F388579

General Info

Members Datasets Scaffolds Average Seq Length
288 176 576 355

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10048591|Ga0157370_100485912
Length 429
Sequence MRQARRISNPRHSGDTADFQSALQRSAARCRSAAQWFLRKRLRNPVRPLNADGDAAARRLHHPGYCQKGVRLEASPPILSRYMKVLITGSSGLIGSEAVAHYDREGHEVHGVDNNMRREFFGPQGDTRWNLDRLRAATKKFTHHELDIRDRARILDFFKKEKFDLVIHCAAQPSHDKAKDIPLVDFDVNAGGTLNLLEATRQTNPDAVFIFMSTNKVYGDAPNEVPLKELPTRWDYSRAEDFNGIREDCRIDRTTHSVFGASKTAADVMAQEYGRYFGMKVGVFRGGCLTGENHSGVQLHGFLSYLVKVAQAGETYTVLGYKGKQVRDQIHSSDVLAAFAEFTKNPRPGEVYNLGGGRENSASILECIEKIEALTARKISWKYVDQNRVGDHICYISDLSKLKSHFPNWKLRWSLDDILERMCQSPVLK

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
67 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
98 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
99 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
100 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
101 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
102 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
103 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
104 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
105 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
106 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
107 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
110 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
112 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
113 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
114 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
115 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
116 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
117 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
118 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
119 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
120 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
121 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
124 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
127 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
128 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
129 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
130 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
131 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
132 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
133 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
134 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
135 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
136 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
137 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
138 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
139 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
140 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
141 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
142 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
143 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
144 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
145 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
146 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
147 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
148 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
149 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
150 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
151 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
152 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
153 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
