F386917

General Info

Members Datasets Scaffolds Average Seq Length
285 151 570 134

Family's Representative Sequence

Representative Sequence 3300035692|Ga0373935_0088948|Ga0373935_0088948_739_1188
Length 149
Sequence MSLRAVGGALIHVHDLPAVNATLNSLATVLLVTGYVLIKRRRLTAHRNVMIAALVCSTLFLTSYLVYHAQVGSVRFPGTGLSRTIYLSILLTHTILAATVPVLAVITVWRASKKRFDRHKAIARWTLPIWLYVSVTGVVVYWMLYQMKW

Samples

Sample ID Description Type Environment
1 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
107 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
109 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
110 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
111 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
117 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
118 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
119 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
120 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
121 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
122 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
123 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
124 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
125 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
126 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
127 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
128 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
129 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
130 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
131 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
132 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
133 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
134 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
135 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
136 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
137 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
138 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
139 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
140 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
141 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
144 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
145 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
146 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
147 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
148 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
149 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.3
Metatranscriptomes 0.7
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.7
Rhizosphere 97.19
Stem 0
Stem Tuber 0
Unclassified 31.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373935_0088948 3300035692 Unclassified 2018
2 MBSR1b_contig_12127774 2162886012 Bacteria 1156
3 Ga0065715_10156346 3300005293 Bacteria 1673
4 Ga0070658_10067634 3300005327 Unclassified 2919
5 Ga0070683_100159592 3300005329 Bacteria 2139
6 Ga0070683_100565096 3300005329 Bacteria 1088
7 Ga0070670_101060579 3300005331 Bacteria 738
8 Ga0068869_100450965 3300005334 Bacteria 1066
9 Ga0068869_100599212 3300005334 Unclassified 930
