F387440

General Info

Members Datasets Scaffolds Average Seq Length
286 193 572 66

Family's Representative Sequence

Representative Sequence 3300021388|Ga0213875_10000432|Ga0213875_1000043235
Length 72
Sequence MQLVLGASGGWTIGLALGVLARRISAQARTAVAGVTQVAEQTDALSGVGRINDSGVRILHSARALRKVAVGR

Samples

Sample ID Description Type Environment
1 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
67 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
97 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
98 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
99 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
100 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
103 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
104 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
105 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
106 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
107 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
108 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
110 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
111 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
112 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
113 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
114 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
115 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
116 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
117 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
118 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
119 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
120 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
121 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
122 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
123 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
124 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
125 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
126 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
127 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
128 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
129 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
130 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
131 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
132 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
133 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
134 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
135 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
136 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
137 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
138 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
139 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
140 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
141 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
142 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
143 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
144 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
145 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
146 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
147 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
148 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
149 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
150 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
164 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
165 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
166 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
174 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
175 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
176 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
177 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
178 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
179 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
180 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
181 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
182 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
183 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
187 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
188 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
189 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
190 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
191 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
192 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
193 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.3
Metatranscriptomes 0.7
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.35
Nodule 0
Rhizoplane 12.59
Rhizosphere 84.97
Stem 0
Stem Tuber 0
Unclassified 14.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213875_10000432 3300021388 Bacteria 36597
2 Ga0070683_101182312 3300005329 Unclassified 735
3 Ga0070682_100016858 3300005337 Bacteria 4252
4 Ga0070691_10280382 3300005341 Bacteria 904
5 Ga0070687_100160778 3300005343 Unclassified 1327
6 Ga0070671_100335934 3300005355 Bacteria 1288
7 Ga0070667_100262320 3300005367 Bacteria 1547
8 Ga0070714_100368765 3300005435 Bacteria 1351
9 Ga0070713_100223045 3300005436 Bacteria 1710
10 Ga0070713_100614015 3300005436 Bacteria 1034
11 Ga0070701_10809013 3300005438 Bacteria 640
12 Ga0070711_100915254 3300005439 Bacteria 749
13 Ga0070711_101371373 3300005439 Unclassified 615
14 Ga0070705_100016895 3300005440 Bacteria 3800
15 Ga0070700_100754588 3300005441 Unclassified 779
16 Ga0070700_100986359 3300005441 Bacteria 692
17 Ga0070663_100199665 3300005455 Bacteria 1560
18 Ga0070663_100809992 3300005455 Bacteria 804
19 Ga0070678_100002361 3300005456 Bacteria 10307
20 Ga0070678_100937321 3300005456 Bacteria 793
21 Ga0070662_100945391 3300005457 Bacteria 736
22 Ga0070662_101121154 3300005457 Unclassified 675
23 Ga0070681_11786097 3300005458 Unclassified 542
24 Ga0068867_101305100 3300005459 Unclassified 670
25 Ga0070685_10711158 3300005466 Unclassified 733
26 Ga0070684_101363433 3300005535 Bacteria 668
27 Ga0068853_101926846 3300005539 Bacteria 573
28 Ga0070686_100014491 3300005544 Bacteria 4547
29 Ga0070686_100683773 3300005544 Bacteria 817
30 Ga0070693_100807308 3300005547 Unclassified 696
31 Ga0070665_101158803 3300005548 Unclassified 784
32 Ga0070704_100333482 3300005549 Unclassified 1275
33 Ga0070702_100003380 3300005615 Bacteria 7127
34 Ga0070702_100133166 3300005615 Bacteria 1573
35 Ga0068852_100120107 3300005616 Bacteria 2404
36 Ga0068859_100277073 3300005617 Bacteria 1770
37 Ga0068864_100162266 3300005618 Bacteria 2032
38 Ga0068864_101341679 3300005618 Bacteria 716
39 Ga0068861_100499965 3300005719 Bacteria 1099
40 Ga0068851_10225797 3300005834 Unclassified 1054
41 Ga0068851_10451710 3300005834 Bacteria 764
42 Ga0068858_100136788 3300005842 Bacteria 2299
43 Ga0068858_100163392 3300005842 Bacteria 2097
44 Ga0068858_101140509 3300005842 Bacteria 766
45 Ga0068860_100049347 3300005843 Bacteria 4009
46 Ga0068860_100438094 3300005843 Bacteria 1298
47 Ga0068860_102500320 3300005843 Unclassified 536
48 Ga0081455_10364413 3300005937 Unclassified 1015
49 Ga0070717_10107534 3300006028 Bacteria 2375
