F388602

General Info

Members Datasets Scaffolds Average Seq Length
288 153 576 100

Family's Representative Sequence

Representative Sequence 3300014969|Ga0157376_11636585|Ga0157376_116365851
Length 115
Sequence MRLRTAKDRLKIEHSIIDGVREILEELLAANAEIRSVIPGVIRQVRDARGKVKVRVTVPTQNGWKAIALSAGARQELFISTAWTKDCGGSGAAEGGSGSGMTPKCKATAPPVRYS

Samples

Sample ID Description Type Environment
1 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
90 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
91 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
92 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
93 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
94 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
95 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
96 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
97 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
98 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
99 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
100 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
101 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
102 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
103 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
104 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
105 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
106 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
107 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
110 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
111 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
112 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
113 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
114 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
115 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
116 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
117 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
118 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
119 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
120 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
121 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
122 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
123 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
124 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
125 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
126 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
127 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
128 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
129 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
130 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
131 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
132 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
133 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
134 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
135 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
136 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
137 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
138 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
139 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
140 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
143 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
144 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
145 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
146 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
151 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
152 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
153 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.74
Rhizosphere 98.26
Stem 0
Stem Tuber 0
Unclassified 37.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157376_11636585 3300014969 Unclassified 678
2 Ga0070676_11149751 3300005328 Bacteria 588
3 Ga0070683_100000035 3300005329 Bacteria 122362
4 Ga0070683_100288748 3300005329 Unclassified 1560
5 Ga0070670_100581555 3300005331 Unclassified 1001
6 Ga0068869_100476929 3300005334 Bacteria 1038
7 Ga0068869_101695540 3300005334 Unclassified 564
8 Ga0070666_10293480 3300005335 Bacteria 1157
9 Ga0068868_100590326 3300005338 Bacteria 983
10 Ga0070689_100044601 3300005340 Bacteria 3411
11 Ga0070668_100472652 3300005347 Bacteria 1081
12 Ga0070669_101151593 3300005353 Bacteria 669
13 Ga0070675_100800874 3300005354 Bacteria 861
14 Ga0070675_100880456 3300005354 Unclassified 820
15 Ga0070675_100887036 3300005354 Unclassified 817
16 Ga0070673_100428999 3300005364 Bacteria 1186
17 Ga0070673_100694382 3300005364 Bacteria 934
18 Ga0070673_101639571 3300005364 Unclassified 608
19 Ga0070667_102043139 3300005367 Unclassified 540
20 Ga0070713_101428821 3300005436 Bacteria 671
21 Ga0070713_102396692 3300005436 Bacteria 510
22 Ga0070713_102444078 3300005436 Bacteria 505
23 Ga0070711_100735145 3300005439 Unclassified 833
24 Ga0070678_100318265 3300005456 Bacteria 1328
25 Ga0070678_100337990 3300005456 Unclassified 1291
26 Ga0070678_101004360 3300005456 Bacteria 767
27 Ga0070681_10383822 3300005458 Unclassified 1315
28 Ga0068867_100531769 3300005459 Bacteria 1015
29 Ga0070685_10088303 3300005466 Bacteria 1872
30 Ga0070679_100030091 3300005530 Bacteria 5359
31 Ga0070684_100000037 3300005535 Bacteria 95058
32 Ga0070684_100409281 3300005535 Unclassified 1251
33 Ga0070684_100911973 3300005535 Bacteria 823
34 Ga0070684_101006640 3300005535 Unclassified 782
35 Ga0070697_100805540 3300005536 Bacteria 831
36 Ga0070672_101241848 3300005543 Bacteria 664
37 Ga0070686_101263753 3300005544 Unclassified 615
38 Ga0070686_101353079 3300005544 Unclassified 596
39 Ga0070686_101869686 3300005544 Unclassified 512
40 Ga0070665_101368394 3300005548 Unclassified 717
41 Ga0068855_100141166 3300005563 Unclassified 2746
42 Ga0068855_100859384 3300005563 Unclassified 961
43 Ga0068855_102511640 3300005563 Bacteria 512
44 Ga0068857_100628570 3300005577 Unclassified 1016
45 Ga0068857_102109428 3300005577 Unclassified 553
46 Ga0068852_101282354 3300005616 Unclassified 754
47 Ga0068864_100519053 3300005618 Bacteria 1148
48 Ga0068864_102541967 3300005618 Bacteria 518
49 Ga0068863_100082524 3300005841 Bacteria 3046
50 Ga0068863_100548625 3300005841 Bacteria 1141
51 Ga0068858_101390007 3300005842 Bacteria 691
52 Ga0068860_100521398 3300005843 Unclassified 1188
53 Ga0068860_101321183 3300005843 Unclassified 742
54 Ga0070717_10185718 3300006028 Bacteria 1814
55 Ga0070717_10974055 3300006028 Unclassified 772
56 Ga0070717_11175777 3300006028 Unclassified 698
57 Ga0070717_12147342 3300006028 Unclassified 502
58 Ga0070712_100577926 3300006175 Bacteria 949
59 Ga0097621_100172894 3300006237 Bacteria 1863
60 Ga0097621_100351558 3300006237 Unclassified 1311
61 Ga0097621_100404132 3300006237 Unclassified 1223
62 Ga0068871_100031562 3300006358 Bacteria 4179
63 Ga0068871_100525634 3300006358 Bacteria 1069
64 Ga0068871_101637437 3300006358 Bacteria 610
65 Ga0068871_101810311 3300006358 Unclassified 580
66 Ga0068871_101892606 3300006358 Unclassified 567
67 Ga0075434_101391162 3300006871 Bacteria 712
68 Ga0097620_102577436 3300006931 Unclassified 559
69 Ga0075435_101002708 3300007076 Unclassified 729
70 Ga0105240_10214295 3300009093 Bacteria 2248
71 Ga0105240_10971433 3300009093 Bacteria 910
72 Ga0105240_11682534 3300009093 Unclassified 663
73 Ga0105240_11735774 3300009093 Unclassified 651
74 Ga0111539_10683346 3300009094 Bacteria 1195
75 Ga0105245_11038768 3300009098 Bacteria 865
76 Ga0105241_11197679 3300009174 Unclassified 719
77 Ga0105241_11553430 3300009174 Bacteria 639
78 Ga0105242_10563271 3300009176 Unclassified 1095
79 Ga0105242_10762459 3300009176 Unclassified 954
80 Ga0105242_10848388 3300009176 Bacteria 909
81 Ga0105242_10930627 3300009176 Bacteria 872
82 Ga0105248_10109130 3300009177 Bacteria 3120
83 Ga0105248_10117704 3300009177 Bacteria 2997
84 Ga0105248_10302789 3300009177 Unclassified 1800
85 Ga0105248_10446672 3300009177 Bacteria 1457
86 Ga0105248_10828893 3300009177 Bacteria 1044
87 Ga0105248_11542801 3300009177 Bacteria 752
88 Ga0105248_12421808 3300009177 Bacteria 598
89 Ga0105248_12547457 3300009177 Bacteria 583
90 Ga0105237_10009673 3300009545 Bacteria 10320
91 Ga0105238_10909033 3300009551 Bacteria 899
92 Ga0105238_11014428 3300009551 Bacteria 851
93 Ga0105239_11174630 3300010375 Bacteria 884
94 Ga0105239_11228958 3300010375 Bacteria 864
95 Ga0105246_10749946 3300011119 Bacteria 861
96 Ga0105246_11062299 3300011119 Bacteria 737
97 Ga0157370_10744717 3300013104 Bacteria 893
98 Ga0157370_10763715 3300013104 Bacteria 880
99 Ga0157369_10047927 3300013105 Bacteria 4638
100 Ga0157369_10116840 3300013105 Unclassified 2832
101 Ga0157374_10357804 3300013296 Bacteria 1451
102 Ga0157374_11069350 3300013296 Bacteria 827
103 Ga0157374_11228807 3300013296 Bacteria 771
104 Ga0157374_11572566 3300013296 Bacteria 681
105 Ga0157378_10458179 3300013297 Bacteria 1267
106 Ga0157378_11375896 3300013297 Bacteria 748
107 Ga0157378_12105952 3300013297 Bacteria 615
108 Ga0157378_13019227 3300013297 Unclassified 522
109 Ga0163162_10211110 3300013306 Bacteria 2071
110 Ga0163162_12051870 3300013306 Bacteria 656
111 Ga0157375_10886759 3300013308 Unclassified 1037
112 Ga0163163_10045375 3300014325 Bacteria 4313
113 Ga0163163_10534758 3300014325 Unclassified 1234
114 Ga0163163_10710750 3300014325 Bacteria 1068
115 Ga0163163_12038148 3300014325 Bacteria 633
116 Ga0157380_11792193 3300014326 Unclassified 673
117 Ga0157380_12293431 3300014326 Unclassified 604
118 Ga0157377_11433551 3300014745 Unclassified 546
119 Ga0157379_10364606 3300014968 Unclassified 1324
120 Ga0157376_10682967 3300014969 Bacteria 1030
121 Ga0157376_10793770 3300014969 Bacteria 959
122 Ga0157376_10839711 3300014969 Unclassified 933
123 Ga0157376_10874806 3300014969 Bacteria 915
124 Ga0157376_11670993 3300014969 Unclassified 672
125 Ga0157376_11938316 3300014969 Bacteria 626
126 Ga0207680_10504610 3300025903 Bacteria 862
127 Ga0207695_10698069 3300025913 Bacteria 895
128 Ga0207695_11683097 3300025913 Unclassified 515
129 Ga0207671_10273291 3300025914 Bacteria 1332
130 Ga0207662_10180898 3300025918 Unclassified 1357
131 Ga0207652_10387915 3300025921 Bacteria 1260
132 Ga0207681_10844231 3300025923 Bacteria 766
133 Ga0207694_10416656 3300025924 Unclassified 1118
134 Ga0207650_11550824 3300025925 Unclassified 563
135 Ga0207650_11753373 3300025925 Unclassified 526
136 Ga0207659_10163284 3300025926 Unclassified 1751
137 Ga0207686_10271092 3300025934 Bacteria 1248
138 Ga0207686_10560463 3300025934 Bacteria 894
139 Ga0207670_11599907 3300025936 Unclassified 554
140 Ga0207669_10772575 3300025937 Unclassified 795
141 Ga0207665_11121537 3300025939 Unclassified 627
142 Ga0207711_10072993 3300025941 Bacteria 2982
143 Ga0207711_10322101 3300025941 Bacteria 1428
144 Ga0207711_11318293 3300025941 Unclassified 664
145 Ga0207711_11720505 3300025941 Bacteria 570
146 Ga0207711_11791997 3300025941 Unclassified 557
147 Ga0207689_10998759 3300025942 Unclassified 706
148 Ga0207661_10000008 3300025944 Bacteria 451211
149 Ga0207661_10481916 3300025944 Bacteria 1132
150 Ga0207661_10906909 3300025944 Bacteria 812
151 Ga0207661_11407814 3300025944 Unclassified 640
152 Ga0207667_10114556 3300025949 Bacteria 2779
153 Ga0207667_10142994 3300025949 Unclassified 2463
154 Ga0207651_10605793 3300025960 Bacteria 958
155 Ga0207668_11193189 3300025972 Bacteria 684
156 Ga0207677_11383276 3300026023 Unclassified 648
157 Ga0207677_11993181 3300026023 Unclassified 540
158 Ga0207703_10531571 3300026035 Bacteria 1107
159 Ga0207703_10968116 3300026035 Unclassified 816
160 Ga0207708_10723466 3300026075 Unclassified 852
161 Ga0207641_10319733 3300026088 Bacteria 1471
162 Ga0207641_10705694 3300026088 Bacteria 994
163 Ga0207641_12583053 3300026088 Bacteria 506
164 Ga0207676_10158886 3300026095 Bacteria 1956
165 Ga0207676_10644907 3300026095 Bacteria 1021
166 Ga0207676_10725789 3300026095 Bacteria 965
167 Ga0207674_10757590 3300026116 Unclassified 937
168 Ga0207683_10549059 3300026121 Bacteria 1068
169 Ga0207683_10586916 3300026121 Bacteria 1031
170 Ga0268266_10732180 3300028379 Bacteria 954
171 Ga0268266_11352485 3300028379 Unclassified 688
172 Ga0268265_11699325 3300028380 Unclassified 637
173 Ga0268264_10726529 3300028381 Bacteria 988
174 Ga0265330_10045078 3300031235 Bacteria 1945
175 Ga0265325_10411059 3300031241 Bacteria 592
176 Ga0265339_10080533 3300031249 Bacteria 1722
177 Ga0265331_10073141 3300031250 Unclassified 1601
178 Ga0265331_10188545 3300031250 Bacteria 930
179 Ga0265316_10001374 3300031344 Bacteria 26206
180 Ga0265316_10002992 3300031344 Bacteria 17280
181 Ga0265316_10003112 3300031344 Bacteria 16913
182 Ga0265316_10056174 3300031344 Bacteria 3077
183 Ga0265316_10133297 3300031344 Bacteria 1870
184 Ga0265316_10216534 3300031344 Bacteria 1414
185 Ga0265316_10235207 3300031344 Bacteria 1348
186 Ga0265316_10341952 3300031344 Bacteria 1084
187 Ga0265316_10363056 3300031344 Bacteria 1047
188 Ga0265316_10452571 3300031344 Bacteria 921
189 Ga0265314_10025568 3300031711 Bacteria 4450
190 Ga0265342_10039960 3300031712 Bacteria 2847
191 Ga0265342_10049465 3300031712 Bacteria 2515
192 Ga0373926_0006397 3300035083 Bacteria 3914
193 Ga0373926_0261942 3300035083 Unclassified 671
194 Ga0373945_0004097 3300035116 Bacteria 4621
195 Ga0373943_0532749 3300035170 Bacteria 688
196 Ga0373935_0067090 3300035692 Bacteria 2306
197 Ga0373935_0801844 3300035692 Bacteria 695
198 Ga0373935_1059497 3300035692 Unclassified 603
199 Ga0373927_0001825 3300035695 Bacteria 15826
200 Ga0373927_0194267 3300035695 Unclassified 1332
201 Ga0373927_0234544 3300035695 Bacteria 1206
202 Ga0373947_0000142 3300035725 Bacteria 37230
203 Ga0373947_0128319 3300035725 Bacteria 1617
204 Ga0373937_0102687 3300036401 Bacteria 2655
205 Ga0373937_2025151 3300036401 Unclassified 522
206 Ga0373925_0000221 3300037068 Bacteria 60956
207 Ga0373925_0371709 3300037068 Bacteria 1163
208 Ga0373925_1523276 3300037068 Bacteria 547
209 Ga0466965_0409565 3300044683 Bacteria 750
210 Ga0466957_1074224 3300044842 Bacteria 580
211 Ga0466959_0125899 3300045049 Bacteria 1819
212 Ga0451576_0325574 3300045051 Unclassified 1608
213 Ga0451576_0339769 3300045051 Bacteria 1572
214 Ga0466967_2460178 3300045976 Bacteria 516
215 Ga0495592_0265919 3300046454 Bacteria 1127
216 Ga0495592_0382056 3300046454 Bacteria 896
217 Ga0495629_0892382 3300046459 Unclassified 583
218 Ga0495651_0023939 3300046462 Bacteria 4749
219 Ga0495651_0442081 3300046462 Unclassified 842
220 Ga0495651_0787864 3300046462 Bacteria 587
221 Ga0495653_0061506 3300046463 Bacteria 2841
222 Ga0495580_0070139 3300046472 Bacteria 2448
223 Ga0495582_0041084 3300046473 Bacteria 2548
224 Ga0495639_0381245 3300046475 Bacteria 711
225 Ga0495664_0107037 3300046477 Unclassified 1686
226 Ga0495594_0046676 3300046499 Bacteria 2379
227 Ga0495608_0016023 3300046511 Bacteria 5189
228 Ga0495618_0115090 3300046514 Bacteria 1722
229 Ga0495618_0293753 3300046514 Unclassified 1011
230 Ga0495628_0056939 3300046516 Bacteria 3075
231 Ga0495628_0436347 3300046516 Bacteria 953
232 Ga0495628_0869997 3300046516 Bacteria 627
233 Ga0495630_1369952 3300046517 Bacteria 532
234 Ga0495666_0200282 3300046526 Bacteria 918
235 Ga0495652_0486796 3300046529 Bacteria 858
236 Ga0495665_0180274 3300046531 Bacteria 1098
237 Ga0495665_0667473 3300046531 Unclassified 517
238 Ga0495640_0460984 3300046533 Unclassified 775
239 Ga0495586_0635484 3300046535 Unclassified 617
240 Ga0495587_0670099 3300046536 Unclassified 569
241 Ga0495645_0043842 3300046543 Bacteria 3263
242 Ga0495645_0097841 3300046543 Unclassified 2089
243 Ga0495645_0214952 3300046543 Unclassified 1296
244 Ga0495645_0319391 3300046543 Bacteria 1009
245 Ga0495645_0905811 3300046543 Unclassified 523
246 Ga0495667_0085302 3300046559 Unclassified 2049
247 Ga0495667_0873230 3300046559 Unclassified 552
248 Ga0495634_0534712 3300046642 Unclassified 685
249 Ga0495635_0016020 3300046663 Bacteria 5236
250 Ga0495657_0093793 3300046675 Bacteria 1921
251 Ga0495599_0852143 3300046678 Bacteria 518
252 Ga0495623_0246561 3300046679 Bacteria 1006
253 Ga0495623_0327419 3300046679 Unclassified 840
254 Ga0495623_0354948 3300046679 Unclassified 798
255 Ga0495623_0473539 3300046679 Unclassified 664
256 Ga0495646_0008265 3300046680 Bacteria 6616
257 Ga0495669_0428407 3300046684 Unclassified 642
258 Ga0495624_0182285 3300046690 Bacteria 1279
259 Ga0495624_0783103 3300046690 Unclassified 564
260 Ga0495600_0063983 3300046809 Bacteria 2404
261 Ga0495581_0216113 3300047315 Unclassified 1121
262 Ga0495604_0106969 3300047317 Bacteria 2045
263 Ga0495604_0162710 3300047317 Bacteria 1575
264 Ga0495604_0363401 3300047317 Unclassified 959
265 Ga0495674_0021041 3300047319 Bacteria 6035
266 Ga0495674_0268298 3300047319 Unclassified 1401
267 Ga0495674_0294461 3300047319 Bacteria 1326
268 Ga0495674_0851767 3300047319 Bacteria 706
269 Ga0495674_1198202 3300047319 Bacteria 574
270 Ga0495676_0203984 3300047321 Bacteria 1372
271 Ga0495675_0288846 3300047444 Unclassified 976
272 Ga0495675_0368216 3300047444 Bacteria 842
273 Ga0495675_0437173 3300047444 Unclassified 758
274 Ga0495675_0657019 3300047444 Unclassified 590
275 Ga0495675_0731087 3300047444 Unclassified 552
276 Ga0495684_0041076 3300047471 Bacteria 3545
277 Ga0495684_0091341 3300047471 Unclassified 2306
278 Ga0495684_0486988 3300047471 Unclassified 850
279 Ga0495593_0590039 3300047673 Unclassified 558
280 Ga0495602_0491277 3300048088 Bacteria 860
281 Ga0496105_0761202 3300048908 Bacteria 739
282 Ga0496109_1355773 3300048912 Unclassified 647
283 Ga0496112_1070759 3300048915 Bacteria 725
284 Ga0496115_0136967 3300048918 Bacteria 2019
285 Ga0496115_1343164 3300048918 Unclassified 530
286 Ga0501081_0332676 3300049743 Bacteria 1118
287 nmdc:mga08y16_683922_c1 3300050511 Bacteria 1027
288 Ga0501082_0000796 3300060353 Bacteria 27751
289 Ga0157376_11636585
290 Ga0070676_11149751
291 Ga0070683_100000035
292 Ga0070683_100288748
293 Ga0070670_100581555
294 Ga0068869_100476929
295 Ga0068869_101695540
296 Ga0070666_10293480
297 Ga0068868_100590326
298 Ga0070689_100044601
299 Ga0070668_100472652
300 Ga0070669_101151593
301 Ga0070675_100800874
302 Ga0070675_100880456
303 Ga0070675_100887036
304 Ga0070673_100428999
305 Ga0070673_100694382
306 Ga0070673_101639571
307 Ga0070667_102043139
308 Ga0070713_101428821
309 Ga0070713_102396692
310 Ga0070713_102444078
311 Ga0070711_100735145
312 Ga0070678_100318265
313 Ga0070678_100337990
314 Ga0070678_101004360
315 Ga0070681_10383822
316 Ga0068867_100531769
317 Ga0070685_10088303
318 Ga0070679_100030091
319 Ga0070684_100000037
320 Ga0070684_100409281
321 Ga0070684_100911973
322 Ga0070684_101006640
323 Ga0070697_100805540
324 Ga0070672_101241848
325 Ga0070686_101263753
326 Ga0070686_101353079
327 Ga0070686_101869686
328 Ga0070665_101368394
329 Ga0068855_100141166
330 Ga0068855_100859384
331 Ga0068855_102511640
332 Ga0068857_100628570
333 Ga0068857_102109428
334 Ga0068852_101282354
335 Ga0068864_100519053
336 Ga0068864_102541967
337 Ga0068863_100082524
338 Ga0068863_100548625
339 Ga0068858_101390007
340 Ga0068860_100521398
341 Ga0068860_101321183
342 Ga0070717_10185718
343 Ga0070717_10974055
344 Ga0070717_11175777
345 Ga0070717_12147342
346 Ga0070712_100577926
347 Ga0097621_100172894
348 Ga0097621_100351558
349 Ga0097621_100404132
350 Ga0068871_100031562
351 Ga0068871_100525634
352 Ga0068871_101637437
353 Ga0068871_101810311
354 Ga0068871_101892606
355 Ga0075434_101391162
356 Ga0097620_102577436
357 Ga0075435_101002708
358 Ga0105240_10214295
359 Ga0105240_10971433
360 Ga0105240_11682534