10 Ga0068869_100644120 3300005334 Bacteria 899
11 Ga0068869_101155651 3300005334 Unclassified 679
12 Ga0070666_10178845 3300005335 Unclassified 1487
13 Ga0070666_10318215 3300005335 Bacteria 1110
14 Ga0070682_100260781 3300005337 Bacteria 1254
15 Ga0068868_100035026 3300005338 Bacteria 3879
16 Ga0070660_100245110 3300005339 Bacteria 1460
17 Ga0070689_100183919 3300005340 Bacteria 1699
18 Ga0070689_100468386 3300005340 Bacteria 1075
19 Ga0070689_101157083 3300005340 Bacteria 693
20 Ga0070671_100453579 3300005355 Unclassified 1100
21 Ga0070674_101635452 3300005356 Unclassified 581
22 Ga0070673_100408560 3300005364 Unclassified 1215
23 Ga0070688_100234331 3300005365 Unclassified 1300
24 Ga0070667_100148431 3300005367 Bacteria 2058
25 Ga0070667_100551522 3300005367 Unclassified 1059
26 Ga0070709_10733980 3300005434 Bacteria 771
27 Ga0070714_100210130 3300005435 Bacteria 1783
28 Ga0070713_100014830 3300005436 Bacteria 5801
29 Ga0070713_100688199 3300005436 Bacteria 976
30 Ga0070711_100086252 3300005439 Archaea 2251
31 Ga0070681_10051756 3300005458 Bacteria 4096
32 Ga0070681_10131441 3300005458 Bacteria 2435
33 Ga0070681_11083901 3300005458 Bacteria 722
34 Ga0068867_100430860 3300005459 Bacteria 1119
35 Ga0070698_100311441 3300005471 Bacteria 1505
36 Ga0070699_101546031 3300005518 Unclassified 608
37 Ga0070679_101733184 3300005530 Unclassified 573
38 Ga0070684_100133901 3300005535 Bacteria 2237
39 Ga0070697_101624253 3300005536 Bacteria 578
40 Ga0068853_100083263 3300005539 Bacteria 2803
41 Ga0068853_100544528 3300005539 Unclassified 1099
42 Ga0070665_100079707 3300005548 Bacteria 3280
43 Ga0070665_100582198 3300005548 Bacteria 1132
44 Ga0070665_101391565 3300005548 Unclassified 711
45 Ga0068855_100015800 3300005563 Bacteria 9083
46 Ga0068855_100070993 3300005563 Bacteria 4050
47 Ga0068855_100419546 3300005563 Bacteria 1464
48 Ga0068857_100019483 3300005577 Bacteria 5959
49 Ga0068857_102300494 3300005577 Bacteria 529
50 Ga0068856_100010221 3300005614 Bacteria 9125
51 Ga0068856_101193963 3300005614 Unclassified 777
52 Ga0068859_100737706 3300005617 Unclassified 1074
53 Ga0068864_100493591 3300005618 Bacteria 1177
54 Ga0068864_100687383 3300005618 Unclassified 999
55 Ga0068851_10027279 3300005834 Unclassified 2814
56 Ga0068863_100007394 3300005841 Bacteria 10749
57 Ga0068863_100015054 3300005841 Bacteria 7431
58 Ga0068863_101433364 3300005841 Unclassified 699
59 Ga0068863_101522154 3300005841 Bacteria 678
60 Ga0068858_100425106 3300005842 Bacteria 1278
61 Ga0068858_100963916 3300005842 Bacteria 835
62 Ga0068858_101629046 3300005842 Unclassified 637
63 Ga0068858_101653281 3300005842 Unclassified 632
64 Ga0068860_100536315 3300005843 Unclassified 1171
65 Ga0068860_100543300 3300005843 Unclassified 1164
66 Ga0068860_101917619 3300005843 Unclassified 614
67 Ga0070717_10023133 3300006028 Unclassified 4919
68 Ga0070717_10256262 3300006028 Bacteria 1547
69 Ga0070716_100097411 3300006173 Bacteria 1795
70 Ga0070716_100606216 3300006173 Unclassified 824
71 Ga0097621_100393884 3300006237 Unclassified 1239
72 Ga0097621_100596349 3300006237 Bacteria 1009
