 3300025940 | Ga0207691_10018001 | Ga0207691_100180015 | 266 |
| 188 | 3300025941 | Ga0207711_10005842 | Ga0207711_100058423 | 266 |
| 189 | 3300025942 | Ga0207689_10017588 | Ga0207689_100175883 | 266 |
| 190 | 3300025942 | Ga0207689_10110301 | Ga0207689_101103013 | 266 |
| 191 | 3300025944 | Ga0207661_10004533 | Ga0207661_1000453310 | 266 |
| 192 | 3300025945 | Ga0207679_10001027 | Ga0207679_100010277 | 266 |
| 193 | 3300025945 | Ga0207679_10300940 | Ga0207679_103009402 | 266 |
| 194 | 3300025949 | Ga0207667_10615219 | Ga0207667_106152192 | 266 |
| 195 | 3300025960 | Ga0207651_10003853 | Ga0207651_100038535 | 266 |
| 196 | 3300025961 | Ga0207712_10163650 | Ga0207712_101636503 | 266 |
| 197 | 3300025986 | Ga0207658_10028520 | Ga0207658_100285203 | 266 |
| 198 | 3300026023 | Ga0207677_10026864 | Ga0207677_100268644 | 266 |
| 199 | 3300026035 | Ga0207703_10010559 | Ga0207703_100105596 | 266 |
| 200 | 3300026035 | Ga0207703_10588764 | Ga0207703_105887642 | 266 |
| 201 | 3300026041 | Ga0207639_10583471 | Ga0207639_105834711 | 266 |
| 202 | 3300026041 | Ga0207639_10721706 | Ga0207639_107217061 | 266 |
| 203 | 3300026067 | Ga0207678_10013492 | Ga0207678_100134926 | 266 |
| 204 | 3300026078 | Ga0207702_10794528 | Ga0207702_107945282 | 266 |
| 205 | 3300026088 | Ga0207641_10000025 | Ga0207641_1000002554 | 266 |
| 206 | 3300026088 | Ga0207641_10014807 | Ga0207641_100148077 | 266 |
| 207 | 3300026088 | Ga0207641_10373062 | Ga0207641_103730622 | 266 |
| 208 | 3300026095 | Ga0207676_10000160 | Ga0207676_1000016040 | 266 |
| 209 | 3300026095 | Ga0207676_10443981 | Ga0207676_104439812 | 266 |
| 210 | 3300026116 | Ga0207674_10000162 | Ga0207674_1000016210 | 266 |
| 211 | 3300026121 | Ga0207683_10046590 | Ga0207683_100465905 | 266 |
| 212 | 3300026142 | Ga0207698_10057925 | Ga0207698_100579252 | 266 |
| 213 | 3300028379 | Ga0268266_10001493 | Ga0268266_100014934 | 266 |
| 214 | 3300028379 | Ga0268266_10002593 | Ga0268266_1000259313 | 266 |
| 215 | 3300028380 | Ga0268265_10004079 | Ga0268265_100040796 | 266 |
| 216 | 3300028381 | Ga0268264_10026196 | Ga0268264_100261964 | 266 |
| 217 | 3300028800 | Ga0265338_10029879 | Ga0265338_100298794 | 266 |
| 218 | 3300028800 | Ga0265338_10038732 | Ga0265338_100387324 | 266 |
| 219 | 3300031090 | Ga0265760_10000625 | Ga0265760_100006259 | 266 |
| 220 | 3300031344 | Ga0265316_10009648 | Ga0265316_100096482 | 266 |
| 221 | 3300031711 | Ga0265314_10091401 | Ga0265314_100914012 | 266 |
| 222 | 3300035691 | Ga0373931_0012338 | Ga0373931_0012338_685_1488 | 266 |
| 223 | 3300035691 | Ga0373931_0201421 | Ga0373931_0201421_57_860 | 266 |
| 224 | 3300035692 | Ga0373935_0192189 | Ga0373935_0192189_69_872 | 266 |
| 225 | 3300036401 | Ga0373937_0130413 | Ga0373937_0130413_229_1032 | 266 |
| 226 | 3300046459 | Ga0495629_0435084 | Ga0495629_0435084_21_824 | 266 |
| 227 | 3300046472 | Ga0495580_0002650 | Ga0495580_0002650_8145_8948 | 266 |
| 228 | 3300046472 | Ga0495580_0024937 | Ga0495580_0024937_2103_2906 | 266 |
| 229 | 3300046472 | Ga0495580_0028792 | Ga0495580_0028792_2242_3045 | 266 |
| 230 | 3300046472 | Ga0495580_0214911 | Ga0495580_0214911_315_1118 | 266 |