361 Ga0105240_11735774
362 Ga0111539_10683346
363 Ga0105245_11038768
364 Ga0105241_11197679
365 Ga0105241_11553430
366 Ga0105242_10563271
367 Ga0105242_10762459
368 Ga0105242_10848388
369 Ga0105242_10930627
370 Ga0105248_10109130
371 Ga0105248_10117704
372 Ga0105248_10302789
373 Ga0105248_10446672
374 Ga0105248_10828893
375 Ga0105248_11542801
376 Ga0105248_12421808
377 Ga0105248_12547457
378 Ga0105237_10009673
379 Ga0105238_10909033
380 Ga0105238_11014428
381 Ga0105239_11174630
382 Ga0105239_11228958
383 Ga0105246_10749946
384 Ga0105246_11062299
385 Ga0157370_10744717
386 Ga0157370_10763715
387 Ga0157369_10047927
388 Ga0157369_10116840
389 Ga0157374_10357804
390 Ga0157374_11069350
391 Ga0157374_11228807
392 Ga0157374_11572566
393 Ga0157378_10458179
394 Ga0157378_11375896
395 Ga0157378_12105952
396 Ga0157378_13019227
397 Ga0163162_10211110
398 Ga0163162_12051870
399 Ga0157375_10886759
400 Ga0163163_10045375
401 Ga0163163_10534758
402 Ga0163163_10710750
403 Ga0163163_12038148
404 Ga0157380_11792193
405 Ga0157380_12293431
406 Ga0157377_11433551
407 Ga0157379_10364606
408 Ga0157376_10682967
409 Ga0157376_10793770
410 Ga0157376_10839711
411 Ga0157376_10874806
412 Ga0157376_11670993
413 Ga0157376_11938316
414 Ga0207680_10504610
415 Ga0207695_10698069
416 Ga0207695_11683097
417 Ga0207671_10273291
418 Ga0207662_10180898
419 Ga0207652_10387915
420 Ga0207681_10844231
421 Ga0207694_10416656
422 Ga0207650_11550824
423 Ga0207650_11753373
424 Ga0207659_10163284
425 Ga0207686_10271092
426 Ga0207686_10560463
427 Ga0207670_11599907
428 Ga0207669_10772575
429 Ga0207665_11121537
430 Ga0207711_10072993
431 Ga0207711_10322101
432 Ga0207711_11318293
433 Ga0207711_11720505
434 Ga0207711_11791997
435 Ga0207689_10998759
436 Ga0207661_10000008
437 Ga0207661_10481916
438 Ga0207661_10906909
439 Ga0207661_11407814
440 Ga0207667_10114556
441 Ga0207667_10142994
442 Ga0207651_10605793
443 Ga0207668_11193189
444 Ga0207677_11383276
445 Ga0207677_11993181
446 Ga0207703_10531571
447 Ga0207703_10968116
448 Ga0207708_10723466
449 Ga0207641_10319733
450 Ga0207641_10705694
451 Ga0207641_12583053
452 Ga0207676_10158886
453 Ga0207676_10644907
454 Ga0207676_10725789
455 Ga0207674_10757590
456 Ga0207683_10549059
457 Ga0207683_10586916
458 Ga0268266_10732180
459 Ga0268266_11352485
460 Ga0268265_11699325
461 Ga0268264_10726529
462 Ga0265330_10045078
463 Ga0265325_10411059
464 Ga0265339_10080533
465 Ga0265331_10073141
466 Ga0265331_10188545
467 Ga0265316_10001374
468 Ga0265316_10002992
469 Ga0265316_10003112
470 Ga0265316_10056174
471 Ga0265316_10133297
472 Ga0265316_10216534
473 Ga0265316_10235207
474 Ga0265316_10341952
475 Ga0265316_10363056
476 Ga0265316_10452571
477 Ga0265314_10025568
478 Ga0265342_10039960
479 Ga0265342_10049465
480 Ga0373926_0006397
481 Ga0373926_0261942
482 Ga0373945_0004097
483 Ga0373943_0532749
484 Ga0373935_0067090
485 Ga0373935_0801844
486 Ga0373935_1059497
487 Ga0373927_0001825
488 Ga0373927_0194267
489 Ga0373927_0234544
490 Ga0373947_0000142
491 Ga0373947_0128319
492 Ga0373937_0102687
493 Ga0373937_2025151
494 Ga0373925_0000221
495 Ga0373925_0371709
496 Ga0373925_1523276
497 Ga0466965_0409565
498 Ga0466957_1074224
499 Ga0466959_0125899
500 Ga0451576_0325574
501 Ga0451576_0339769
502 Ga0466967_2460178