73 Ga0068871_100090313 3300006358 Bacteria 2551
74 Ga0068871_100231394 3300006358 Bacteria 1604
75 Ga0068871_100490629 3300006358 Bacteria 1106
76 Ga0075434_100554468 3300006871 Unclassified 1169
77 Ga0075434_100634013 3300006871 Unclassified 1087
78 Ga0097620_100737653 3300006931 Unclassified 1074
79 Ga0075435_100892719 3300007076 Unclassified 775
80 Ga0075435_101158874 3300007076 Bacteria 676
81 Ga0105240_10003595 3300009093 Bacteria 24023
82 Ga0105240_10085957 3300009093 Bacteria 3853
83 Ga0105240_10231159 3300009093 Bacteria 2149
84 Ga0105240_10383520 3300009093 Bacteria 1587
85 Ga0111539_10387680 3300009094 Bacteria 1627
86 Ga0105245_10003943 3300009098 Bacteria 13202
87 Ga0105245_11478881 3300009098 Bacteria 730
88 Ga0105247_10131885 3300009101 Unclassified 1629
89 Ga0105247_10364455 3300009101 Bacteria 1020
90 Ga0105243_10142350 3300009148 Bacteria 2047
91 Ga0105241_10009804 3300009174 Bacteria 7039
92 Ga0105241_10013212 3300009174 Bacteria 6052
93 Ga0105241_10056509 3300009174 Bacteria 3009
94 Ga0105241_10283754 3300009174 Bacteria 1415
95 Ga0105241_10667352 3300009174 Bacteria 946
96 Ga0105242_10069500 3300009176 Bacteria 2917
97 Ga0105242_10090723 3300009176 Bacteria 2571
98 Ga0105242_10520276 3300009176 Bacteria 1135
99 Ga0105242_11435480 3300009176 Unclassified 719
100 Ga0105248_10556024 3300009177 Bacteria 1295
101 Ga0105248_10698903 3300009177 Bacteria 1144
102 Ga0105248_10733473 3300009177 Unclassified 1115
103 Ga0105248_11164675 3300009177 Unclassified 871
104 Ga0105248_11220301 3300009177 Bacteria 850
105 Ga0105248_11410810 3300009177 Unclassified 788
106 Ga0105248_12714870 3300009177 Unclassified 565
107 Ga0105237_10011202 3300009545 Bacteria 9504
108 Ga0105237_10097746 3300009545 Bacteria 2927
109 Ga0105237_10280798 3300009545 Unclassified 1668
110 Ga0105237_11432258 3300009545 Unclassified 697
111 Ga0105238_10042569 3300009551 Bacteria 4598
112 Ga0105238_10069527 3300009551 Bacteria 3521
113 Ga0105238_10273057 3300009551 Bacteria 1671
114 Ga0105238_11356795 3300009551 Unclassified 738
115 Ga0105238_11572817 3300009551 Bacteria 687
116 Ga0105249_10372132 3300009553 Bacteria 1453
117 Ga0105239_10007685 3300010375 Bacteria 12348
118 Ga0105239_10031306 3300010375 Bacteria 5851
119 Ga0105239_10229744 3300010375 Bacteria 2081
120 Ga0105239_10290376 3300010375 Bacteria 1841
121 Ga0105239_11342750 3300010375 Bacteria 825
122 Ga0105246_10101513 3300011119 Unclassified 2096
123 Ga0105246_11248710 3300011119 Bacteria 686
124 Ga0157370_10033474 3300013104 Bacteria 5011
125 Ga0157370_10705403 3300013104 Bacteria 921
126 Ga0157369_10062466 3300013105 Bacteria 4014
127 Ga0157374_10182082 3300013296 Unclassified 2053
128 Ga0157374_10892481 3300013296 Unclassified 906
129 Ga0157374_11608508 3300013296 Bacteria 674
130 Ga0157378_10012206 3300013297 Bacteria 7524
131 Ga0157378_10999790 3300013297 Unclassified 871
132 Ga0157378_12573733 3300013297 Unclassified 561
133 Ga0163162_10032399 3300013306 Bacteria 5191
134 Ga0163162_10137551 3300013306 Unclassified 2554
135 Ga0157372_10215533 3300013307 Bacteria 2225
136 Ga0157372_10565171 3300013307 Bacteria 1326
137 Ga0157375_10244691 3300013308 Unclassified 1953
138 Ga0157375_12447112 3300013308 Bacteria 623
139 Ga0163163_10024150 3300014325 Bacteria 5784
140 Ga0163163_10185432 3300014325 Bacteria 2128
141 Ga0163163_10310430 3300014325 Unclassified 1630
142 Ga0163163_12928963 3300014325 Unclassified 533
143 Ga0157376_10015977 3300014969 Bacteria 5687
144 Ga0157376_10371291 3300014969 Bacteria 1375
145 Ga0157376_10554186 3300014969 Bacteria 1138
146 Ga0157376_10593708 3300014969 Unclassified 1101
147 Ga0157376_10800041 3300014969 Bacteria 955
148 Ga0157376_12612157 3300014969 Bacteria 545
149 Ga0207680_10197415 3300025903 Unclassified 1369
150 Ga0207699_10298410 3300025906 Unclassified 1124
151 Ga0207699_10534180 3300025906 Bacteria 849
152 Ga0207705_10101993 3300025909 Unclassified 2112
153 Ga0207654_10163441 3300025911 Bacteria 1440
154 Ga0207695_10086235 3300025913 Bacteria 3167
155 Ga0207695_10120311 3300025913 Bacteria 2595
156 Ga0207695_10120630 3300025913 Bacteria 2591
157 Ga0207671_10355308 3300025914 Bacteria 1162
158 Ga0207663_10144200 3300025916 Archaea 1663
159 Ga0207649_10638349 3300025920 Bacteria 822
160 Ga0207652_10211650 3300025921 Unclassified 1745
161 Ga0207694_10233901 3300025924 Bacteria 1501
162 Ga0207694_11058248 3300025924 Bacteria 687
163 Ga0207687_10723812 3300025927 Bacteria 846
164 Ga0207700_10031166 3300025928 Bacteria 3785
165 Ga0207700_10619535 3300025928 Bacteria 964
166 Ga0207664_10088286 3300025929 Bacteria 2537
167 Ga0207664_10243221 3300025929 Bacteria 1568
168 Ga0207644_10447176 3300025931 Unclassified 1061
169 Ga0207686_10071254 3300025934 Bacteria 2236
170 Ga0207670_10267781 3300025936 Bacteria 1327
171 Ga0207665_10349456 3300025939 Bacteria 1116
172 Ga0207691_10412629 3300025940 Bacteria 1151
173 Ga0207691_10873146 3300025940 Bacteria 754
174 Ga0207711_10817082 3300025941 Bacteria 868
175 Ga0207711_10949225 3300025941 Bacteria 799
176 Ga0207689_10013917 3300025942 Bacteria 6853
177 Ga0207689_10171530 3300025942 Bacteria 1788
178 Ga0207689_10200893 3300025942 Bacteria 1645
179 Ga0207689_10587080 3300025942 Bacteria 937
180 Ga0207689_10978631 3300025942 Unclassified 714
181 Ga0207661_10400021 3300025944 Bacteria 1245
182 Ga0207679_10618285 3300025945 Bacteria 978
183 Ga0207667_10058529 3300025949 Bacteria 4041
184 Ga0207667_10384422 3300025949 Bacteria 1430
185 Ga0207667_10430000 3300025949 Bacteria 1343
186 Ga0207651_10314248 3300025960 Bacteria 1308
187 Ga0207651_10735760 3300025960 Unclassified 871
188 Ga0207712_10316203 3300025961 Bacteria 1286
189 Ga0207658_10140024 3300025986 Bacteria 1956
190 Ga0207658_10668974 3300025986 Bacteria 937
191 Ga0207658_11338455 3300025986 Unclassified 655
192 Ga0207703_10032017 3300026035 Bacteria 4160
193 Ga0207703_10414254 3300026035 Bacteria 1252
194 Ga0207702_12272801 3300026078 Unclassified 530
195 Ga0207641_10004694 3300026088 Bacteria 11776
196 Ga0207641_10142876 3300026088 Unclassified 2162
197 Ga0207641_11229562 3300026088 Bacteria 749
198 Ga0207641_11961696 3300026088 Bacteria 587
199 Ga0207648_10307780 3300026089 Bacteria 1422
200 Ga0207648_10769932 3300026089 Bacteria 895