| 231 | 3300048904 | Ga0496101_0357052 | Ga0496101_0357052_228_1031 | 266 |
| 232 | 3300048908 | Ga0496105_0542443 | Ga0496105_0542443_52_855 | 266 |
| 233 | 3300048911 | Ga0496108_0000203 | Ga0496108_0000203_21351_22151 | 266 |
| 234 | 3300048911 | Ga0496108_0292345 | Ga0496108_0292345_352_1152 | 266 |
| 235 | 3300048912 | Ga0496109_0000099 | Ga0496109_0000099_11499_12299 | 266 |
| 236 | 3300048912 | Ga0496109_0541164 | Ga0496109_0541164_51_854 | 266 |
| 237 | 3300048913 | Ga0496110_0000189 | Ga0496110_0000189_33091_33891 | 266 |
| 238 | 3300048913 | Ga0496110_0563813 | Ga0496110_0563813_22_825 | 266 |
| 239 | 3300048914 | Ga0496111_0018686 | Ga0496111_0018686_348_1148 | 266 |
| 240 | 3300048914 | Ga0496111_0092356 | Ga0496111_0092356_888_1688 | 266 |
| 241 | 3300048915 | Ga0496112_0000048 | Ga0496112_0000048_65930_66730 | 266 |
| 242 | 3300048915 | Ga0496112_0090889 | Ga0496112_0090889_2111_2911 | 266 |
| 243 | 3300048915 | Ga0496112_0136515 | Ga0496112_0136515_104_904 | 266 |
| 244 | 3300048915 | Ga0496112_0705958 | Ga0496112_0705958_123_926 | 266 |
| 245 | 3300048916 | Ga0496113_0000655 | Ga0496113_0000655_2705_3505 | 266 |
| 246 | 3300048916 | Ga0496113_0168928 | Ga0496113_0168928_483_1283 | 266 |
| 247 | 3300048918 | Ga0496115_0448958 | Ga0496115_0448958_59_859 | 266 |
| 248 | 3300005614 | Ga0068856_100315106 | Ga0068856_1003151063 | 267 |
| 249 | 3300010375 | Ga0105239_10464960 | Ga0105239_104649602 | 267 |
| 250 | 3300013296 | Ga0157374_10026180 | Ga0157374_100261806 | 267 |
| 251 | 3300014325 | Ga0163163_10184772 | Ga0163163_101847722 | 267 |
| 252 | 3300015262 | Ga0182007_10068451 | Ga0182007_100684512 | 267 |
| 253 | 3300025898 | Ga0207692_10319731 | Ga0207692_103197311 | 267 |
| 254 | 3300031731 | Ga0307405_10160164 | Ga0307405_101601642 | 267 |
| 255 | 3300031852 | Ga0307410_10331104 | Ga0307410_103311042 | 267 |
| 256 | 3300048915 | Ga0496112_0446795 | Ga0496112_0446795_206_1012 | 267 |
| 257 | 3300001976 | JGI24752J21851_1002278 | JGI24752J21851_10022783 | 284 |
| 258 | 3300005290 | Ga0065712_10093442 | Ga0065712_100934423 | 284 |
| 259 | 3300005329 | Ga0070683_100030202 | Ga0070683_1000302024 | 284 |
| 260 | 3300005331 | Ga0070670_100016220 | Ga0070670_1000162204 | 284 |
| 261 | 3300005334 | Ga0068869_100000409 | Ga0068869_10000040918 | 284 |
| 262 | 3300005340 | Ga0070689_100040215 | Ga0070689_1000402152 | 284 |
| 263 | 3300005344 | Ga0070661_100001327 | Ga0070661_10000132713 | 284 |
| 264 | 3300005354 | Ga0070675_100025351 | Ga0070675_1000253514 | 284 |
| 265 | 3300005355 | Ga0070671_100007177 | Ga0070671_1000071776 | 284 |
| 266 | 3300005455 | Ga0070663_100006247 | Ga0070663_1000062476 | 284 |
| 267 | 3300005455 | Ga0070663_100106632 | Ga0070663_1001066322 | 284 |
| 268 | 3300005535 | Ga0070684_100011359 | Ga0070684_1000113596 | 284 |
| 269 | 3300005617 | Ga0068859_100027742 | Ga0068859_1000277424 | 284 |
| 270 | 3300005842 | Ga0068858_100062001 | Ga0068858_1000620014 | 284 |
| 271 | 3300005844 | Ga0068862_100012726 | Ga0068862_1000127266 | 284 |
| 272 | 3300006931 | Ga0097620_100027739 | Ga0097620_1000277395 | 284 |