154 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
155 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
156 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
157 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
158 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
159 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
160 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
161 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
166 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
167 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
168 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
170 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
171 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
172 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
173 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
174 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.69
Nodule 0
Rhizoplane 2.43
Rhizosphere 94.44
Stem 0
Stem Tuber 0
Unclassified 14.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10048591 3300013104 Unclassified 4064
2 rootL2_10229353 3300003322 Bacteria 1203
3 Ga0070658_10014093 3300005327 Bacteria 6420
4 Ga0070658_10021340 3300005327 Bacteria 5190
5 Ga0070683_100003514 3300005329 Bacteria 12748
6 Ga0070670_100130949 3300005331 Bacteria 2166
7 Ga0070660_100081941 3300005339 Bacteria 2533
8 Ga0070692_10002028 3300005345 Bacteria 7691
9 Ga0070671_100083949 3300005355 Bacteria 2664
10 Ga0070671_100328899 3300005355 Bacteria 1303
11 Ga0070659_100021187 3300005366 Bacteria 4946
12 Ga0070703_10000160 3300005406 Bacteria 33776
13 Ga0070709_10005425 3300005434 Bacteria 6909
14 Ga0070709_10028025 3300005434 Unclassified 3356
15 Ga0070714_100002460 3300005435 Bacteria 13671
16 Ga0070713_100038488 3300005436 Bacteria 3876
17 Ga0070713_100044579 3300005436 Bacteria 3631
18 Ga0070711_100002030 3300005439 Bacteria 11406
19 Ga0070711_100002518 3300005439 Bacteria 10471
20 Ga0070711_100029462 3300005439 Bacteria 3623
21 Ga0070711_100104785 3300005439 Unclassified 2064
22 Ga0070705_100046608 3300005440 Bacteria 2500
23 Ga0070700_100051578 3300005441 Bacteria 2561
24 Ga0070700_100103704 3300005441 Unclassified 1878
25 Ga0070708_100005786 3300005445 Bacteria 9814
26 Ga0070708_100038977 3300005445 Bacteria 4155
27 Ga0070708_100120593 3300005445 Bacteria 2419
28 Ga0070708_100124521 3300005445 Unclassified 2381
29 Ga0070706_100007462 3300005467 Bacteria 10253
30 Ga0070706_100007631 3300005467 Bacteria 10123
31 Ga0070706_100035217 3300005467 Unclassified 4623
32 Ga0070707_100010223 3300005468 Bacteria 8739
33 Ga0070707_100047783 3300005468 Bacteria 4098
34 Ga0070698_100004623 3300005471 Bacteria 15124
35 Ga0070698_100004709 3300005471 Bacteria 14985
36 Ga0070698_100009145 3300005471 Bacteria 10634
37 Ga0070698_100092732 3300005471 Bacteria 3001
38 Ga0070699_100008897 3300005518 Bacteria 8698
39 Ga0070679_100189557 3300005530 Bacteria 2026
40 Ga0070684_100005562 3300005535 Bacteria 9672
41 Ga0070697_100003239 3300005536 Bacteria 12493
42 Ga0070697_100071985 3300005536 Bacteria 2836
43 Ga0068853_100447093 3300005539 Unclassified 1215
44 Ga0070695_100130235 3300005545 Bacteria 1733
45 Ga0070696_100031796 3300005546 Unclassified 3619
46 Ga0070665_100015175 3300005548 Bacteria 7735
47 Ga0070704_100008965 3300005549 Bacteria 6028
48 Ga0070704_100022985 3300005549 Bacteria 4064
49 Ga0068855_100009224 3300005563 Bacteria 11919
50 Ga0070664_100028483 3300005564 Bacteria 4647
51 Ga0068857_100286071 3300005577 Bacteria 1517
52 Ga0068854_100009315 3300005578 Bacteria 6337
53 Ga0068859_100160104 3300005617 Bacteria 2330