201 Ga0207676_10118646 3300026095 Bacteria 2227
202 Ga0207676_10622526 3300026095 Bacteria 1039
203 Ga0207676_10767015 3300026095 Bacteria 939
204 Ga0207676_10991986 3300026095 Unclassified 827
205 Ga0207674_10006347 3300026116 Bacteria 13918
206 Ga0207674_10904192 3300026116 Bacteria 851
207 Ga0207675_100360668 3300026118 Bacteria 1426
208 Ga0207698_10884243 3300026142 Bacteria 900
209 Ga0268266_10153904 3300028379 Bacteria 2075
210 Ga0268266_10830785 3300028379 Unclassified 893
211 Ga0268264_10028760 3300028381 Bacteria 4549
212 Ga0307416_100829342 3300032002 Bacteria 1022
213 Ga0373951_0221041 3300035091 Unclassified 559
214 Ga0373923_0429488 3300035111 Bacteria 639
215 Ga0373953_0282969 3300035117 Unclassified 723
216 Ga0373943_0750064 3300035170 Bacteria 580
217 Ga0373935_0370491 3300035692 Unclassified 1024
218 Ga0373927_0107087 3300035695 Unclassified 1821
219 Ga0373927_0526018 3300035695 Unclassified 782
220 Ga0373933_0628670 3300035724 Bacteria 705
221 Ga0373937_0094333 3300036401 Bacteria 2775
222 Ga0373925_0139161 3300037068 Unclassified 1899
223 Ga0436364_0273271 3300037853 Unclassified 1082
224 Ga0436364_1024136 3300037853 Bacteria 10258
225 Ga0436364_1105963 3300037853 Bacteria 8548
226 Ga0436364_1367765 3300037853 Unclassified 575
227 Ga0436365_0889388 3300039437 Unclassified 769
228 Ga0436365_0987810 3300039437 Bacteria 761
229 Ga0453683_0033626 3300044673 Unclassified 3234
230 Ga0466959_0296957 3300045049 Unclassified 1107
231 Ga0451576_0285417 3300045051 Bacteria 1726
232 Ga0495603_0267650 3300046455 Bacteria 983
233 Ga0495651_0060468 3300046462 Bacteria 2901
234 Ga0495580_0003695 3300046472 Bacteria 12974
235 Ga0495580_0017763 3300046472 Bacteria 5308
236 Ga0495580_0102822 3300046472 Bacteria 1986
237 Ga0495580_0307670 3300046472 Unclassified 1078
238 Ga0495580_0321463 3300046472 Bacteria 1052
239 Ga0495580_0333493 3300046472 Unclassified 1030
240 Ga0495580_0791875 3300046472 Unclassified 615
241 Ga0495582_0634855 3300046473 Unclassified 618
242 Ga0495664_0192744 3300046477 Bacteria 1235
243 Ga0495594_0104582 3300046499 Bacteria 1594
244 Ga0495594_0248253 3300046499 Unclassified 1014
245 Ga0495628_0275754 3300046516 Unclassified 1250
246 Ga0495652_0470016 3300046529 Unclassified 877
247 Ga0495665_0037554 3300046531 Bacteria 2585
248 Ga0495665_0262002 3300046531 Unclassified 889
249 Ga0495665_0331418 3300046531 Unclassified 776
250 Ga0495640_0286662 3300046533 Unclassified 1025
251 Ga0495640_0789356 3300046533 Unclassified 566
252 Ga0495587_0036726 3300046536 Bacteria 2946
253 Ga0495645_0336365 3300046543 Bacteria 976
254 Ga0495667_0026359 3300046559 Bacteria 3917
255 Ga0495667_0101086 3300046559 Bacteria 1866
256 Ga0495635_0550992 3300046663 Unclassified 756
257 Ga0495623_0098756 3300046679 Bacteria 1781
258 Ga0495623_0279221 3300046679 Bacteria 930
259 Ga0495613_0105992 3300046689 Bacteria 2028
260 Ga0495604_0419433 3300047317 Unclassified 879
261 Ga0495604_0688277 3300047317 Bacteria 650
262 Ga0495674_0005655 3300047319 Bacteria 11974
263 Ga0495674_0306642 3300047319 Bacteria 1296
264 Ga0495674_0370946 3300047319 Bacteria 1159