| 273 | 3300009101 | Ga0105247_10035107 | Ga0105247_100351073 | 284 |
| 274 | 3300011119 | Ga0105246_10023978 | Ga0105246_100239784 | 284 |
| 275 | 3300013296 | Ga0157374_10021785 | Ga0157374_100217853 | 284 |
| 276 | 3300013308 | Ga0157375_10051478 | Ga0157375_100514784 | 284 |
| 277 | 3300014325 | Ga0163163_10020791 | Ga0163163_100207915 | 284 |
| 278 | 3300014745 | Ga0157377_10033455 | Ga0157377_100334553 | 284 |
| 279 | 3300014968 | Ga0157379_10043679 | Ga0157379_100436794 | 284 |
| 280 | 3300014969 | Ga0157376_10303320 | Ga0157376_103033202 | 284 |
| 281 | 3300025321 | Ga0207656_10051857 | Ga0207656_100518572 | 284 |
| 282 | 3300025919 | Ga0207657_10182423 | Ga0207657_101824233 | 284 |
| 283 | 3300025926 | Ga0207659_10014083 | Ga0207659_100140834 | 284 |
| 284 | 3300025940 | Ga0207691_10013168 | Ga0207691_100131686 | 284 |
| 285 | 3300025941 | Ga0207711_10007700 | Ga0207711_100077006 | 284 |
| 286 | 3300026121 | Ga0207683_10041785 | Ga0207683_100417852 | 284 |
| 287 | 3300028379 | Ga0268266_10091645 | Ga0268266_100916452 | 284 |
| 288 | 3300028380 | Ga0268265_10002498 | Ga0268265_100024985 | 284 |
| 289 | 3300028381 | Ga0268264_10011195 | Ga0268264_100111955 | 284 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3k70-assembly2.cif.gz_E | crystal structure of the complete initiation complex of recbcd | 0.5723 | 138 | 222 |
| 3ulc-assembly1.cif.gz_A-2 | crystal structure of the pleckstrin homology domain of saccharomyces cerevisiae avo1, a torc2 subunit, in the p3121 crystal form | 0.5711 | 194 | 231 |
| 5zyu-assembly2.cif.gz_B | the crystal structure of humanmgme1 with single strand dna2 | 0.5681 | 18 | 231 |
| 5zyv-assembly1.cif.gz_A | crystal structure of human mgme1 with single strand dna2 and ca2+ | 0.5563 | 21 | 231 |
| 5zyt-assembly2.cif.gz_B | crystal structure of human mgme1 with 3' overhang double strand dna3 | 0.5504 | 21 | 231 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q4D018_3_106_1.20.1310.10 | Mainly Alpha;Up-down Bundle;5 helical Cullin repeat like;Cullin Repeats | 0.7414 | 51 | 85 | 1.20.1310.10 |
| 5mbvB05 | Alpha Beta;Alpha-Beta Complex;Lambda Exonuclease; Chain A; | 0.5887 | 131 | 222 | 3.90.320.10 |
| af_A9QY30_44_274_3.90.320.10 | Alpha Beta;Alpha-Beta Complex;Lambda Exonuclease; Chain A; | 0.5859 | 51 | 232 | 3.90.320.10 |
| af_B8A4D5_139_334_3.90.320.10 | Alpha Beta;Alpha-Beta Complex;Lambda Exonuclease; Chain A; | 0.5749 | 51 | 231 | 3.90.320.10 |
| 5ld2B05 | Alpha Beta;Alpha-Beta Complex;Lambda Exonuclease; Chain A; | 0.5737 | 136 | 222 | 3.90.320.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V9NFZ3-F1-model_v4 | PD-(D/E)XK endonuclease-like domain-containing protein | 0.9495 | 19 | 112 |
|
| AF-A0A2V9MR30-F1-model_v4 | PD-(D/E)XK endonuclease-like domain-containing protein | 0.9473 | 19 | 196 |
|
| AF-A0A2V9WJG4-F1-model_v4 | PD-(D/E)XK endonuclease-like domain-containing protein | 0.9426 | 19 | 252 |
|
| AF-A0A2V9MR30-F1-model_v4 | PD-(D/E)XK endonuclease-like domain-containing protein | 0.9422 | 19 | 196 |
|
| AF-A0A838JA83-F1-model_v4 | PD-(D/E)XK nuclease family protein | 0.938 | 19 | 177 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar