F389248

General Info

Members Datasets Scaffolds Average Seq Length
289 140 289 268

Family's Representative Sequence

Representative Sequence 3300026078|Ga0207702_10023516|Ga0207702_100235169
Length 234
Sequence MMFSYTQLSQYLTCPRRYRLRYLEGWREKDTRAAVLFGRGFELALGAYFRREDPGDVLFREWALYKNELLQFSNQDTWDRMLEQGIMLLTRFCQDNRIQVADPQKNLQIKISRQIAGNEFVGYVDGIGKLDGKQRLLEWKTSSYRYPEKPAELLTLDPQLVCYSWLTGIAEVAQVVFVRKRMVEVQYLETTIANAQRVEFGQLVEDTIRRIEAGHFLPHSGIRFPQNPCLSCPY

Samples

Sample ID Description Type Environment
1 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
73 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
121 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
123 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
127 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
130 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
131 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
132 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
133 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
134 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
135 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
136 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
137 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
138 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
139 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
140 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0.35
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.23
Rhizosphere 93.77
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1002278 3300001976 Viruses 2563
2 JGI24751J29686_10007902 3300002459 Unclassified 2174
3 Ga0065712_10093442 3300005290 Unclassified 2292
4 Ga0070683_100002123 3300005329 Bacteria 15651
5 Ga0070683_100030202 3300005329 Bacteria 4915
6 Ga0070670_100016220 3300005331 Bacteria 6396
7 Ga0070670_100034927 3300005331 Bacteria 4327
8 Ga0068869_100000409 3300005334 Bacteria 23378
9 Ga0068869_100002923 3300005334 Bacteria 10365
10 Ga0068869_100189148 3300005334 Bacteria 1618
11 Ga0070666_10033227 3300005335 Bacteria 3412
12 Ga0068868_100307165 3300005338 Unclassified 1349
13 Ga0068868_100330740 3300005338 Unclassified 1300
14 Ga0070689_100006429 3300005340 Bacteria 8129
15 Ga0070689_100040215 3300005340 Bacteria 3584
16 Ga0070687_100010174 3300005343 Bacteria 4056
17 Ga0070661_100001327 3300005344 Bacteria 17332
18 Ga0070661_100005018 3300005344 Bacteria 9120
19 Ga0070669_100011144 3300005353 Bacteria 6381
20 Ga0070675_100025351 3300005354 Bacteria 4754
21 Ga0070675_100120243 3300005354 Unclassified 2231
22 Ga0070671_100007177 3300005355 Bacteria 8906
23 Ga0070671_100017553 3300005355 Bacteria 5799
24 Ga0070671_100379146 3300005355 Unclassified 1208
25 Ga0070673_100000589 3300005364 Bacteria 19744
26 Ga0070688_100002679 3300005365 Bacteria 9041
27 Ga0070688_100218329 3300005365 Bacteria 1342
28 Ga0070667_100013226 3300005367 Bacteria 6819
29 Ga0070714_100061064 3300005435 Bacteria 3236
30 Ga0070713_100098134 3300005436 Unclassified 2533
31 Ga0070713_100224646 3300005436 Bacteria 1705
32 Ga0070713_100239198 3300005436 Bacteria 1653
33 Ga0070701_10101954 3300005438 Unclassified 1591
34 Ga0070708_100010876 3300005445 Bacteria 7391
35 Ga0070708_100017626 3300005445 Bacteria 5962
36 Ga0070708_100036377 3300005445 Unclassified 4294
37 Ga0070708_100061880 3300005445 Bacteria 3345
38 Ga0070708_100108447 3300005445 Bacteria 2550
39 Ga0070708_100112167 3300005445 Unclassified 2507
40 Ga0070708_100136122 3300005445 Bacteria 2276
41 Ga0070708_100174583 3300005445 Bacteria 2007
42 Ga0070708_100318713 3300005445 Unclassified 1464
43 Ga0070708_100335121 3300005445 Archaea 1426
44 Ga0070708_100436992 3300005445 Unclassified 1234
45 Ga0070708_100474370 3300005445 Bacteria 1180
46 Ga0070663_100001276 3300005455 Bacteria 13788
47 Ga0070663_100006247 3300005455 Bacteria 7143
48 Ga0070663_100106632 3300005455 Bacteria 2099
49 Ga0070678_100039990 3300005456 Unclassified 3314
50 Ga0070662_100447606 3300005457 Unclassified 1072
51 Ga0070681_10590634 3300005458 Unclassified 1025
52 Ga0068867_100480690 3300005459 Bacteria 1064
53 Ga0070685_10003008 3300005466 Bacteria 8595
54 Ga0070685_10021576 3300005466 Bacteria 3501
55 Ga0070706_100001557 3300005467 Bacteria 23929
56 Ga0070706_100045984 3300005467 Unclassified 4030
57 Ga0070706_100197405 3300005467 Bacteria 1880
58 Ga0070706_100211573 3300005467 Bacteria 1811
59 Ga0070706_100354769 3300005467 Bacteria 1367
60 Ga0070706_100529619 3300005467 Unclassified 1096
61 Ga0070706_100574900 3300005467 Unclassified 1048
62 Ga0070707_100004133 3300005468 Bacteria 13605
63 Ga0070707_100142261 3300005468 Unclassified 2335
64 Ga0070707_100238569 3300005468 Bacteria 1770
65 Ga0070707_100455839 3300005468 Unclassified 1239
66 Ga0070698_100001653 3300005471 Bacteria 24861
67 Ga0070698_100267439 3300005471 Bacteria 1641
68 Ga0070699_100071496 3300005518 Bacteria 3017
69 Ga0070699_100092128 3300005518 Bacteria 2651
70 Ga0070699_100121967 3300005518 Bacteria 2293
71 Ga0070699_100440608 3300005518 Bacteria 1180
72 Ga0070684_100000936 3300005535 Bacteria 20753
73 Ga0070684_100011359 3300005535 Bacteria 7092
74 Ga0070697_100012716 3300005536 Bacteria 6589
75 Ga0070697_100037401 3300005536 Bacteria 3921
76 Ga0070697_100046666 3300005536 Unclassified 3511