54 Ga0068864_100014247 3300005618 Bacteria 6602
55 Ga0068861_100145347 3300005719 Bacteria 1940
56 Ga0068851_10026662 3300005834 Bacteria 2842
57 Ga0068863_100003006 3300005841 Bacteria 16662
58 Ga0068863_100079783 3300005841 Bacteria 3099
59 Ga0068863_100108058 3300005841 Bacteria 2648
60 Ga0068863_100128115 3300005841 Unclassified 2422
61 Ga0068863_100167915 3300005841 Bacteria 2104
62 Ga0068863_100282200 3300005841 Bacteria 1609
63 Ga0068860_100007205 3300005843 Bacteria 11120
64 Ga0081455_10167699 3300005937 Bacteria 1676
65 Ga0075368_10029522 3300006042 Bacteria 2120
66 Ga0070715_10050155 3300006163 Bacteria 1791
67 Ga0070716_100001110 3300006173 Bacteria 11852
68 Ga0070716_100002801 3300006173 Bacteria 8114
69 Ga0070716_100025029 3300006173 Bacteria 3180
70 Ga0068871_100015126 3300006358 Bacteria 5769
71 Ga0075433_10091439 3300006852 Bacteria 2690
72 Ga0075434_100010471 3300006871 Bacteria 8694
73 Ga0075434_100020556 3300006871 Bacteria 6404
74 Ga0075434_100396026 3300006871 Bacteria 1402
75 Ga0075436_100104725 3300006914 Unclassified 1972
76 Ga0075436_100181781 3300006914 Bacteria 1486
77 Ga0097620_100123892 3300006931 Unclassified 2652
78 Ga0097620_100160098 3300006931 Bacteria 2330
79 Ga0099794_10000859 3300007265 Bacteria 10228
80 Ga0099794_10001334 3300007265 Bacteria 8563
81 Ga0099794_10016470 3300007265 Unclassified 3277
82 Ga0099794_10105613 3300007265 Unclassified 1408
83 Ga0105240_10020331 3300009093 Bacteria 8859
84 Ga0105240_10039829 3300009093 Eukaryota 6015
85 Ga0105240_10062479 3300009093 Unclassified 4637
86 Ga0105240_10382841 3300009093 Bacteria 1588
87 Ga0105245_10000043 3300009098 Bacteria 136604
88 Ga0114129_10209552 3300009147 Bacteria 2635
89 Ga0114129_10212099 3300009147 Bacteria 2617
90 Ga0105242_10147594 3300009176 Unclassified 2047
91 Ga0105248_10054818 3300009177 Unclassified 4472
92 Ga0105238_10000001 3300009551 Bacteria 2036163
93 Ga0105249_10064075 3300009553 Unclassified 3378
94 Ga0105249_10189643 3300009553 Bacteria 2006
95 Ga0105249_10400977 3300009553 Bacteria 1402
96 Ga0157370_10069653 3300013104 Bacteria 3322
97 Ga0157370_10363004 3300013104 Unclassified 1334
98 Ga0157369_10038956 3300013105 Bacteria 5196
99 Ga0157378_10000912 3300013297 Bacteria 27214
100 Ga0157378_10001027 3300013297 Bacteria 25529
101 Ga0157378_10054305 3300013297 Bacteria 3567
102 Ga0163162_10275641 3300013306 Unclassified 1814
103 Ga0163162_10376703 3300013306 Bacteria 1552
104 Ga0157372_10001684 3300013307 Bacteria 23902
105 Ga0157372_10129027 3300013307 Bacteria 2908
106 Ga0157372_10412238 3300013307 Bacteria 1574
107 Ga0157375_10178880 3300013308 Bacteria 2272
108 Ga0163163_10140818 3300014325 Bacteria 2454
109 Ga0157379_10009491 3300014968 Bacteria 8474
110 Ga0157376_10000026 3300014969 Bacteria 204319
111 Ga0163161_10289871 3300017792 Bacteria 1286
112 Ga0213876_10022711 3300021384 Bacteria 3315
113 Ga0207656_10016139 3300025321 Bacteria 2903
114 Ga0207653_10000080 3300025885 Bacteria 69891
115 Ga0207642_10039579 3300025899 Bacteria 2050
116 Ga0207699_10003734 3300025906 Bacteria 7275
117 Ga0207699_10008717 3300025906 Bacteria 5018
118 Ga0207699_10062134 3300025906 Bacteria 2251
119 Ga0207699_10072483 3300025906 Bacteria 2109
120 Ga0207699_10146927 3300025906 Bacteria 1555
121 Ga0207705_10017608 3300025909 Bacteria 5113
122 Ga0207705_10022249 3300025909 Bacteria 4522
123 Ga0207684_10006086 3300025910 Bacteria 11037
124 Ga0207684_10022514 3300025910 Bacteria 5379
125 Ga0207695_10110962 3300025913 Unclassified 2722
126 Ga0207695_10144585 3300025913 Bacteria 2323
127 Ga0207695_10205151 3300025913 Unclassified 1884
