F385151

General Info

Members Datasets Scaffolds Average Seq Length
282 170 564 320

Family's Representative Sequence

Representative Sequence 3300046524|Ga0495648_0015665|Ga0495648_0015665_2606_3685
Length 359
Sequence VFSGAFEVVGSLDLEPELESLMNHLLWLALVVAALAFLLTLFLRRYALSRSLIDIPNARSSHLVPTPRGGGVAIVLSFLVALPILLMSGATSQSVTWALMVGGAAVAVLGFLDDHGHIAARWRLLGHFSAAIWALVCIGGLPPISLPGGTVDLGWLGHILAVFYLVWVLNLYNFMDGIDGLASVEAICVCLGACLVYGLGGYPMLIWAPLLLSMAVLGFLYWNVPAARIFMGDAGSGFLGFVLGGLSLAAAWQNANLLWVWLILLGVFITDATFTLIRRLMRGDKVYEAHRSHAYQFAARKVGRHLPVTLSVLSINLLWLTPIAIGVGVLGLNGLFGLVVAYVPLVVLAVKFKAGAIET

Samples

Sample ID Description Type Environment
1 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
11 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
12 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
13 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
14 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
15 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
16 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
17 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
18 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
19 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
20 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
21 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
22 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
23 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
24 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
25 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
26 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
27 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
28 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
29 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
30 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
31 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
32 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
33 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
42 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
43 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
44 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
45 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
46 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
47 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
48 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
49 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
50 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
51 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
52 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
53 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
54 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
55 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
56 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
57 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
58 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
59 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
60 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
61 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
62 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
63 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
64 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
65 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
66 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
67 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
68 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
69 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
70 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
71 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
72 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
73 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
74 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
75 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
76 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
77 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
78 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
79 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
80 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
81 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
82 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
83 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
84 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
85 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
86 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
87 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
88 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
89 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
90 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
91 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
92 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
93 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
94 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
95 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
96 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
97 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
98 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
99 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
100 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
101 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
102 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
103 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
104 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
105 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
106 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
107 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
108 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
109 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
110 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
111 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
112 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
113 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
114 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
115 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
116 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
117 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
118 2511231007 Pseudomonas sp. GM18 Isolate Nodule
119 2511231019 Pseudomonas sp. GM67 Isolate Nodule
120 2511231021 Pseudomonas sp. GM78 Isolate Nodule
121 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