77 Ga0070697_100125678 3300005536 Bacteria 2148
78 Ga0070697_100354615 3300005536 Bacteria 1267
79 Ga0070697_100409281 3300005536 Unclassified 1178
80 Ga0070697_100435275 3300005536 Bacteria 1141
81 Ga0070697_100692917 3300005536 Bacteria 899
82 Ga0068853_100152117 3300005539 Unclassified 2083
83 Ga0070672_100000364 3300005543 Bacteria 26086
84 Ga0070665_100010125 3300005548 Bacteria 9536
85 Ga0070665_100027710 3300005548 Bacteria 5704
86 Ga0070665_100553918 3300005548 Bacteria 1162
87 Ga0070664_100002544 3300005564 Bacteria 14706
88 Ga0070664_100088765 3300005564 Bacteria 2673
89 Ga0068857_100001315 3300005577 Bacteria 19544
90 Ga0068857_100039101 3300005577 Bacteria 4201
91 Ga0068856_100002220 3300005614 Bacteria 20098
92 Ga0068856_100315106 3300005614 Bacteria 1582
93 Ga0068856_100516038 3300005614 Unclassified 1216
94 Ga0068859_100003313 3300005617 Bacteria 16365
95 Ga0068859_100027742 3300005617 Bacteria 5679
96 Ga0068864_100000879 3300005618 Bacteria 25306
97 Ga0068864_100001704 3300005618 Bacteria 18071
98 Ga0068851_10064091 3300005834 Bacteria 1888
99 Ga0068863_100001146 3300005841 Bacteria 26467
100 Ga0068863_100002863 3300005841 Bacteria 17081
101 Ga0068863_100006619 3300005841 Bacteria 11374
102 Ga0068858_100008599 3300005842 Bacteria 9805
103 Ga0068858_100062001 3300005842 Bacteria 3457
104 Ga0068858_100609196 3300005842 Unclassified 1060
105 Ga0068860_100014700 3300005843 Bacteria 7656
106 Ga0068860_100059515 3300005843 Bacteria 3631
107 Ga0068862_100003035 3300005844 Bacteria 14617
108 Ga0068862_100012726 3300005844 Bacteria 6965
109 Ga0070717_10012540 3300006028 Bacteria 6465
110 Ga0070717_10036785 3300006028 Bacteria 3972
111 Ga0070717_10114071 3300006028 Bacteria 2308
112 Ga0070717_10201854 3300006028 Bacteria 1742
113 Ga0070712_100056559 3300006175 Bacteria 2752
114 Ga0070712_100431642 3300006175 Bacteria 1094
115 Ga0070712_100449574 3300006175 Bacteria 1072
116 Ga0097621_100008738 3300006237 Bacteria 7318
117 Ga0068871_100009017 3300006358 Bacteria 7205
118 Ga0068871_100324888 3300006358 Unclassified 1356
119 Ga0068865_100187704 3300006881 Unclassified 1596
120 Ga0097620_100003313 3300006931 Bacteria 16365
121 Ga0097620_100027739 3300006931 Bacteria 5679
122 Ga0105240_10088248 3300009093 Bacteria 3795
123 Ga0105247_10035107 3300009101 Bacteria 3055
124 Ga0105247_10061835 3300009101 Unclassified 2322
125 Ga0114129_11325628 3300009147 Unclassified 891
126 Ga0105242_10774792 3300009176 Unclassified 947
127 Ga0105248_10012614 3300009177 Bacteria 9325
128 Ga0105248_10409932 3300009177 Bacteria 1526
129 Ga0105249_10276624 3300009553 Unclassified 1675
130 Ga0105239_10145945 3300010375 Unclassified 2639
131 Ga0105239_10464960 3300010375 Unclassified 1436
132 Ga0105246_10001222 3300011119 Bacteria 15046
133 Ga0105246_10023978 3300011119 Bacteria 3955
134 Ga0105246_10281870 3300011119 Unclassified 1333
135 Ga0157371_10164485 3300013102 Unclassified 1585
136 Ga0157369_10019781 3300013105 Bacteria 7535
137 Ga0157369_10042779 3300013105 Unclassified 4942
138 Ga0157369_10700927 3300013105 Unclassified 1043
139 Ga0157374_10000388 3300013296 Bacteria 40353
140 Ga0157374_10013013 3300013296 Bacteria 7255
141 Ga0157374_10021785 3300013296 Bacteria 5708
142 Ga0157374_10026180 3300013296 Bacteria 5246
143 Ga0157374_10050333 3300013296 Bacteria 3872
144 Ga0157374_10087878 3300013296 Bacteria 2960
145 Ga0157378_10028929 3300013297 Unclassified 4891
146 Ga0157378_10497746 3300013297 Unclassified 1217
147 Ga0163162_10049309 3300013306 Unclassified 4220
148 Ga0163162_10286009 3300013306 Bacteria 1781
149 Ga0163162_10688525 3300013306 Bacteria 1144
150 Ga0163162_11172923 3300013306 Unclassified 871
151 Ga0157372_10020137 3300013307 Bacteria 7194
152 Ga0157372_11009094 3300013307 Unclassified 964
153 Ga0157375_10010780 3300013308 Bacteria 8052
154 Ga0157375_10051478 3300013308 Bacteria 4044
155 Ga0157375_10464231 3300013308 Unclassified 1431
156 Ga0157375_10913255 3300013308 Unclassified 1021
157 Ga0157375_11337352 3300013308 Unclassified 843
158 Ga0163163_10020791 3300014325 Bacteria 6187
159 Ga0163163_10041481 3300014325 Unclassified 4500
160 Ga0163163_10184772 3300014325 Bacteria 2132
161 Ga0163163_10795209 3300014325 Unclassified 1009
162 Ga0157377_10010765 3300014745 Bacteria 4538
163 Ga0157377_10033455 3300014745 Bacteria 2807
164 Ga0157377_10117136 3300014745 Bacteria 1609
165 Ga0157379_10001205 3300014968 Bacteria 21029
166 Ga0157379_10043679 3300014968 Bacteria 4001
167 Ga0157376_10012767 3300014969 Bacteria 6247
168 Ga0157376_10205719 3300014969 Unclassified 1814
169 Ga0157376_10303320 3300014969 Bacteria 1512
170 Ga0182007_10068451 3300015262 Unclassified 1163
171 Ga0207656_10051857 3300025321 Bacteria 1775
172 Ga0207692_10319731 3300025898 Unclassified 949
173 Ga0207642_10112721 3300025899 Bacteria 1388
174 Ga0207710_10192572 3300025900 Unclassified 1004
175 Ga0207680_10059405 3300025903 Unclassified 2323
176 Ga0207647_10011317 3300025904 Bacteria 6263
177 Ga0207685_10090774 3300025905 Bacteria 1286
178 Ga0207684_10001403 3300025910 Bacteria 26185
179 Ga0207684_10041352 3300025910 Bacteria 3909
180 Ga0207684_10050511 3300025910 Unclassified 3528
181 Ga0207684_10163380 3300025910 Bacteria 1918
182 Ga0207684_10458593 3300025910 Unclassified 1094