128 Ga0207663_10004988 3300025916 Bacteria 6653
129 Ga0207663_10010606 3300025916 Unclassified 4912
130 Ga0207663_10178612 3300025916 Bacteria 1514
131 Ga0207663_10196052 3300025916 Bacteria 1454
132 Ga0207657_10089032 3300025919 Bacteria 2579
133 Ga0207646_10023257 3300025922 Bacteria 5695
134 Ga0207646_10062597 3300025922 Unclassified 3321
135 Ga0207694_10000001 3300025924 Bacteria 4078485
136 Ga0207694_10024858 3300025924 Unclassified 4549
137 Ga0207687_10000024 3300025927 Bacteria 187490
138 Ga0207664_10000520 3300025929 Bacteria 27368
139 Ga0207664_10113245 3300025929 Bacteria 2259
140 Ga0207644_10061385 3300025931 Bacteria 2722
141 Ga0207686_10000090 3300025934 Bacteria 74224
142 Ga0207686_10053570 3300025934 Bacteria 2523
143 Ga0207686_10090089 3300025934 Unclassified 2023
144 Ga0207665_10002704 3300025939 Bacteria 11893
145 Ga0207665_10005176 3300025939 Bacteria 8709
146 Ga0207665_10018725 3300025939 Bacteria 4550
147 Ga0207691_10052133 3300025940 Bacteria 3737
148 Ga0207711_10098922 3300025941 Bacteria 2578
149 Ga0207661_10008318 3300025944 Bacteria 7409
150 Ga0207679_10009830 3300025945 Bacteria 6140
151 Ga0207667_10184478 3300025949 Bacteria 2142
152 Ga0207658_10121852 3300025986 Bacteria 2081
153 Ga0207658_10150176 3300025986 Bacteria 1897
154 Ga0207708_10061744 3300026075 Bacteria 2861
155 Ga0207641_10104216 3300026088 Bacteria 2504
156 Ga0207676_10005896 3300026095 Bacteria 8654
157 Ga0207674_10394894 3300026116 Bacteria 1337
158 Ga0209588_1006929 3300027671 Bacteria 3317
159 Ga0209588_1037179 3300027671 Bacteria 1567
160 Ga0207428_10231049 3300027907 Bacteria 1384
161 Ga0268266_10000194 3300028379 Bacteria 106020
162 Ga0268264_10033676 3300028381 Bacteria 4211
163 Ga0268264_10124244 3300028381 Bacteria 2278
164 Ga0265326_10017018 3300028558 Bacteria 2100
165 Ga0265338_10000053 3300028800 Bacteria 208184
166 Ga0265338_10000442 3300028800 Bacteria 74078
167 Ga0265338_10001870 3300028800 Bacteria 33044
168 Ga0265338_10006598 3300028800 Bacteria 14710
169 Ga0265338_10023701 3300028800 Bacteria 6296
170 Ga0265338_10133335 3300028800 Unclassified 1957
171 Ga0265338_10152202 3300028800 Bacteria 1796
172 Ga0265324_10002441 3300029957 Bacteria 9518
173 Ga0265324_10011299 3300029957 Bacteria 3408
174 Ga0307511_10000763 3300030521 Bacteria 34313
175 Ga0265325_10036018 3300031241 Bacteria 2624
176 Ga0265331_10066973 3300031250 Bacteria 1685
177 Ga0265316_10286254 3300031344 Bacteria 1203
178 Ga0265314_10110006 3300031711 Unclassified 1753
179 Ga0307410_10165547 3300031852 Bacteria 1661
180 Ga0307406_10006004 3300031901 Bacteria 6668
181 Ga0307407_10093847 3300031903 Bacteria 1846
182 Ga0307409_100003711 3300031995 Bacteria 8378
183 Ga0373934_0039025 3300035086 Bacteria 1871
184 Ga0373923_0009516 3300035111 Bacteria 3510
185 Ga0373932_0000114 3300035112 Bacteria 22242
186 Ga0373936_0001847 3300035113 Bacteria 7800
187 Ga0373954_0022598 3300035118 Bacteria 2855
188 Ga0373954_0058944 3300035118 Archaea 1809
189 Ga0373956_0061179 3300035119 Bacteria 1706
190 Ga0373943_0000891 3300035170 Bacteria 13128
191 Ga0373943_0030080 3300035170 Bacteria 2569
192 Ga0373946_0003701 3300035171 Bacteria 5418
193 Ga0373946_0022919 3300035171 Bacteria 2435
194 Ga0373946_0136485 3300035171 Unclassified 1133
195 Ga0373955_0114231 3300035172 Archaea 1564
196 Ga0373955_0125796 3300035172 Bacteria 1493
197 Ga0373924_0090261 3300035410 Bacteria 1310
198 Ga0373935_0022483 3300035692 Bacteria 3867
199 Ga0373935_0087516 3300035692 Unclassified 2034
200 Ga0373927_0001505 3300035695 Bacteria 17538
201 Ga0373927_0005248 3300035695 Bacteria 8959
202 Ga0373927_0217701 3300035695 Unclassified 1254