503 Ga0495592_0265919
504 Ga0495592_0382056
505 Ga0495629_0892382
506 Ga0495651_0023939
507 Ga0495651_0442081
508 Ga0495651_0787864
509 Ga0495653_0061506
510 Ga0495580_0070139
511 Ga0495582_0041084
512 Ga0495639_0381245
513 Ga0495664_0107037
514 Ga0495594_0046676
515 Ga0495608_0016023
516 Ga0495618_0115090
517 Ga0495618_0293753
518 Ga0495628_0056939
519 Ga0495628_0436347
520 Ga0495628_0869997
521 Ga0495630_1369952
522 Ga0495666_0200282
523 Ga0495652_0486796
524 Ga0495665_0180274
525 Ga0495665_0667473
526 Ga0495640_0460984
527 Ga0495586_0635484
528 Ga0495587_0670099
529 Ga0495645_0043842
530 Ga0495645_0097841
531 Ga0495645_0214952
532 Ga0495645_0319391
533 Ga0495645_0905811
534 Ga0495667_0085302
535 Ga0495667_0873230
536 Ga0495634_0534712
537 Ga0495635_0016020
538 Ga0495657_0093793
539 Ga0495599_0852143
540 Ga0495623_0246561
541 Ga0495623_0327419
542 Ga0495623_0354948
543 Ga0495623_0473539
544 Ga0495646_0008265
545 Ga0495669_0428407
546 Ga0495624_0182285
547 Ga0495624_0783103
548 Ga0495600_0063983
549 Ga0495581_0216113
550 Ga0495604_0106969
551 Ga0495604_0162710
552 Ga0495604_0363401
553 Ga0495674_0021041
554 Ga0495674_0268298
555 Ga0495674_0294461
556 Ga0495674_0851767
557 Ga0495674_1198202
558 Ga0495676_0203984
559 Ga0495675_0288846
560 Ga0495675_0368216
561 Ga0495675_0437173
562 Ga0495675_0657019
563 Ga0495675_0731087
564 Ga0495684_0041076
565 Ga0495684_0091341
566 Ga0495684_0486988
567 Ga0495593_0590039
568 Ga0495602_0491277
569 Ga0496105_0761202
570 Ga0496109_1355773
571 Ga0496112_1070759
572 Ga0496115_0136967
573 Ga0496115_1343164
574 Ga0501081_0332676
575 nmdc:mga08y16_683922_c1
576 Ga0501082_0000796

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09876

DUF2103

Predicted metal-binding protein (DUF2103)

5

94

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1it7-assembly1.cif.gz_B crystal structure of archaeosine trna-guanine transglycosylase complexed with guanine 0.7652 50 76
3x0c-assembly1.cif.gz_A crystal structure of pip4kiibeta i368a complex with gmp 0.7507 64 81
6k4h-assembly1.cif.gz_A crystal structure of the pi5p4kbeta-amppnp complex 0.7463 64 81
3x01-assembly1.cif.gz_A crystal structure of pip4kiibeta complex with amp 0.7434 64 81
3x02-assembly1.cif.gz_A crystal structure of pip4kiibeta complex with gmp 0.7352 64 81
ID Description Score Start End Superfamily
1it8B01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Queuine tRNA-ribosyltransferase-like 0.7523 50 76 3.20.20.105
af_K7L4D0_610_722_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.725 2 95 2.30.29.30
af_F1Q6B3_1495_1589_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7229 53 95 2.30.29.30
2yf0A01 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.6858 53 94 2.30.29.30
af_Q9LU24_186_340_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.6794 50 76 2.120.10.80
ID Description Score Start End GO Terms
AF-A0A076HIK5-F1-model_v4 Uncharacterized protein 0.8516 33 94
AF-A0A6U6BHY6-F1-model_v4 Spp2/MOS2 G-patch domain-containing protein 0.8458 14 95
AF-A0A7G8HB30-F1-model_v4 Uncharacterized conserved metal-binding protein (DUF2103) 0.8422 17 95
AF-A0A350UL57-F1-model_v4 DUF721 domain-containing protein 0.8374 1 95
AF-K9RWH3-F1-model_v4 Putative metal-binding protein (DUF2103) 0.8372 11 95

Map