183 Ga0207695_10056714 3300025913 Bacteria 4075
184 Ga0207693_10036264 3300025915 Bacteria 3887
185 Ga0207693_10366543 3300025915 Bacteria 1127
186 Ga0207693_10393941 3300025915 Bacteria 1083
187 Ga0207662_10145316 3300025918 Unclassified 1505
188 Ga0207657_10152234 3300025919 Bacteria 1883
189 Ga0207657_10182423 3300025919 Bacteria 1696
190 Ga0207649_10000513 3300025920 Bacteria 27268
191 Ga0207646_10000037 3300025922 Bacteria 196362
192 Ga0207646_10001071 3300025922 Bacteria 34859
193 Ga0207646_10051996 3300025922 Bacteria 3665
194 Ga0207646_10111113 3300025922 Unclassified 2460
195 Ga0207646_10172462 3300025922 Unclassified 1953
196 Ga0207646_10220908 3300025922 Bacteria 1712
197 Ga0207646_10259067 3300025922 Unclassified 1572
198 Ga0207646_10362414 3300025922 Bacteria 1309
199 Ga0207646_10377468 3300025922 Unclassified 1281
200 Ga0207681_10166123 3300025923 Unclassified 1669
201 Ga0207650_10000059 3300025925 Bacteria 151427
202 Ga0207650_10082396 3300025925 Unclassified 2442
203 Ga0207659_10014083 3300025926 Bacteria 5149
204 Ga0207659_10095123 3300025926 Unclassified 2234
205 Ga0207687_10253637 3300025927 Bacteria 1400
206 Ga0207700_10134961 3300025928 Unclassified 2020
207 Ga0207700_10261734 3300025928 Bacteria 1481
208 Ga0207700_10303051 3300025928 Unclassified 1380
209 Ga0207700_10373528 3300025928 Bacteria 1245
210 Ga0207664_10177361 3300025929 Bacteria 1828
211 Ga0207644_10020075 3300025931 Unclassified 4539
212 Ga0207690_10018279 3300025932 Unclassified 4298
213 Ga0207706_10170569 3300025933 Unclassified 1912
214 Ga0207704_10068208 3300025938 Unclassified 2241
215 Ga0207665_10062223 3300025939 Unclassified 2532
216 Ga0207665_10142066 3300025939 Bacteria 1713
217 Ga0207665_10181874 3300025939 Archaea 1523
218 Ga0207691_10013168 3300025940 Bacteria 7920
219 Ga0207691_10018001 3300025940 Bacteria 6689
220 Ga0207711_10005842 3300025941 Bacteria 10394
221 Ga0207711_10007700 3300025941 Bacteria 9004
222 Ga0207689_10017588 3300025942 Bacteria 6043
223 Ga0207689_10110301 3300025942 Bacteria 2261
224 Ga0207661_10004533 3300025944 Bacteria 9733
225 Ga0207679_10001027 3300025945 Bacteria 17836
226 Ga0207679_10300940 3300025945 Unclassified 1382
227 Ga0207667_10615219 3300025949 Bacteria 1094
228 Ga0207651_10003853 3300025960 Bacteria 7443
229 Ga0207712_10163650 3300025961 Unclassified 1732
230 Ga0207658_10028520 3300025986 Bacteria 3931
231 Ga0207677_10026864 3300026023 Bacteria 3616
232 Ga0207703_10010559 3300026035 Bacteria 7219
233 Ga0207703_10588764 3300026035 Bacteria 1051
234 Ga0207639_10583471 3300026041 Unclassified 1029
235 Ga0207639_10721706 3300026041 Bacteria 925
236 Ga0207678_10013492 3300026067 Bacteria 7174
237 Ga0207702_10023516 3300026078 Bacteria 5111
238 Ga0207702_10794528 3300026078 Archaea 935
239 Ga0207641_10000025 3300026088 Bacteria 247727
240 Ga0207641_10014807 3300026088 Bacteria 6393
241 Ga0207641_10373062 3300026088 Bacteria 1365
242 Ga0207676_10000160 3300026095 Bacteria 58979
243 Ga0207676_10443981 3300026095 Unclassified 1222
244 Ga0207674_10000162 3300026116 Bacteria 79631
245 Ga0207683_10041785 3300026121 Unclassified 4004
246 Ga0207683_10046590 3300026121 Unclassified 3795
247 Ga0207698_10057925 3300026142 Unclassified 3000
248 Ga0268266_10001493 3300028379 Bacteria 27650
249 Ga0268266_10002593 3300028379 Bacteria 19155
250 Ga0268266_10091645 3300028379 Viruses 2665
251 Ga0268265_10002498 3300028380 Bacteria 13798
252 Ga0268265_10004079 3300028380 Bacteria 10261
253 Ga0268264_10011195 3300028381 Bacteria 7410
254 Ga0268264_10026196 3300028381 Unclassified 4762
255 Ga0265338_10029879 3300028800 Bacteria 5391
256 Ga0265338_10038732 3300028800 Viruses 4510
257 Ga0265760_10000625 3300031090 Bacteria 10021
258 Ga0265316_10009648 3300031344 Bacteria 8870
259 Ga0265314_10091401 3300031711 Bacteria 1981
260 Ga0307405_10160164 3300031731 Unclassified 1593
261 Ga0307410_10331104 3300031852 Bacteria 1211
262 Ga0373931_0012338 3300035691 Viruses 4139
263 Ga0373931_0201421 3300035691 Unclassified 1189
264 Ga0373935_0192189 3300035692 Bacteria 1407
265 Ga0373937_0130413 3300036401 Unclassified 2348
266 Ga0495629_0435084 3300046459 Bacteria 889
267 Ga0495580_0002650 3300046472 Bacteria 15548
268 Ga0495580_0024937 3300046472 Bacteria 4372
269 Ga0495580_0028792 3300046472 Bacteria 4036
270 Ga0495580_0214911 3300046472 Unclassified 1322
271 Ga0496101_0357052 3300048904 Unclassified 1149
272 Ga0496105_0542443 3300048908 Unclassified 909
273 Ga0496108_0000203 3300048911 Bacteria 54921
274 Ga0496108_0292345 3300048911 Bacteria 1419
275 Ga0496109_0000099 3300048912 Bacteria 89901
276 Ga0496109_0541164 3300048912 Unclassified 1099
277 Ga0496110_0000189 3300048913 Bacteria 38583
278 Ga0496110_0563813 3300048913 Bacteria 1035
279 Ga0496111_0018686 3300048914 Unclassified 4805
280 Ga0496111_0092356 3300048914 Bacteria 2219
281 Ga0496112_0000048 3300048915 Bacteria 84789
282 Ga0496112_0090889 3300048915 Bacteria 3022
283 Ga0496112_0136515 3300048915 Bacteria 2422
284 Ga0496112_0446795 3300048915 Bacteria 1231
285 Ga0496112_0705958 3300048915 Unclassified 936
286 Ga0496113_0000655 3300048916 Bacteria 17490
287 Ga0496113_0168928 3300048916 Bacteria 1732
288 Ga0496115_0448958 3300048918 Bacteria 1042
289 nmdc:mga08x19_241863_c1 3300050514 Bacteria 1244

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005467 Ga0070706_100529619 Ga0070706_1005296192 232
2 3300005535 Ga0070684_100000936 Ga0070684_1000009365 232
3 3300006028 Ga0070717_10012540 Ga0070717_100125407 232
4 3300025910 Ga0207684_10458593 Ga0207684_104585932 232
5 3300025915 Ga0207693_10393941 Ga0207693_103939412 232
6 3300026078 Ga0207702_10023516 Ga0207702_100235169 234
7 3300005536 Ga0070697_100125678 Ga0070697_1001256783 243
8 3300006358 Ga0068871_100324888 Ga0068871_1003248882 256
9 3300005435 Ga0070714_100061064 Ga0070714_1000610644 265
10 3300005467 Ga0070706_100354769 Ga0070706_1003547692 265
11 3300005614 Ga0068856_100002220 Ga0068856_1000022209 265
12 3300025922 Ga0207646_10377468 Ga0207646_103774681 265
13 3300050514 nmdc:mga08x19_241863_c1 nmdc:mga08x19_241863_c1_25_825 265
14 3300002459 JGI24751J29686_10007902 JGI24751J29686_100079022 266
15 3300005329 Ga0070683_100002123 Ga0070683_1000021235 266
16 3300005331 Ga0070670_100034927 Ga0070670_1000349275 266
17 3300005334 Ga0068869_100002923 Ga0068869_1000029239 266
18 3300005334 Ga0068869_100189148 Ga0068869_1001891482 266
19 3300005335 Ga0070666_10033227 Ga0070666_100332273 266
20 3300005338 Ga0068868_100307165 Ga0068868_1003071652 266
21 3300005338 Ga0068868_100330740 Ga0068868_1003307402 266
22 3300005340 Ga0070689_100006429 Ga0070689_1000064296 266
23 3300005343 Ga0070687_100010174 Ga0070687_1000101743 266
24 3300005344 Ga0070661_100005018 Ga0070661_1000050185 266
25 3300005353 Ga0070669_100011144 Ga0070669_1000111443 266
26 3300005354 Ga0070675_100120243 Ga0070675_1001202433 266
27 3300005355 Ga0070671_100017553 Ga0070671_1000175534 266
28 3300005355 Ga0070671_100379146 Ga0070671_1003791462 266
29 3300005364 Ga0070673_100000589 Ga0070673_10000058910 266
30 3300005365 Ga0070688_100002679 Ga0070688_1000026799 266
31 3300005365 Ga0070688_100218329 Ga0070688_1002183292 266
32 3300005367 Ga0070667_100013226 Ga0070667_1000132265 266
33 3300005436 Ga0070713_100098134 Ga0070713_1000981342 266
34 3300005436 Ga0070713_100224646 Ga0070713_1002246462 266
35 3300005436 Ga0070713_100239198 Ga0070713_1002391982 266
36 3300005438 Ga0070701_10101954 Ga0070701_101019543 266
37 3300005445 Ga0070708_100010876 Ga0070708_1000108764 266
38 3300005445 Ga0070708_100017626 Ga0070708_1000176262 266
39 3300005445 Ga0070708_100036377 Ga0070708_1000363773 266
40 3300005445 Ga0070708_100061880 Ga0070708_1000618805 266
41 3300005445 Ga0070708_100108447 Ga0070708_1001084473 266
42 3300005445 Ga0070708_100112167 Ga0070708_1001121673 266
43 3300005445 Ga0070708_100136122 Ga0070708_1001361223 266
44 3300005445 Ga0070708_100174583 Ga0070708_1001745833 266
45 3300005445 Ga0070708_100318713 Ga0070708_1003187132 266
46 3300005445 Ga0070708_100335121 Ga0070708_1003351212 266
47 3300005445 Ga0070708_100436992 Ga0070708_1004369921 266
48 3300005445 Ga0070708_100474370 Ga0070708_1004743702 266
49 3300005455 Ga0070663_100001276 Ga0070663_1000012765 266
50 3300005456 Ga0070678_100039990 Ga0070678_1000399904 266
51 3300005457 Ga0070662_100447606 Ga0070662_1004476062 266
52 3300005458 Ga0070681_10590634 Ga0070681_105906341 266
53 3300005459 Ga0068867_100480690 Ga0068867_1004806901 266
54 3300005466 Ga0070685_10003008 Ga0070685_100030085 266
55 3300005466 Ga0070685_10021576 Ga0070685_100215764 266
56 3300005467 Ga0070706_100001557 Ga0070706_1000015573 266
57 3300005467 Ga0070706_100045984 Ga0070706_1000459846 266
58 3300005467 Ga0070706_100197405 Ga0070706_1001974053 266
59 3300005467 Ga0070706_100211573 Ga0070706_1002115732 266
60 3300005467 Ga0070706_100574900 Ga0070706_1005749002 266
61 3300005468 Ga0070707_100004133 Ga0070707_10000413314 266
62 3300005468 Ga0070707_100142261 Ga0070707_1001422612 266
63 3300005468 Ga0070707_100238569 Ga0070707_1002385692 266
64 3300005468 Ga0070707_100455839 Ga0070707_1004558392 266
65 3300005471 Ga0070698_100001653 Ga0070698_10000165326 266
66 3300005471 Ga0070698_100267439 Ga0070698_1002674391 266
67 3300005518 Ga0070699_100071496 Ga0070699_1000714965 266
68 3300005518 Ga0070699_100092128 Ga0070699_1000921282 266
69 3300005518 Ga0070699_100121967 Ga0070699_1001219672 266
70 3300005518 Ga0070699_100440608 Ga0070699_1004406081 266
71 3300005536 Ga0070697_100012716 Ga0070697_1000127168 266
72 3300005536 Ga0070697_100037401 Ga0070697_1000374014 266