50 Ga0070717_10231911 3300006028 Bacteria 1625
51 Ga0070717_10659818 3300006028 Bacteria 950
52 Ga0070716_100403833 3300006173 Unclassified 983
53 Ga0070712_100206707 3300006175 Bacteria 1546
54 Ga0097621_100015218 3300006237 Bacteria 5781
55 Ga0097621_101338218 3300006237 Bacteria 677
56 Ga0068871_100157939 3300006358 Bacteria 1938
57 Ga0068871_101674803 3300006358 Bacteria 603
58 Ga0075433_10418197 3300006852 Bacteria 1182
59 Ga0075434_100867527 3300006871 Bacteria 918
60 Ga0097620_100277067 3300006931 Bacteria 1770
61 Ga0075435_100539599 3300007076 Bacteria 1010
62 Ga0075435_101295112 3300007076 Bacteria 638
63 Ga0111539_12421257 3300009094 Bacteria 609
64 Ga0105245_10423473 3300009098 Bacteria 1335
65 Ga0105245_12964594 3300009098 Bacteria 526
66 Ga0105247_10036327 3300009101 Bacteria 3003
67 Ga0105247_11404749 3300009101 Bacteria 565
68 Ga0114129_10218498 3300009147 Bacteria 2573
69 Ga0105243_10009051 3300009148 Bacteria 7606
70 Ga0105243_10202028 3300009148 Bacteria 1744
71 Ga0105243_10709549 3300009148 Bacteria 981
72 Ga0105243_11914893 3300009148 Unclassified 626
73 Ga0105241_10033002 3300009174 Bacteria 3884
74 Ga0105241_10603328 3300009174 Bacteria 992
75 Ga0105242_10008882 3300009176 Bacteria 7711
76 Ga0105242_10133231 3300009176 Bacteria 2148
77 Ga0105242_11759736 3300009176 Bacteria 657
78 Ga0105248_10071900 3300009177 Bacteria 3887
79 Ga0105248_11231783 3300009177 Bacteria 846
80 Ga0105248_11900013 3300009177 Bacteria 676
81 Ga0105238_11534031 3300009551 Bacteria 695
82 Ga0105239_10330293 3300010375 Bacteria 1720
83 Ga0105239_11017318 3300010375 Bacteria 953
84 Ga0105239_13504239 3300010375 Unclassified 510
85 Ga0157327_1034847 3300012512 Bacteria 648
86 Ga0157374_11263372 3300013296 Unclassified 760
87 Ga0157378_10003749 3300013297 Bacteria 13469
88 Ga0157378_11744734 3300013297 Bacteria 670
89 Ga0163162_12775095 3300013306 Bacteria 564
90 Ga0157372_10581813 3300013307 Bacteria 1305
91 Ga0157372_11318849 3300013307 Bacteria 833
92 Ga0157375_10850752 3300013308 Unclassified 1059
93 Ga0157380_10315592 3300014326 Unclassified 1447
94 Ga0157380_10636547 3300014326 Bacteria 1061
95 Ga0182008_10447823 3300014497 Bacteria 701
96 Ga0157377_10294402 3300014745 Bacteria 1069
97 Ga0157379_10067341 3300014968 Bacteria 3201
98 Ga0157376_10012529 3300014969 Bacteria 6296
99 Ga0157376_12695978 3300014969 Bacteria 537
100 Ga0197907_10157740 3300020069 Bacteria 782
101 Ga0206355_1475982 3300020076 Bacteria 651
102 Ga0207710_10027820 3300025900 Bacteria 2452
103 Ga0207688_10171281 3300025901 Bacteria 1291
104 Ga0207688_10174556 3300025901 Bacteria 1279
105 Ga0207654_10162107 3300025911 Unclassified 1445
106 Ga0207693_10384983 3300025915 Bacteria 1097
107 Ga0207693_10534352 3300025915 Bacteria 915
108 Ga0207663_10208021 3300025916 Bacteria 1416
109 Ga0207662_10106742 3300025918 Bacteria 1742
110 Ga0207687_10572774 3300025927 Bacteria 949
111 Ga0207700_10111491 3300025928 Bacteria 2202
112 Ga0207700_10306428 3300025928 Bacteria 1373
113 Ga0207664_10031412 3300025929 Bacteria 4063
114 Ga0207664_10064138 3300025929 Bacteria 2937
115 Ga0207664_10271301 3300025929 Bacteria 1486
116 Ga0207664_11164191 3300025929 Bacteria 688
117 Ga0207664_11718374 3300025929 Bacteria 550
118 Ga0207644_10062454 3300025931 Bacteria 2702
119 Ga0207644_10253054 3300025931 Bacteria 1406
120 Ga0207706_10314439 3300025933 Bacteria 1363
121 Ga0207706_10751093 3300025933 Bacteria 831
122 Ga0207686_10269302 3300025934 Unclassified 1252
123 Ga0207709_10029320 3300025935 Bacteria 3190
124 Ga0207709_10127712 3300025935 Bacteria 1727