203 Ga0373947_0000996 3300035725 Bacteria 17295
204 Ga0373947_0020790 3300035725 Bacteria 3793
205 Ga0373937_0011257 3300036401 Bacteria 7842
206 Ga0373925_0005583 3300037068 Bacteria 9364
207 Ga0373925_0009538 3300037068 Bacteria 7067
208 Ga0400489_65997 3300039093 Unclassified 1625
209 Ga0436365_0357340 3300039437 Bacteria 3180
210 Ga0436365_1518819 3300039437 Bacteria 8460
211 Ga0451577_0224148 3300042876 Bacteria 1700
212 Ga0451576_0129445 3300045051 Bacteria 2631
213 Ga0495592_0073605 3300046454 Unclassified 2484
214 Ga0495651_0000141 3300046462 Bacteria 53187
215 Ga0495651_0188722 3300046462 Unclassified 1452
216 Ga0495653_0014703 3300046463 Bacteria 6385
217 Ga0495580_0030936 3300046472 Bacteria 3871
218 Ga0495582_0000052 3300046473 Bacteria 58410
219 Ga0495582_0114570 3300046473 Bacteria 1515
220 Ga0495664_0130978 3300046477 Bacteria 1518
221 Ga0495608_0018993 3300046511 Bacteria 4737
222 Ga0495618_0075896 3300046514 Bacteria 2141
223 Ga0495628_0027803 3300046516 Bacteria 4597
224 Ga0495628_0064548 3300046516 Archaea 2866
225 Ga0495630_0003002 3300046517 Bacteria 11704
226 Ga0495630_0028464 3300046517 Bacteria 4151
227 Ga0495630_0080024 3300046517 Bacteria 2465
228 Ga0495630_0182794 3300046517 Bacteria 1599
229 Ga0495666_0001926 3300046526 Bacteria 10240
230 Ga0495666_0055359 3300046526 Bacteria 1901
231 Ga0495652_0030074 3300046529 Bacteria 4766
232 Ga0495665_0036748 3300046531 Bacteria 2614
233 Ga0495586_0016078 3300046535 Bacteria 3981
234 Ga0495587_0079631 3300046536 Bacteria 1899
235 Ga0495587_0088692 3300046536 Archaea 1788
236 Ga0495667_0044563 3300046559 Bacteria 2938
237 Ga0495667_0044870 3300046559 Unclassified 2927
238 Ga0495668_0002498 3300046616 Bacteria 15045
239 Ga0495634_0022926 3300046642 Bacteria 4396
240 Ga0495635_0042075 3300046663 Bacteria 3156
241 Ga0495657_0017214 3300046675 Bacteria 5251
242 Ga0495599_0088345 3300046678 Bacteria 1935
243 Ga0495623_0004534 3300046679 Bacteria 9119
244 Ga0495646_0002431 3300046680 Bacteria 11426
245 Ga0495613_0020022 3300046689 Bacteria 4986
246 Ga0495624_0007075 3300046690 Bacteria 7903
247 Ga0495600_0190561 3300046809 Unclassified 1319
248 Ga0495604_0184611 3300047317 Unclassified 1457
249 Ga0495604_0198776 3300047317 Bacteria 1392
250 Ga0495674_0003577 3300047319 Bacteria 15106
251 Ga0495674_0011167 3300047319 Bacteria 8482
252 Ga0495674_0018267 3300047319 Bacteria 6529
253 Ga0495674_0039253 3300047319 Bacteria 4245
254 Ga0495680_0010541 3300047322 Bacteria 8251
255 Ga0495680_0136148 3300047322 Bacteria 1801
256 Ga0495680_0152401 3300047322 Unclassified 1684
257 Ga0495675_0008740 3300047444 Bacteria 6287
258 Ga0495675_0020492 3300047444 Bacteria 4206
259 Ga0495675_0157789 3300047444 Archaea 1398
260 Ga0495684_0023654 3300047471 Unclassified 4725
261 Ga0495684_0026695 3300047471 Unclassified 4438
262 Ga0495593_0029822 3300047673 Bacteria 2988
263 Ga0495602_0060801 3300048088 Unclassified 3289
264 Ga0495602_0103550 3300048088 Bacteria 2330
265 Ga0495602_0186705 3300048088 Archaea 1593
266 Ga0495614_0017182 3300048089 Bacteria 3144
267 Ga0496102_0016525 3300048905 Bacteria 6450
268 Ga0496109_0130431 3300048912 Bacteria 2346
269 Ga0496109_0215619 3300048912 Bacteria 1805
270 Ga0496110_0328376 3300048913 Bacteria 1393
271 Ga0496114_0062965 3300048917 Bacteria 3105
272 Ga0496115_0003327 3300048918 Bacteria 11536
273 Ga0496115_0052781 3300048918 Unclassified 3262
274 Ga0496126_0289906 3300048929 Bacteria 1354
275 Ga0501034_0079609 3300049571 Bacteria 3280
276 Ga0501073_0004779 3300049589 Bacteria 10165
277 Ga0501080_0070005 3300049742 Unclassified 3263