73 3300005536 Ga0070697_100046666 Ga0070697_1000466666 266
74 3300005536 Ga0070697_100354615 Ga0070697_1003546151 266
75 3300005536 Ga0070697_100409281 Ga0070697_1004092811 266
76 3300005536 Ga0070697_100435275 Ga0070697_1004352751 266
77 3300005536 Ga0070697_100692917 Ga0070697_1006929171 266
78 3300005539 Ga0068853_100152117 Ga0068853_1001521171 266
79 3300005543 Ga0070672_100000364 Ga0070672_10000036412 266
80 3300005548 Ga0070665_100010125 Ga0070665_1000101259 266
81 3300005548 Ga0070665_100027710 Ga0070665_1000277104 266
82 3300005548 Ga0070665_100553918 Ga0070665_1005539182 266
83 3300005564 Ga0070664_100002544 Ga0070664_1000025448 266
84 3300005564 Ga0070664_100088765 Ga0070664_1000887652 266
85 3300005577 Ga0068857_100001315 Ga0068857_1000013159 266
86 3300005577 Ga0068857_100039101 Ga0068857_1000391016 266
87 3300005614 Ga0068856_100516038 Ga0068856_1005160382 266
88 3300005617 Ga0068859_100003313 Ga0068859_1000033134 266
89 3300005618 Ga0068864_100000879 Ga0068864_1000008794 266
90 3300005618 Ga0068864_100001704 Ga0068864_1000017048 266
91 3300005834 Ga0068851_10064091 Ga0068851_100640913 266
92 3300005841 Ga0068863_100001146 Ga0068863_1000011466 266
93 3300005841 Ga0068863_100002863 Ga0068863_1000028636 266
94 3300005841 Ga0068863_100006619 Ga0068863_1000066196 266
95 3300005842 Ga0068858_100008599 Ga0068858_1000085998 266
96 3300005842 Ga0068858_100609196 Ga0068858_1006091962 266
97 3300005843 Ga0068860_100014700 Ga0068860_1000147006 266
98 3300005843 Ga0068860_100059515 Ga0068860_1000595154 266
99 3300005844 Ga0068862_100003035 Ga0068862_1000030355 266
100 3300006028 Ga0070717_10036785 Ga0070717_100367854 266
101 3300006028 Ga0070717_10114071 Ga0070717_101140713 266
102 3300006028 Ga0070717_10201854 Ga0070717_102018543 266
103 3300006175 Ga0070712_100056559 Ga0070712_1000565592 266
104 3300006175 Ga0070712_100431642 Ga0070712_1004316422 266
105 3300006175 Ga0070712_100449574 Ga0070712_1004495741 266
106 3300006237 Ga0097621_100008738 Ga0097621_1000087385 266
107 3300006358 Ga0068871_100009017 Ga0068871_1000090175 266
108 3300006881 Ga0068865_100187704 Ga0068865_1001877042 266
109 3300006931 Ga0097620_100003313 Ga0097620_1000033134 266
110 3300009093 Ga0105240_10088248 Ga0105240_100882483 266
111 3300009101 Ga0105247_10061835 Ga0105247_100618354 266
112 3300009147 Ga0114129_11325628 Ga0114129_113256281 266
113 3300009176 Ga0105242_10774792 Ga0105242_107747922 266
114 3300009177 Ga0105248_10012614 Ga0105248_100126144 266
115 3300009177 Ga0105248_10409932 Ga0105248_104099322 266
116 3300009553 Ga0105249_10276624 Ga0105249_102766242 266
117 3300010375 Ga0105239_10145945 Ga0105239_101459452 266
118 3300011119 Ga0105246_10001222 Ga0105246_100012222 266
119 3300011119 Ga0105246_10281870 Ga0105246_102818702 266
120 3300013102 Ga0157371_10164485 Ga0157371_101644851 266
121 3300013105 Ga0157369_10019781 Ga0157369_100197814 266
122 3300013105 Ga0157369_10042779 Ga0157369_100427793 266
123 3300013105 Ga0157369_10700927 Ga0157369_107009271 266
124 3300013296 Ga0157374_10000388 Ga0157374_1000038817 266
125 3300013296 Ga0157374_10013013 Ga0157374_100130135 266
126 3300013296 Ga0157374_10050333 Ga0157374_100503332 266
127 3300013296 Ga0157374_10087878 Ga0157374_100878784 266
128 3300013297 Ga0157378_10028929 Ga0157378_100289292 266
129 3300013297 Ga0157378_10497746 Ga0157378_104977462 266
130 3300013306 Ga0163162_10049309 Ga0163162_100493094 266
131 3300013306 Ga0163162_10286009 Ga0163162_102860092 266
132 3300013306 Ga0163162_10688525 Ga0163162_106885251 266
133 3300013306 Ga0163162_11172923 Ga0163162_111729231 266
134 3300013307 Ga0157372_10020137 Ga0157372_100201374 266
135 3300013307 Ga0157372_11009094 Ga0157372_110090941 266
136 3300013308 Ga0157375_10010780 Ga0157375_100107803 266
137 3300013308 Ga0157375_10464231 Ga0157375_104642312 266
138 3300013308 Ga0157375_10913255 Ga0157375_109132552 266
139 3300013308 Ga0157375_11337352 Ga0157375_113373521 266
140 3300014325 Ga0163163_10041481 Ga0163163_100414814 266
141 3300014325 Ga0163163_10795209 Ga0163163_107952092 266
142 3300014745 Ga0157377_10010765 Ga0157377_100107654 266
143 3300014745 Ga0157377_10117136 Ga0157377_101171362 266
144 3300014968 Ga0157379_10001205 Ga0157379_1000120510 266
145 3300014969 Ga0157376_10012767 Ga0157376_100127676 266