125 Ga0207709_11195443 3300025935 Unclassified 626
126 Ga0207669_10033967 3300025937 Bacteria 2885
127 Ga0207704_10274321 3300025938 Bacteria 1278
128 Ga0207665_10519061 3300025939 Unclassified 922
129 Ga0207711_10161992 3300025941 Bacteria 2026
130 Ga0207711_11455595 3300025941 Bacteria 628
131 Ga0207651_10478694 3300025960 Bacteria 1073
132 Ga0207703_10116793 3300026035 Bacteria 2285
133 Ga0207639_11309528 3300026041 Bacteria 680
134 Ga0207678_10394660 3300026067 Unclassified 1197
135 Ga0207678_10708606 3300026067 Bacteria 886
136 Ga0207708_10850500 3300026075 Unclassified 788
137 Ga0207702_10709239 3300026078 Bacteria 992
138 Ga0207702_12493758 3300026078 Bacteria 504
139 Ga0207676_10310236 3300026095 Bacteria 1444
140 Ga0207675_100605511 3300026118 Bacteria 1099
141 Ga0207675_101283381 3300026118 Bacteria 753
142 Ga0207683_10000098 3300026121 Bacteria 71739
143 Ga0207683_11297090 3300026121 Bacteria 674
144 Ga0207698_10894707 3300026142 Bacteria 895
145 Ga0268266_10966579 3300028379 Unclassified 824
146 Ga0268264_10576386 3300028381 Bacteria 1106
147 Ga0268264_12124176 3300028381 Unclassified 570
148 Ga0265318_10163545 3300028577 Unclassified 816
149 Ga0307410_10420144 3300031852 Bacteria 1084
150 Ga0307410_10698760 3300031852 Bacteria 855
151 Ga0307406_10955824 3300031901 Bacteria 733
152 Ga0307407_11189015 3300031903 Bacteria 595
153 Ga0307409_102338560 3300031995 Unclassified 564
154 Ga0307409_102639392 3300031995 Unclassified 531
155 Ga0307416_101761744 3300032002 Bacteria 724
156 Ga0307415_100069853 3300032126 Bacteria 2464
157 Ga0307415_100364570 3300032126 Bacteria 1221
158 Ga0307415_100632060 3300032126 Bacteria 957
159 Ga0373939_0298638 3300035114 Bacteria 641
160 Ga0373943_0378520 3300035170 Bacteria 815
161 Ga0373955_0388798 3300035172 Bacteria 847
162 Ga0373961_0097159 3300035241 Unclassified 949
163 Ga0373933_0934874 3300035724 Bacteria 571
164 Ga0373925_0859179 3300037068 Bacteria 748
165 Ga0436364_0878578 3300037853 Unclassified 1070
166 Ga0436364_1031907 3300037853 Bacteria 102112
167 Ga0451787_635727 3300041441 Bacteria 523
168 Ga0451841_0355755 3300041498 Bacteria 666
169 Ga0451847_0009789 3300041503 Bacteria 586
170 Ga0495603_0124358 3300046455 Bacteria 1503
171 Ga0495603_0838292 3300046455 Bacteria 524
172 Ga0495629_0146487 3300046459 Bacteria 1642
173 Ga0495641_0179902 3300046461 Bacteria 947
174 Ga0495641_0269992 3300046461 Unclassified 765
175 Ga0495651_0035001 3300046462 Bacteria 3913
176 Ga0495653_0342473 3300046463 Bacteria 963
177 Ga0495580_0294443 3300046472 Bacteria 1106
178 Ga0495582_0237439 3300046473 Bacteria 1044
179 Ga0495582_0888153 3300046473 Bacteria 515
180 Ga0495639_0522619 3300046475 Unclassified 607
181 Ga0495584_0736507 3300046491 Bacteria 503
182 Ga0495594_0222708 3300046499 Bacteria 1076
183 Ga0495608_0003901 3300046511 Bacteria 10723
184 Ga0495618_0043239 3300046514 Bacteria 2842
185 Ga0495628_0077423 3300046516 Bacteria 2587
186 Ga0495628_0672606 3300046516 Bacteria 733
187 Ga0495630_0129123 3300046517 Bacteria 1919
188 Ga0495630_0461669 3300046517 Bacteria 973
189 Ga0495644_0236064 3300046523 Bacteria 709
190 Ga0495652_0027017 3300046529 Bacteria 5062
191 Ga0495640_0185922 3300046533 Bacteria 1322
192 Ga0495587_0239789 3300046536 Bacteria 1020
193 Ga0495598_0447892 3300046537 Bacteria 511
194 Ga0495645_0252440 3300046543 Bacteria 1172
195 Ga0495667_0016501 3300046559 Bacteria 4989
196 Ga0495656_0239500 3300046615 Bacteria 913
197 Ga0495634_0034182 3300046642 Bacteria 3489
198 Ga0495635_0276915 3300046663 Bacteria 1127
199 Ga0495635_0705945 3300046663 Bacteria 654
200 Ga0495657_0037905 3300046675 Bacteria 3319
201 Ga0495657_0387296 3300046675 Bacteria 824
202 Ga0495646_0038670 3300046680 Bacteria 2945
203 Ga0495658_0114816 3300046683 Bacteria 1623
204 Ga0495600_0114154 3300046809 Bacteria 1759
205 Ga0495660_0221495 3300046810 Bacteria 892
206 Ga0495581_0244672 3300047315 Bacteria 1049
207 Ga0495581_0431526 3300047315 Bacteria 768
208 Ga0495581_0810193 3300047315 Bacteria 537
209 Ga0495604_0133098 3300047317 Bacteria 1785
210 Ga0495604_0323635 3300047317 Bacteria 1030
211 Ga0495604_0913313 3300047317 Unclassified 548
212 Ga0495674_0049365 3300047319 Bacteria 3719
213 Ga0495676_0187628 3300047321 Bacteria 1444
214 Ga0495676_0480372 3300047321 Bacteria 817
215 Ga0495680_0000502 3300047322 Bacteria 44236
216 Ga0495684_0008861 3300047471 Bacteria 7774
217 Ga0495602_0437788 3300048088 Bacteria 925
218 Ga0495614_0424672 3300048089 Bacteria 627
219 Ga0496100_0012446 3300048903 Bacteria 4878
220 Ga0496100_0036667 3300048903 Bacteria 3095
221 Ga0496101_0036749 3300048904 Bacteria 3469
222 Ga0496102_0015761 3300048905 Bacteria 6586
223 Ga0496102_0100968 3300048905 Bacteria 2680
224 Ga0496103_0029004 3300048906 Bacteria 3361
225 Ga0496103_0139141 3300048906 Bacteria 1552
226 Ga0496104_0026210 3300048907 Bacteria 5379
227 Ga0496104_0393276 3300048907 Bacteria 1298
228 Ga0496104_0631180 3300048907 Bacteria 981
229 Ga0496104_1069011 3300048907 Bacteria 711
230 Ga0496105_0015778 3300048908 Bacteria 6027
231 Ga0496105_0119485 3300048908 Bacteria 2174
232 Ga0496106_0004359 3300048909 Bacteria 10512
233 Ga0496106_0038532 3300048909 Bacteria 3577
234 Ga0496106_0144413 3300048909 Bacteria 1873
235 Ga0496107_0004266 3300048910 Bacteria 9671
236 Ga0496107_0170767 3300048910 Bacteria 1613
237 Ga0496108_0464666 3300048911 Bacteria 1106
238 Ga0496108_1176996 3300048911 Bacteria 649
239 Ga0496109_0078528 3300048912 Bacteria 3040
240 Ga0496109_0261431 3300048912 Bacteria 1630
241 Ga0496109_1312104 3300048912 Unclassified 660
242 Ga0496110_0294915 3300048913 Bacteria 1477
243 Ga0496110_0378988 3300048913 Bacteria 1289
244 Ga0496111_0789066 3300048914 Bacteria 688
245 Ga0496112_1663840 3300048915 Unclassified 551
246 Ga0496114_0010039 3300048917 Bacteria 7528
247 Ga0496114_1012566 3300048917 Unclassified 714
248 Ga0496114_1556200 3300048917 Unclassified 549
249 Ga0496115_0042887 3300048918 Bacteria 3606
250 Ga0496115_0106646 3300048918 Unclassified 2300
251 Ga0496115_0127320 3300048918 Bacteria 2098
252 Ga0496115_0525048 3300048918 Bacteria 949
253 Ga0496115_0559957 3300048918 Bacteria 913
254 Ga0496126_0229784 3300048929 Bacteria 1555
255 Ga0501031_0151965 3300049568 Bacteria 1513
256 Ga0501036_0146297 3300049572 Bacteria 1993
257 Ga0501039_1230858 3300049575 Bacteria 578
258 Ga0501040_0020653 3300049576 Bacteria 4391
259 Ga0501040_0176057 3300049576 Bacteria 1515
260 Ga0501041_0293504 3300049577 Bacteria 1024
261 Ga0501041_0312410 3300049577 Bacteria 991
262 Ga0501042_0050300 3300049578 Bacteria 2973
263 Ga0501046_0123540 3300049580 Bacteria 1968
264 Ga0501068_0367837 3300049584 Bacteria 925
265 Ga0501072_0136271 3300049588 Bacteria 1957
266 Ga0501074_0017903 3300049590 Bacteria 5148
267 Ga0501076_0080266 3300049592 Bacteria 2618
268 Ga0501076_0392377 3300049592 Bacteria 1141
269 Ga0501077_0442485 3300049593 Bacteria 832
270 Ga0501079_0040248 3300049741 Bacteria 3605
271 Ga0501080_1081992 3300049742 Bacteria 693
272 Ga0501081_0210133 3300049743 Bacteria 1413
273 Ga0501045_0014049 3300049824 Bacteria 5667
274 nmdc:mga06z11_546105_c1 3300050494 Bacteria 703
275 nmdc:mga05p37_2096026_c1 3300050507 Bacteria 530