278 nmdc:mga0k408_70445_c1 3300050493 Bacteria 2040
279 nmdc:mga0n895_19401_c1 3300050512 Bacteria 6319
280 nmdc:mga0n895_392875_c1 3300050512 Bacteria 1403
281 nmdc:mga0n895_5777_c1 3300050512 Bacteria 10384
282 nmdc:mga0n895_582902_c1 3300050512 Bacteria 1122
283 nmdc:mga0rr50_7648_c1 3300050513 Bacteria 6682
284 nmdc:mga08x19_169758_c1 3300050514 Bacteria 1485
285 nmdc:mga08x19_231_c1 3300050514 Bacteria 42540
286 nmdc:mga08x19_245517_c1 3300050514 Bacteria 1235
287 nmdc:mga0a205_103963_c1 3300050515 Bacteria 2739
288 Ga0495612_0009095 3300053078 Bacteria 4029
289 Ga0157370_10048591
290 rootL2_10229353
291 Ga0070658_10014093
292 Ga0070658_10021340
293 Ga0070683_100003514
294 Ga0070670_100130949
295 Ga0070660_100081941
296 Ga0070692_10002028
297 Ga0070671_100083949
298 Ga0070671_100328899
299 Ga0070659_100021187
300 Ga0070703_10000160
301 Ga0070709_10005425
302 Ga0070709_10028025
303 Ga0070714_100002460
304 Ga0070713_100038488
305 Ga0070713_100044579
306 Ga0070711_100002030
307 Ga0070711_100002518
308 Ga0070711_100029462
309 Ga0070711_100104785
310 Ga0070705_100046608
311 Ga0070700_100051578
312 Ga0070700_100103704
313 Ga0070708_100005786
314 Ga0070708_100038977
315 Ga0070708_100120593
316 Ga0070708_100124521
317 Ga0070706_100007462
318 Ga0070706_100007631
319 Ga0070706_100035217
320 Ga0070707_100010223
321 Ga0070707_100047783
322 Ga0070698_100004623
323 Ga0070698_100004709
324 Ga0070698_100009145
325 Ga0070698_100092732
326 Ga0070699_100008897
327 Ga0070679_100189557
328 Ga0070684_100005562
329 Ga0070697_100003239
330 Ga0070697_100071985
331 Ga0068853_100447093
332 Ga0070695_100130235
333 Ga0070696_100031796
334 Ga0070665_100015175
335 Ga0070704_100008965
336 Ga0070704_100022985
337 Ga0068855_100009224
338 Ga0070664_100028483
339 Ga0068857_100286071
340 Ga0068854_100009315
341 Ga0068859_100160104
342 Ga0068864_100014247
343 Ga0068861_100145347
344 Ga0068851_10026662
345 Ga0068863_100003006
346 Ga0068863_100079783
347 Ga0068863_100108058
348 Ga0068863_100128115
349 Ga0068863_100167915
350 Ga0068863_100282200
351 Ga0068860_100007205
352 Ga0081455_10167699
353 Ga0075368_10029522
354 Ga0070715_10050155
355 Ga0070716_100001110
356 Ga0070716_100002801
357 Ga0070716_100025029
358 Ga0068871_100015126
359 Ga0075433_10091439
360 Ga0075434_100010471
361 Ga0075434_100020556
362 Ga0075434_100396026
363 Ga0075436_100104725
364 Ga0075436_100181781
365 Ga0097620_100123892
366 Ga0097620_100160098
367 Ga0099794_10000859
368 Ga0099794_10001334
369 Ga0099794_10016470
370 Ga0099794_10105613
371 Ga0105240_10020331
372 Ga0105240_10039829
373 Ga0105240_10062479
374 Ga0105240_10382841
375 Ga0105245_10000043
376 Ga0114129_10209552
377 Ga0114129_10212099
378 Ga0105242_10147594
379 Ga0105248_10054818
380 Ga0105238_10000001
381 Ga0105249_10064075
382 Ga0105249_10189643
383 Ga0105249_10400977
384 Ga0157370_10069653
385 Ga0157370_10363004
386 Ga0157369_10038956
387 Ga0157378_10000912
388 Ga0157378_10001027
389 Ga0157378_10054305
390 Ga0163162_10275641
391 Ga0163162_10376703
392 Ga0157372_10001684
393 Ga0157372_10129027
394 Ga0157372_10412238
395 Ga0157375_10178880
396 Ga0163163_10140818
397 Ga0157379_10009491
398 Ga0157376_10000026
399 Ga0163161_10289871
400 Ga0213876_10022711
401 Ga0207656_10016139
402 Ga0207653_10000080
403 Ga0207642_10039579
404 Ga0207699_10003734
405 Ga0207699_10008717
406 Ga0207699_10062134
407 Ga0207699_10072483
408 Ga0207699_10146927
409 Ga0207705_10017608
410 Ga0207705_10022249
411 Ga0207684_10006086
412 Ga0207684_10022514
413 Ga0207695_10110962
414 Ga0207695_10144585
415 Ga0207695_10205151
416 Ga0207663_10004988
417 Ga0207663_10010606