146 3300014969 Ga0157376_10205719 Ga0157376_102057192 266
147 3300025899 Ga0207642_10112721 Ga0207642_101127212 266
148 3300025900 Ga0207710_10192572 Ga0207710_101925722 266
149 3300025903 Ga0207680_10059405 Ga0207680_100594052 266
150 3300025904 Ga0207647_10011317 Ga0207647_100113175 266
151 3300025905 Ga0207685_10090774 Ga0207685_100907742 266
152 3300025910 Ga0207684_10001403 Ga0207684_100014039 266
153 3300025910 Ga0207684_10041352 Ga0207684_100413521 266
154 3300025910 Ga0207684_10050511 Ga0207684_100505112 266
155 3300025910 Ga0207684_10163380 Ga0207684_101633802 266
156 3300025913 Ga0207695_10056714 Ga0207695_100567144 266
157 3300025915 Ga0207693_10036264 Ga0207693_100362644 266
158 3300025915 Ga0207693_10366543 Ga0207693_103665432 266
159 3300025918 Ga0207662_10145316 Ga0207662_101453163 266
160 3300025919 Ga0207657_10152234 Ga0207657_101522343 266
161 3300025920 Ga0207649_10000513 Ga0207649_1000051315 266
162 3300025922 Ga0207646_10000037 Ga0207646_100000374 266
163 3300025922 Ga0207646_10001071 Ga0207646_1000107123 266
164 3300025922 Ga0207646_10051996 Ga0207646_100519965 266
165 3300025922 Ga0207646_10111113 Ga0207646_101111133 266
166 3300025922 Ga0207646_10172462 Ga0207646_101724623 266
167 3300025922 Ga0207646_10220908 Ga0207646_102209082 266
168 3300025922 Ga0207646_10259067 Ga0207646_102590673 266
169 3300025922 Ga0207646_10362414 Ga0207646_103624141 266
170 3300025923 Ga0207681_10166123 Ga0207681_101661232 266
171 3300025925 Ga0207650_10000059 Ga0207650_1000005952 266
172 3300025925 Ga0207650_10082396 Ga0207650_100823963 266
173 3300025926 Ga0207659_10095123 Ga0207659_100951233 266
174 3300025927 Ga0207687_10253637 Ga0207687_102536372 266
175 3300025928 Ga0207700_10134961 Ga0207700_101349612 266
176 3300025928 Ga0207700_10261734 Ga0207700_102617342 266
177 3300025928 Ga0207700_10303051 Ga0207700_103030512 266
178 3300025928 Ga0207700_10373528 Ga0207700_103735282 266
179 3300025929 Ga0207664_10177361 Ga0207664_101773613 266
180 3300025931 Ga0207644_10020075 Ga0207644_100200755 266
181 3300025932 Ga0207690_10018279 Ga0207690_100182796 266
182 3300025933 Ga0207706_10170569 Ga0207706_101705693 266
183 3300025938 Ga0207704_10068208 Ga0207704_100682082 266
184 3300025939 Ga0207665_10062223 Ga0207665_100622234 266
185 3300025939 Ga0207665_10142066 Ga0207665_101420661 266
186 3300025939 Ga0207665_10181874 Ga0207665_101818742 266
187 3300025940 Ga0207691_10018001 Ga0207691_100180015 266
188 3300025941 Ga0207711_10005842 Ga0207711_100058423 266
189 3300025942 Ga0207689_10017588 Ga0207689_100175883 266
190 3300025942 Ga0207689_10110301 Ga0207689_101103013 266
191 3300025944 Ga0207661_10004533 Ga0207661_1000453310 266
192 3300025945 Ga0207679_10001027 Ga0207679_100010277 266
193 3300025945 Ga0207679_10300940 Ga0207679_103009402 266
194 3300025949 Ga0207667_10615219 Ga0207667_106152192 266
195 3300025960 Ga0207651_10003853 Ga0207651_100038535 266
196 3300025961 Ga0207712_10163650 Ga0207712_101636503 266
197 3300025986 Ga0207658_10028520 Ga0207658_100285203 266
198 3300026023 Ga0207677_10026864 Ga0207677_100268644 266
199 3300026035 Ga0207703_10010559 Ga0207703_100105596 266
200 3300026035 Ga0207703_10588764 Ga0207703_105887642 266
201 3300026041 Ga0207639_10583471 Ga0207639_105834711 266
202 3300026041 Ga0207639_10721706 Ga0207639_107217061 266
203 3300026067 Ga0207678_10013492 Ga0207678_100134926 266
204 3300026078 Ga0207702_10794528 Ga0207702_107945282 266
205 3300026088 Ga0207641_10000025 Ga0207641_1000002554 266
206 3300026088 Ga0207641_10014807 Ga0207641_100148077 266
207 3300026088 Ga0207641_10373062 Ga0207641_103730622 266
208 3300026095 Ga0207676_10000160 Ga0207676_1000016040 266
209 3300026095 Ga0207676_10443981 Ga0207676_104439812 266
210 3300026116 Ga0207674_10000162 Ga0207674_1000016210 266
211 3300026121 Ga0207683_10046590 Ga0207683_100465905 266
212 3300026142 Ga0207698_10057925 Ga0207698_100579252 266
213 3300028379 Ga0268266_10001493 Ga0268266_100014934 266
214 3300028379 Ga0268266_10002593 Ga0268266_1000259313 266
215 3300028380 Ga0268265_10004079 Ga0268265_100040796 266
216 3300028381 Ga0268264_10026196 Ga0268264_100261964 266
217 3300028800 Ga0265338_10029879 Ga0265338_100298794 266
218 3300028800 Ga0265338_10038732 Ga0265338_100387324 266
219 3300031090 Ga0265760_10000625 Ga0265760_100006259 266