276 nmdc:mga08y16_110800_c1 3300050511 Bacteria 2858
277 nmdc:mga0n895_1010326_c1 3300050512 Bacteria 812
278 nmdc:mga0rr50_1651512_c1 3300050513 Bacteria 540
279 nmdc:mga0a205_677950_c1 3300050515 Bacteria 881
280 Ga0495601_0070338 3300053077 Bacteria 2234
281 Ga0495612_0142939 3300053078 Bacteria 1039
282 Ga0495595_0559994 3300053084 Bacteria 584
283 Ga0495619_0515842 3300053085 Bacteria 821
284 Ga0501084_0024662 3300054114 Bacteria 5019
285 Ga0501084_0043991 3300054114 Bacteria 3737
286 Ga0530510_0014564 3300061734 Bacteria 5548
287 Ga0213875_10000432
288 Ga0070683_101182312
289 Ga0070682_100016858
290 Ga0070691_10280382
291 Ga0070687_100160778
292 Ga0070671_100335934
293 Ga0070667_100262320
294 Ga0070714_100368765
295 Ga0070713_100223045
296 Ga0070713_100614015
297 Ga0070701_10809013
298 Ga0070711_100915254
299 Ga0070711_101371373
300 Ga0070705_100016895
301 Ga0070700_100754588
302 Ga0070700_100986359
303 Ga0070663_100199665
304 Ga0070663_100809992
305 Ga0070678_100002361
306 Ga0070678_100937321
307 Ga0070662_100945391
308 Ga0070662_101121154
309 Ga0070681_11786097
310 Ga0068867_101305100
311 Ga0070685_10711158
312 Ga0070684_101363433
313 Ga0068853_101926846
314 Ga0070686_100014491
315 Ga0070686_100683773
316 Ga0070693_100807308
317 Ga0070665_101158803
318 Ga0070704_100333482
319 Ga0070702_100003380
320 Ga0070702_100133166
321 Ga0068852_100120107
322 Ga0068859_100277073
323 Ga0068864_100162266
324 Ga0068864_101341679
325 Ga0068861_100499965
326 Ga0068851_10225797
327 Ga0068851_10451710
328 Ga0068858_100136788
329 Ga0068858_100163392
330 Ga0068858_101140509
331 Ga0068860_100049347
332 Ga0068860_100438094
333 Ga0068860_102500320
334 Ga0081455_10364413
335 Ga0070717_10107534
336 Ga0070717_10231911
337 Ga0070717_10659818
338 Ga0070716_100403833
339 Ga0070712_100206707
340 Ga0097621_100015218
341 Ga0097621_101338218
342 Ga0068871_100157939
343 Ga0068871_101674803
344 Ga0075433_10418197
345 Ga0075434_100867527
346 Ga0097620_100277067
347 Ga0075435_100539599
348 Ga0075435_101295112
349 Ga0111539_12421257
350 Ga0105245_10423473
351 Ga0105245_12964594
352 Ga0105247_10036327
353 Ga0105247_11404749
354 Ga0114129_10218498
355 Ga0105243_10009051
356 Ga0105243_10202028
357 Ga0105243_10709549
358 Ga0105243_11914893
359 Ga0105241_10033002
360 Ga0105241_10603328
361 Ga0105242_10008882
362 Ga0105242_10133231
363 Ga0105242_11759736
364 Ga0105248_10071900
365 Ga0105248_11231783
366 Ga0105248_11900013
367 Ga0105238_11534031
368 Ga0105239_10330293
369 Ga0105239_11017318
370 Ga0105239_13504239
371 Ga0157327_1034847
372 Ga0157374_11263372
373 Ga0157378_10003749
374 Ga0157378_11744734
375 Ga0163162_12775095
376 Ga0157372_10581813
377 Ga0157372_11318849
378 Ga0157375_10850752
379 Ga0157380_10315592
380 Ga0157380_10636547
381 Ga0182008_10447823
382 Ga0157377_10294402
383 Ga0157379_10067341
384 Ga0157376_10012529
385 Ga0157376_12695978
386 Ga0197907_10157740
387 Ga0206355_1475982
388 Ga0207710_10027820
389 Ga0207688_10171281
390 Ga0207688_10174556
391 Ga0207654_10162107
392 Ga0207693_10384983
393 Ga0207693_10534352
394 Ga0207663_10208021
395 Ga0207662_10106742
396 Ga0207687_10572774
397 Ga0207700_10111491
398 Ga0207700_10306428
399 Ga0207664_10031412
400 Ga0207664_10064138
401 Ga0207664_10271301
402 Ga0207664_11164191
403 Ga0207664_11718374
404 Ga0207644_10062454
405 Ga0207644_10253054
406 Ga0207706_10314439
407 Ga0207706_10751093
408 Ga0207686_10269302
409 Ga0207709_10029320
410 Ga0207709_10127712
411 Ga0207709_11195443
412 Ga0207669_10033967
413 Ga0207704_10274321
414 Ga0207665_10519061
415 Ga0207711_10161992
416 Ga0207711_11455595