265 Ga0495674_0802065 3300047319 Bacteria 732
266 Ga0495676_0548995 3300047321 Bacteria 755
267 Ga0495680_0177704 3300047322 Bacteria 1538
268 Ga0495675_0114339 3300047444 Unclassified 1683
269 Ga0495675_0117801 3300047444 Bacteria 1655
270 Ga0495675_0247853 3300047444 Bacteria 1071
271 Ga0495684_0000817 3300047471 Bacteria 25175
272 Ga0495684_0092693 3300047471 Bacteria 2288
273 Ga0495602_0288624 3300048088 Bacteria 1205
274 Ga0495602_0324357 3300048088 Bacteria 1119
275 Ga0496112_0195075 3300048915 Bacteria 1986
276 Ga0496115_0422941 3300048918 Bacteria 1079
277 nmdc:mga05p37_1063093_c1 3300050507 Bacteria 852
278 nmdc:mga0n895_514263_c1 3300050512 Unclassified 1205
279 nmdc:mga0n895_768341_c1 3300050512 Unclassified 956
280 nmdc:mga0rr50_813587_c1 3300050513 Bacteria 797
281 Ga0495601_0720015 3300053077 Bacteria 636
282 Ga0495619_0562212 3300053085 Unclassified 782
283 Ga0587073_0017371 3300059492 Bacteria 1328
284 Ga0587083_0021700 3300059505 Unclassified 1196
285 Ga0530510_0080031 3300061734 Bacteria 2377
286 Ga0373935_0088948
287 MBSR1b_contig_12127774
288 Ga0065715_10156346
289 Ga0070658_10067634
290 Ga0070683_100159592
291 Ga0070683_100565096
292 Ga0070670_101060579
293 Ga0068869_100450965
294 Ga0068869_100599212
295 Ga0068869_100644120
296 Ga0068869_101155651
297 Ga0070666_10178845
298 Ga0070666_10318215
299 Ga0070682_100260781
300 Ga0068868_100035026
301 Ga0070660_100245110
302 Ga0070689_100183919
303 Ga0070689_100468386
304 Ga0070689_101157083
305 Ga0070671_100453579
306 Ga0070674_101635452
307 Ga0070673_100408560
308 Ga0070688_100234331
309 Ga0070667_100148431
310 Ga0070667_100551522
311 Ga0070709_10733980
312 Ga0070714_100210130
313 Ga0070713_100014830
314 Ga0070713_100688199
315 Ga0070711_100086252
316 Ga0070681_10051756
317 Ga0070681_10131441
318 Ga0070681_11083901
319 Ga0068867_100430860
320 Ga0070698_100311441
321 Ga0070699_101546031
322 Ga0070679_101733184
323 Ga0070684_100133901
324 Ga0070697_101624253
325 Ga0068853_100083263
326 Ga0068853_100544528
327 Ga0070665_100079707
328 Ga0070665_100582198
329 Ga0070665_101391565
330 Ga0068855_100015800
331 Ga0068855_100070993
332 Ga0068855_100419546
333 Ga0068857_100019483
334 Ga0068857_102300494
335 Ga0068856_100010221
336 Ga0068856_101193963
337 Ga0068859_100737706
338 Ga0068864_100493591
339 Ga0068864_100687383
340 Ga0068851_10027279
341 Ga0068863_100007394
342 Ga0068863_100015054
343 Ga0068863_101433364
344 Ga0068863_101522154
345 Ga0068858_100425106
346 Ga0068858_100963916
347 Ga0068858_101629046
348 Ga0068858_101653281
349 Ga0068860_100536315
350 Ga0068860_100543300
351 Ga0068860_101917619
352 Ga0070717_10023133
353 Ga0070717_10256262
354 Ga0070716_100097411
355 Ga0070716_100606216
356 Ga0097621_100393884
357 Ga0097621_100596349
358 Ga0068871_100090313
359 Ga0068871_100231394
360 Ga0068871_100490629
361 Ga0075434_100554468
362 Ga0075434_100634013
363 Ga0097620_100737653
364 Ga0075435_100892719
365 Ga0075435_101158874
366 Ga0105240_10003595
367 Ga0105240_10085957
368 Ga0105240_10231159
369 Ga0105240_10383520
370 Ga0111539_10387680
371 Ga0105245_10003943
372 Ga0105245_11478881