220 3300031344 Ga0265316_10009648 Ga0265316_100096482 266
221 3300031711 Ga0265314_10091401 Ga0265314_100914012 266
222 3300035691 Ga0373931_0012338 Ga0373931_0012338_685_1488 266
223 3300035691 Ga0373931_0201421 Ga0373931_0201421_57_860 266
224 3300035692 Ga0373935_0192189 Ga0373935_0192189_69_872 266
225 3300036401 Ga0373937_0130413 Ga0373937_0130413_229_1032 266
226 3300046459 Ga0495629_0435084 Ga0495629_0435084_21_824 266
227 3300046472 Ga0495580_0002650 Ga0495580_0002650_8145_8948 266
228 3300046472 Ga0495580_0024937 Ga0495580_0024937_2103_2906 266
229 3300046472 Ga0495580_0028792 Ga0495580_0028792_2242_3045 266
230 3300046472 Ga0495580_0214911 Ga0495580_0214911_315_1118 266
231 3300048904 Ga0496101_0357052 Ga0496101_0357052_228_1031 266
232 3300048908 Ga0496105_0542443 Ga0496105_0542443_52_855 266
233 3300048911 Ga0496108_0000203 Ga0496108_0000203_21351_22151 266
234 3300048911 Ga0496108_0292345 Ga0496108_0292345_352_1152 266
235 3300048912 Ga0496109_0000099 Ga0496109_0000099_11499_12299 266
236 3300048912 Ga0496109_0541164 Ga0496109_0541164_51_854 266
237 3300048913 Ga0496110_0000189 Ga0496110_0000189_33091_33891 266
238 3300048913 Ga0496110_0563813 Ga0496110_0563813_22_825 266
239 3300048914 Ga0496111_0018686 Ga0496111_0018686_348_1148 266
240 3300048914 Ga0496111_0092356 Ga0496111_0092356_888_1688 266
241 3300048915 Ga0496112_0000048 Ga0496112_0000048_65930_66730 266
242 3300048915 Ga0496112_0090889 Ga0496112_0090889_2111_2911 266
243 3300048915 Ga0496112_0136515 Ga0496112_0136515_104_904 266
244 3300048915 Ga0496112_0705958 Ga0496112_0705958_123_926 266
245 3300048916 Ga0496113_0000655 Ga0496113_0000655_2705_3505 266
246 3300048916 Ga0496113_0168928 Ga0496113_0168928_483_1283 266
247 3300048918 Ga0496115_0448958 Ga0496115_0448958_59_859 266
248 3300005614 Ga0068856_100315106 Ga0068856_1003151063 267
249 3300010375 Ga0105239_10464960 Ga0105239_104649602 267
250 3300013296 Ga0157374_10026180 Ga0157374_100261806 267
251 3300014325 Ga0163163_10184772 Ga0163163_101847722 267
252 3300015262 Ga0182007_10068451 Ga0182007_100684512 267
253 3300025898 Ga0207692_10319731 Ga0207692_103197311 267
254 3300031731 Ga0307405_10160164 Ga0307405_101601642 267
255 3300031852 Ga0307410_10331104 Ga0307410_103311042 267
256 3300048915 Ga0496112_0446795 Ga0496112_0446795_206_1012 267
257 3300001976 JGI24752J21851_1002278 JGI24752J21851_10022783 284
258 3300005290 Ga0065712_10093442 Ga0065712_100934423 284
259 3300005329 Ga0070683_100030202 Ga0070683_1000302024 284
260 3300005331 Ga0070670_100016220 Ga0070670_1000162204 284
261 3300005334 Ga0068869_100000409 Ga0068869_10000040918 284
262 3300005340 Ga0070689_100040215 Ga0070689_1000402152 284
263 3300005344 Ga0070661_100001327 Ga0070661_10000132713 284
264 3300005354 Ga0070675_100025351 Ga0070675_1000253514 284
265 3300005355 Ga0070671_100007177 Ga0070671_1000071776 284
266 3300005455 Ga0070663_100006247 Ga0070663_1000062476 284
267 3300005455 Ga0070663_100106632 Ga0070663_1001066322 284
268 3300005535 Ga0070684_100011359 Ga0070684_1000113596 284
269 3300005617 Ga0068859_100027742 Ga0068859_1000277424 284
270 3300005842 Ga0068858_100062001 Ga0068858_1000620014 284
271 3300005844 Ga0068862_100012726 Ga0068862_1000127266 284
272 3300006931 Ga0097620_100027739 Ga0097620_1000277395 284
273 3300009101 Ga0105247_10035107 Ga0105247_100351073 284
274 3300011119 Ga0105246_10023978 Ga0105246_100239784 284
275 3300013296 Ga0157374_10021785 Ga0157374_100217853 284
276 3300013308 Ga0157375_10051478 Ga0157375_100514784 284
277 3300014325 Ga0163163_10020791 Ga0163163_100207915 284
278 3300014745 Ga0157377_10033455 Ga0157377_100334553 284
279 3300014968 Ga0157379_10043679 Ga0157379_100436794 284
280 3300014969 Ga0157376_10303320 Ga0157376_103033202 284
281 3300025321 Ga0207656_10051857 Ga0207656_100518572 284
282 3300025919 Ga0207657_10182423 Ga0207657_101824233 284
283 3300025926 Ga0207659_10014083 Ga0207659_100140834 284
284 3300025940 Ga0207691_10013168 Ga0207691_100131686 284
285 3300025941 Ga0207711_10007700 Ga0207711_100077006 284
286 3300026121 Ga0207683_10041785 Ga0207683_100417852 284
287 3300028379 Ga0268266_10091645 Ga0268266_100916452 284
288 3300028380 Ga0268265_10002498 Ga0268265_100024985 284
289 3300028381 Ga0268264_10011195 Ga0268264_100111955 284