418 Ga0207663_10178612
419 Ga0207663_10196052
420 Ga0207657_10089032
421 Ga0207646_10023257
422 Ga0207646_10062597
423 Ga0207694_10000001
424 Ga0207694_10024858
425 Ga0207687_10000024
426 Ga0207664_10000520
427 Ga0207664_10113245
428 Ga0207644_10061385
429 Ga0207686_10000090
430 Ga0207686_10053570
431 Ga0207686_10090089
432 Ga0207665_10002704
433 Ga0207665_10005176
434 Ga0207665_10018725
435 Ga0207691_10052133
436 Ga0207711_10098922
437 Ga0207661_10008318
438 Ga0207679_10009830
439 Ga0207667_10184478
440 Ga0207658_10121852
441 Ga0207658_10150176
442 Ga0207708_10061744
443 Ga0207641_10104216
444 Ga0207676_10005896
445 Ga0207674_10394894
446 Ga0209588_1006929
447 Ga0209588_1037179
448 Ga0207428_10231049
449 Ga0268266_10000194
450 Ga0268264_10033676
451 Ga0268264_10124244
452 Ga0265326_10017018
453 Ga0265338_10000053
454 Ga0265338_10000442
455 Ga0265338_10001870
456 Ga0265338_10006598
457 Ga0265338_10023701
458 Ga0265338_10133335
459 Ga0265338_10152202
460 Ga0265324_10002441
461 Ga0265324_10011299
462 Ga0307511_10000763
463 Ga0265325_10036018
464 Ga0265331_10066973
465 Ga0265316_10286254
466 Ga0265314_10110006
467 Ga0307410_10165547
468 Ga0307406_10006004
469 Ga0307407_10093847
470 Ga0307409_100003711
471 Ga0373934_0039025
472 Ga0373923_0009516
473 Ga0373932_0000114
474 Ga0373936_0001847
475 Ga0373954_0022598
476 Ga0373954_0058944
477 Ga0373956_0061179
478 Ga0373943_0000891
479 Ga0373943_0030080
480 Ga0373946_0003701
481 Ga0373946_0022919
482 Ga0373946_0136485
483 Ga0373955_0114231
484 Ga0373955_0125796
485 Ga0373924_0090261
486 Ga0373935_0022483
487 Ga0373935_0087516
488 Ga0373927_0001505
489 Ga0373927_0005248
490 Ga0373927_0217701
491 Ga0373947_0000996
492 Ga0373947_0020790
493 Ga0373937_0011257
494 Ga0373925_0005583
495 Ga0373925_0009538
496 Ga0400489_65997
497 Ga0436365_0357340
498 Ga0436365_1518819
499 Ga0451577_0224148
500 Ga0451576_0129445
501 Ga0495592_0073605
502 Ga0495651_0000141
503 Ga0495651_0188722
504 Ga0495653_0014703
505 Ga0495580_0030936
506 Ga0495582_0000052
507 Ga0495582_0114570
508 Ga0495664_0130978
509 Ga0495608_0018993
510 Ga0495618_0075896
511 Ga0495628_0027803
512 Ga0495628_0064548
513 Ga0495630_0003002
514 Ga0495630_0028464
515 Ga0495630_0080024
516 Ga0495630_0182794
517 Ga0495666_0001926
518 Ga0495666_0055359
519 Ga0495652_0030074
520 Ga0495665_0036748
521 Ga0495586_0016078
522 Ga0495587_0079631
523 Ga0495587_0088692
524 Ga0495667_0044563
525 Ga0495667_0044870
526 Ga0495668_0002498
527 Ga0495634_0022926
528 Ga0495635_0042075
529 Ga0495657_0017214
530 Ga0495599_0088345
531 Ga0495623_0004534
532 Ga0495646_0002431
533 Ga0495613_0020022
534 Ga0495624_0007075
535 Ga0495600_0190561
536 Ga0495604_0184611
537 Ga0495604_0198776
538 Ga0495674_0003577
539 Ga0495674_0011167
540 Ga0495674_0018267
541 Ga0495674_0039253
542 Ga0495680_0010541
543 Ga0495680_0136148
544 Ga0495680_0152401
545 Ga0495675_0008740
546 Ga0495675_0020492
547 Ga0495675_0157789
548 Ga0495684_0023654
549 Ga0495684_0026695
550 Ga0495593_0029822
551 Ga0495602_0060801
552 Ga0495602_0103550
553 Ga0495602_0186705
554 Ga0495614_0017182
555 Ga0496102_0016525
556 Ga0496109_0130431
557 Ga0496109_0215619
558 Ga0496110_0328376
559 Ga0496114_0062965
560 Ga0496115_0003327
561 Ga0496115_0052781
562 Ga0496126_0289906
563 Ga0501034_0079609
564 Ga0501073_0004779
565 Ga0501080_0070005
566 nmdc:mga0k408_70445_c1
567 nmdc:mga0n895_19401_c1
568 nmdc:mga0n895_392875_c1
569 nmdc:mga0n895_5777_c1
570 nmdc:mga0n895_582902_c1
571 nmdc:mga0rr50_7648_c1
572 nmdc:mga08x19_169758_c1
573 nmdc:mga08x19_231_c1
574 nmdc:mga08x19_245517_c1
575 nmdc:mga0a205_103963_c1
576 Ga0495612_0009095