373 Ga0105247_10131885
374 Ga0105247_10364455
375 Ga0105243_10142350
376 Ga0105241_10009804
377 Ga0105241_10013212
378 Ga0105241_10056509
379 Ga0105241_10283754
380 Ga0105241_10667352
381 Ga0105242_10069500
382 Ga0105242_10090723
383 Ga0105242_10520276
384 Ga0105242_11435480
385 Ga0105248_10556024
386 Ga0105248_10698903
387 Ga0105248_10733473
388 Ga0105248_11164675
389 Ga0105248_11220301
390 Ga0105248_11410810
391 Ga0105248_12714870
392 Ga0105237_10011202
393 Ga0105237_10097746
394 Ga0105237_10280798
395 Ga0105237_11432258
396 Ga0105238_10042569
397 Ga0105238_10069527
398 Ga0105238_10273057
399 Ga0105238_11356795
400 Ga0105238_11572817
401 Ga0105249_10372132
402 Ga0105239_10007685
403 Ga0105239_10031306
404 Ga0105239_10229744
405 Ga0105239_10290376
406 Ga0105239_11342750
407 Ga0105246_10101513
408 Ga0105246_11248710
409 Ga0157370_10033474
410 Ga0157370_10705403
411 Ga0157369_10062466
412 Ga0157374_10182082
413 Ga0157374_10892481
414 Ga0157374_11608508
415 Ga0157378_10012206
416 Ga0157378_10999790
417 Ga0157378_12573733
418 Ga0163162_10032399
419 Ga0163162_10137551
420 Ga0157372_10215533
421 Ga0157372_10565171
422 Ga0157375_10244691
423 Ga0157375_12447112
424 Ga0163163_10024150
425 Ga0163163_10185432
426 Ga0163163_10310430
427 Ga0163163_12928963
428 Ga0157376_10015977
429 Ga0157376_10371291
430 Ga0157376_10554186
431 Ga0157376_10593708
432 Ga0157376_10800041
433 Ga0157376_12612157
434 Ga0207680_10197415
435 Ga0207699_10298410
436 Ga0207699_10534180
437 Ga0207705_10101993
438 Ga0207654_10163441
439 Ga0207695_10086235
440 Ga0207695_10120311
441 Ga0207695_10120630
442 Ga0207671_10355308
443 Ga0207663_10144200
444 Ga0207649_10638349
445 Ga0207652_10211650
446 Ga0207694_10233901
447 Ga0207694_11058248
448 Ga0207687_10723812
449 Ga0207700_10031166
450 Ga0207700_10619535
451 Ga0207664_10088286
452 Ga0207664_10243221
453 Ga0207644_10447176
454 Ga0207686_10071254
455 Ga0207670_10267781
456 Ga0207665_10349456
457 Ga0207691_10412629
458 Ga0207691_10873146
459 Ga0207711_10817082
460 Ga0207711_10949225
461 Ga0207689_10013917
462 Ga0207689_10171530
463 Ga0207689_10200893
464 Ga0207689_10587080
465 Ga0207689_10978631
466 Ga0207661_10400021
467 Ga0207679_10618285
468 Ga0207667_10058529
469 Ga0207667_10384422
470 Ga0207667_10430000
471 Ga0207651_10314248
472 Ga0207651_10735760
473 Ga0207712_10316203
474 Ga0207658_10140024
475 Ga0207658_10668974
476 Ga0207658_11338455
477 Ga0207703_10032017
478 Ga0207703_10414254
479 Ga0207702_12272801
480 Ga0207641_10004694
481 Ga0207641_10142876
482 Ga0207641_11229562
483 Ga0207641_11961696
484 Ga0207648_10307780
485 Ga0207648_10769932
486 Ga0207676_10118646
487 Ga0207676_10622526
488 Ga0207676_10767015
489 Ga0207676_10991986
490 Ga0207674_10006347
491 Ga0207674_10904192
492 Ga0207675_100360668
493 Ga0207698_10884243
494 Ga0268266_10153904
495 Ga0268266_10830785
496 Ga0268264_10028760
497 Ga0307416_100829342
498 Ga0373951_0221041
499 Ga0373923_0429488
500 Ga0373953_0282969
501 Ga0373943_0750064
502 Ga0373935_0370491
503 Ga0373927_0107087
504 Ga0373927_0526018
505 Ga0373933_0628670
506 Ga0373937_0094333
507 Ga0373925_0139161