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12705

PDDEXK_1

PD-(D/E)XK nuclease superfamily

2

234

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3k70-assembly2.cif.gz_E crystal structure of the complete initiation complex of recbcd 0.5723 138 222
3ulc-assembly1.cif.gz_A-2 crystal structure of the pleckstrin homology domain of saccharomyces cerevisiae avo1, a torc2 subunit, in the p3121 crystal form 0.5711 194 231
5zyu-assembly2.cif.gz_B the crystal structure of humanmgme1 with single strand dna2 0.5681 18 231
5zyv-assembly1.cif.gz_A crystal structure of human mgme1 with single strand dna2 and ca2+ 0.5563 21 231
5zyt-assembly2.cif.gz_B crystal structure of human mgme1 with 3' overhang double strand dna3 0.5504 21 231
ID Description Score Start End Superfamily
af_Q4D018_3_106_1.20.1310.10 Mainly Alpha;Up-down Bundle;5 helical Cullin repeat like;Cullin Repeats 0.7414 51 85 1.20.1310.10
5mbvB05 Alpha Beta;Alpha-Beta Complex;Lambda Exonuclease; Chain A; 0.5887 131 222 3.90.320.10
af_A9QY30_44_274_3.90.320.10 Alpha Beta;Alpha-Beta Complex;Lambda Exonuclease; Chain A; 0.5859 51 232 3.90.320.10
af_B8A4D5_139_334_3.90.320.10 Alpha Beta;Alpha-Beta Complex;Lambda Exonuclease; Chain A; 0.5749 51 231 3.90.320.10
5ld2B05 Alpha Beta;Alpha-Beta Complex;Lambda Exonuclease; Chain A; 0.5737 136 222 3.90.320.10
ID Description Score Start End GO Terms
AF-A0A2V9NFZ3-F1-model_v4 PD-(D/E)XK endonuclease-like domain-containing protein 0.9495 19 112
AF-A0A2V9MR30-F1-model_v4 PD-(D/E)XK endonuclease-like domain-containing protein 0.9473 19 196
AF-A0A2V9WJG4-F1-model_v4 PD-(D/E)XK endonuclease-like domain-containing protein 0.9426 19 252
AF-A0A2V9MR30-F1-model_v4 PD-(D/E)XK endonuclease-like domain-containing protein 0.9422 19 196
AF-A0A838JA83-F1-model_v4 PD-(D/E)XK nuclease family protein 0.938 19 177

Feature Viewer

pLDDT pTM Quality
78.62 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map