417 Ga0207651_10478694
418 Ga0207703_10116793
419 Ga0207639_11309528
420 Ga0207678_10394660
421 Ga0207678_10708606
422 Ga0207708_10850500
423 Ga0207702_10709239
424 Ga0207702_12493758
425 Ga0207676_10310236
426 Ga0207675_100605511
427 Ga0207675_101283381
428 Ga0207683_10000098
429 Ga0207683_11297090
430 Ga0207698_10894707
431 Ga0268266_10966579
432 Ga0268264_10576386
433 Ga0268264_12124176
434 Ga0265318_10163545
435 Ga0307410_10420144
436 Ga0307410_10698760
437 Ga0307406_10955824
438 Ga0307407_11189015
439 Ga0307409_102338560
440 Ga0307409_102639392
441 Ga0307416_101761744
442 Ga0307415_100069853
443 Ga0307415_100364570
444 Ga0307415_100632060
445 Ga0373939_0298638
446 Ga0373943_0378520
447 Ga0373955_0388798
448 Ga0373961_0097159
449 Ga0373933_0934874
450 Ga0373925_0859179
451 Ga0436364_0878578
452 Ga0436364_1031907
453 Ga0451787_635727
454 Ga0451841_0355755
455 Ga0451847_0009789
456 Ga0495603_0124358
457 Ga0495603_0838292
458 Ga0495629_0146487
459 Ga0495641_0179902
460 Ga0495641_0269992
461 Ga0495651_0035001
462 Ga0495653_0342473
463 Ga0495580_0294443
464 Ga0495582_0237439
465 Ga0495582_0888153
466 Ga0495639_0522619
467 Ga0495584_0736507
468 Ga0495594_0222708
469 Ga0495608_0003901
470 Ga0495618_0043239
471 Ga0495628_0077423
472 Ga0495628_0672606
473 Ga0495630_0129123
474 Ga0495630_0461669
475 Ga0495644_0236064
476 Ga0495652_0027017
477 Ga0495640_0185922
478 Ga0495587_0239789
479 Ga0495598_0447892
480 Ga0495645_0252440
481 Ga0495667_0016501
482 Ga0495656_0239500
483 Ga0495634_0034182
484 Ga0495635_0276915
485 Ga0495635_0705945
486 Ga0495657_0037905
487 Ga0495657_0387296
488 Ga0495646_0038670
489 Ga0495658_0114816
490 Ga0495600_0114154
491 Ga0495660_0221495
492 Ga0495581_0244672
493 Ga0495581_0431526
494 Ga0495581_0810193
495 Ga0495604_0133098
496 Ga0495604_0323635
497 Ga0495604_0913313
498 Ga0495674_0049365
499 Ga0495676_0187628
500 Ga0495676_0480372
501 Ga0495680_0000502
502 Ga0495684_0008861
503 Ga0495602_0437788
504 Ga0495614_0424672
505 Ga0496100_0012446
506 Ga0496100_0036667
507 Ga0496101_0036749
508 Ga0496102_0015761
509 Ga0496102_0100968
510 Ga0496103_0029004
511 Ga0496103_0139141
512 Ga0496104_0026210
513 Ga0496104_0393276
514 Ga0496104_0631180
515 Ga0496104_1069011
516 Ga0496105_0015778
517 Ga0496105_0119485
518 Ga0496106_0004359
519 Ga0496106_0038532
520 Ga0496106_0144413
521 Ga0496107_0004266
522 Ga0496107_0170767
523 Ga0496108_0464666
524 Ga0496108_1176996
525 Ga0496109_0078528
526 Ga0496109_0261431
527 Ga0496109_1312104
528 Ga0496110_0294915
529 Ga0496110_0378988
530 Ga0496111_0789066
531 Ga0496112_1663840
532 Ga0496114_0010039
533 Ga0496114_1012566
534 Ga0496114_1556200
535 Ga0496115_0042887
536 Ga0496115_0106646
537 Ga0496115_0127320
538 Ga0496115_0525048
539 Ga0496115_0559957
540 Ga0496126_0229784
541 Ga0501031_0151965
542 Ga0501036_0146297
543 Ga0501039_1230858
544 Ga0501040_0020653
545 Ga0501040_0176057
546 Ga0501041_0293504
547 Ga0501041_0312410
548 Ga0501042_0050300
549 Ga0501046_0123540
550 Ga0501068_0367837
551 Ga0501072_0136271
552 Ga0501074_0017903
553 Ga0501076_0080266
554 Ga0501076_0392377
555 Ga0501077_0442485
556 Ga0501079_0040248
557 Ga0501080_1081992
558 Ga0501081_0210133
559 Ga0501045_0014049
560 nmdc:mga06z11_546105_c1
561 nmdc:mga05p37_2096026_c1
562 nmdc:mga08y16_110800_c1
563 nmdc:mga0n895_1010326_c1
564 nmdc:mga0rr50_1651512_c1
565 nmdc:mga0a205_677950_c1
566 Ga0495601_0070338
567 Ga0495612_0142939
568 Ga0495595_0559994
569 Ga0495619_0515842
570 Ga0501084_0024662
571 Ga0501084_0043991
572 Ga0530510_0014564

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map