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04321

RmlD_sub_bind

RmlD substrate binding domain

83

231

0.95

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

85

355

0.9

PF07993

NAD_binding_4

Male sterility protein

131

338

0.79

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

85

222

0.77

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

86

422

0.76

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

86

239

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
1orr-assembly3.cif.gz_C crystal structure of cdp-tyvelose 2-epimerase complexed with nad and cdp 0.9445 1 346
1orr-assembly3.cif.gz_C crystal structure of cdp-tyvelose 2-epimerase complexed with nad and cdp 0.939 1 346
1orr-assembly2.cif.gz_D crystal structure of cdp-tyvelose 2-epimerase complexed with nad and cdp 0.937 1 346
1orr-assembly1.cif.gz_A crystal structure of cdp-tyvelose 2-epimerase complexed with nad and cdp 0.9331 1 346
1orr-assembly2.cif.gz_D crystal structure of cdp-tyvelose 2-epimerase complexed with nad and cdp 0.9316 1 346
ID Description Score Start End Superfamily
1orrD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.937 1 346 3.40.50.720
1orrD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9316 1 346 3.40.50.720
6bwlA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9072 1 204 3.40.50.720
af_P72050_1_314_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8976 1 346 3.40.50.720
af_P72050_1_314_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8815 1 346 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A5B1CMT2-F1-model_v4 CDP-paratose 2-epimerase (EC 5.1.3.10) 0.9889 1 348 GO:0047732
AF-A0A2V9BML9-F1-model_v4 NAD-dependent epimerase 0.9888 1 298
AF-A0A538ABH6-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.988 1 347
AF-A0A358ENP8-F1-model_v4 NAD-dependent epimerase 0.9872 94 351
AF-A0A850Q6N9-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9861 2 271

Map