508 Ga0436364_0273271
509 Ga0436364_1024136
510 Ga0436364_1105963
511 Ga0436364_1367765
512 Ga0436365_0889388
513 Ga0436365_0987810
514 Ga0453683_0033626
515 Ga0466959_0296957
516 Ga0451576_0285417
517 Ga0495603_0267650
518 Ga0495651_0060468
519 Ga0495580_0003695
520 Ga0495580_0017763
521 Ga0495580_0102822
522 Ga0495580_0307670
523 Ga0495580_0321463
524 Ga0495580_0333493
525 Ga0495580_0791875
526 Ga0495582_0634855
527 Ga0495664_0192744
528 Ga0495594_0104582
529 Ga0495594_0248253
530 Ga0495628_0275754
531 Ga0495652_0470016
532 Ga0495665_0037554
533 Ga0495665_0262002
534 Ga0495665_0331418
535 Ga0495640_0286662
536 Ga0495640_0789356
537 Ga0495587_0036726
538 Ga0495645_0336365
539 Ga0495667_0026359
540 Ga0495667_0101086
541 Ga0495635_0550992
542 Ga0495623_0098756
543 Ga0495623_0279221
544 Ga0495613_0105992
545 Ga0495604_0419433
546 Ga0495604_0688277
547 Ga0495674_0005655
548 Ga0495674_0306642
549 Ga0495674_0370946
550 Ga0495674_0802065
551 Ga0495676_0548995
552 Ga0495680_0177704
553 Ga0495675_0114339
554 Ga0495675_0117801
555 Ga0495675_0247853
556 Ga0495684_0000817
557 Ga0495684_0092693
558 Ga0495602_0288624
559 Ga0495602_0324357
560 Ga0496112_0195075
561 Ga0496115_0422941
562 nmdc:mga05p37_1063093_c1
563 nmdc:mga0n895_514263_c1
564 nmdc:mga0n895_768341_c1
565 nmdc:mga0rr50_813587_c1
566 Ga0495601_0720015
567 Ga0495619_0562212
568 Ga0587073_0017371
569 Ga0587083_0021700
570 Ga0530510_0080031

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04238

DUF420

Protein of unknown function (DUF420)

16

144

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7o3e-assembly1.cif.gz_c murine supercomplex ciii2civ in the intermediate locked conformation 0.7761 7 135
6x8n-assembly2.cif.gz_B crystal structure of h49a able mutant 0.7648 2 134
6x8n-assembly2.cif.gz_B crystal structure of h49a able mutant 0.7594 2 134
5gpn-assembly1.cif.gz_0 architecture of mammalian respirasome 0.731 1 135
5luf-assembly1.cif.gz_z cryo-em of bovine respirasome 0.731 1 135
ID Description Score Start End Superfamily
af_Q55C03_152_358_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7378 3 131 1.20.120.1770
4yjwA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Uncharacterised protein PF12889, N-terminal DUF3829 0.733 66 137 1.20.120.930
af_Q6UXN7_57_150_1.20.960.10 Mainly Alpha;Up-down Bundle;Mitochondrial Import Receptor Subunit Tom20; Chain A;Mitochondrial outer membrane translocase complex, subunit Tom20 domain 0.7317 7 63 1.20.960.10
af_Q67ZF6_11_222_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7294 32 138 1.20.120.1770
af_P14575_77_269_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.7174 1 136 1.20.120.80
ID Description Score Start End GO Terms
AF-A0A1Q7S487-F1-model_v4 DUF420 domain-containing protein 0.9568 1 103 GO:0004129
GO:0016020
GO:0022904
AF-A0A430SFZ7-F1-model_v4 DUF420 domain-containing protein 0.9391 2 111 GO:0004129
GO:0016020
GO:0022904
AF-A0A0C2TBR4-F1-model_v4 deleted 0.9336 22 136
AF-A0A7W1XB66-F1-model_v4 DUF420 domain-containing protein 0.9283 22 137 GO:0016020
AF-A0A2D6MXX6-F1-model_v4 DUF420 domain-containing protein 0.9276 41 137 GO:0016020

Map