122 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
123 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
124 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
125 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
126 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
127 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
128 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
129 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
130 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
131 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
132 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
133 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
134 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
135 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
136 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
137 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
138 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
139 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
140 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
141 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
142 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
143 2765235841 Pseudomonas putida AA7 Isolate Unclassified
144 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
145 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
146 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
147 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
148 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
149 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
150 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
151 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
152 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
153 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
154 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
155 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
156 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
157 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
158 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
159 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
160 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
161 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
162 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
163 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
164 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
165 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
166 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
167 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
168 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
169 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
170 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.21
Metatranscriptomes 0
Isolates 18.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.9
Nodule 2.48
Rhizoplane 7.45
Rhizosphere 70.57
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495648_0015665 3300046524 Bacteria 5492
2 MRS2a_Contig_949 2124908027 Bacteria 2192
3 JGI25162J39368_1000330 3300002737 Bacteria 41675
4 JGI25163J39215_1000287 3300002771 Bacteria 17355
5 JGI25164J39214_1000251 3300002772 Bacteria 40327
6 JGI25165J46597_1000362 3300003214 Bacteria 50814
7 Ga0065714_10002270 3300005288 Bacteria 29515
8 Ga0065714_10065403 3300005288 Bacteria 10293
9 Ga0070670_100001543 3300005331 Bacteria 18565
10 Ga0070661_100000132 3300005344 Bacteria 62286
11 Ga0070664_100000361 3300005564 Bacteria 33502
12 Ga0075432_10010488 3300006058 Bacteria 3145
13 Ga0075432_10035150 3300006058 Bacteria 1741
14 Ga0075432_10048108 3300006058 Bacteria 1500
15 Ga0075362_10078966 3300006177 Bacteria 1514
16 Ga0075369_10087488 3300006186 Bacteria 1388
17 Ga0075431_100001319 3300006847 Bacteria 22677
18 Ga0099823_1046345 3300006944 Bacteria 2859
19 Ga0079104_1000115 3300006946 Bacteria 115517
20 Ga0105251_10001056 3300009011 Bacteria 24130
21 Ga0105251_10003620 3300009011 Bacteria 11111
22 Ga0105251_10007086 3300009011 Bacteria 6987
23 Ga0105244_10000300 3300009036 Bacteria 48059
24 Ga0105244_10000547 3300009036 Bacteria 33532
25 Ga0105244_10001592 3300009036 Bacteria 18035
26 Ga0105244_10001595 3300009036 Bacteria 18015
27 Ga0105244_10002020 3300009036 Bacteria 15645
28 Ga0105250_10000415 3300009092 Bacteria 31253
29 Ga0105250_10006640 3300009092 Bacteria 5036
30 Ga0105250_10011930 3300009092 Bacteria 3599
31 Ga0105243_10004552 3300009148 Bacteria 10950
32 Ga0105249_10023937 3300009553 Bacteria 5485
33 Ga0157373_10000684 3300013100 Bacteria 26574
34 Ga0157371_10033740 3300013102 Bacteria 3675
35 Ga0157370_10030847 3300013104 Bacteria 5251
36 Ga0157369_10003354 3300013105 Bacteria 19017
37 Ga0157369_10003414 3300013105 Bacteria 18837
38 Ga0182008_10000912 3300014497 Bacteria 20556
39 Ga0182008_10001622 3300014497 Bacteria 14896
40 Ga0182008_10022174 3300014497 Bacteria 3253
41 Ga0182007_10000772 3300015262 Bacteria 17934
42 Ga0182007_10041369 3300015262 Bacteria 1536
43 Ga0163161_10000482 3300017792 Bacteria 32775
44 Ga0163161_10004889 3300017792 Bacteria 9336
45 Ga0209760_100043 3300025207 Bacteria 113964
46 Ga0207427_100082 3300025231 Bacteria 142809
47 Ga0209437_100006 3300025233 Bacteria 1042724
48 Ga0209233_1000105 3300025261 Bacteria 272035
49 Ga0209676_1000309 3300025292 Bacteria 95678
50 Ga0207696_1000097 3300025711 Bacteria 175696
51 Ga0207696_1000373 3300025711 Bacteria 44298
52 Ga0207655_1000421 3300025728 Bacteria 57722
53 Ga0207655_1000485 3300025728 Bacteria 51276
54 Ga0207655_1000706 3300025728 Bacteria 38597
55 Ga0207655_1000744 3300025728 Bacteria 36545
56 Ga0207655_1001457 3300025728 Bacteria 21890
57 Ga0207655_1044128 3300025728 Bacteria 1876
58 Ga0207713_1001078 3300025735 Bacteria 23498
59 Ga0207713_1006661 3300025735 Bacteria 6991
60 Ga0207713_1023253 3300025735 Bacteria 2921
61 Ga0207649_10000002 3300025920 Bacteria 498633
62 Ga0207650_10001130 3300025925 Bacteria 19629
63 Ga0207709_10001759 3300025935 Bacteria 14567
64 Ga0207679_10000006 3300025945 Bacteria 498868
65 Ga0209281_1000077 3300027111 Bacteria 262887
66 Ga0209389_1055960 3300027296 Bacteria 2578
67 Ga0209371_1000338 3300027312 Bacteria 51239
68 Ga0207428_10022515 3300027907 Bacteria 5316
69 Ga0207428_10056856 3300027907 Bacteria 3108
70 Ga0207428_10064658 3300027907 Bacteria 2887
71 Ga0268256_1000289 3300030500 Bacteria 51239
72 Ga0307412_10000311 3300031911 Bacteria 30815
73 Ga0439438_000275 3300041405 Bacteria 23167
74 Ga0439438_000402 3300041405 Bacteria 19401
75 Ga0439438_003901 3300041405 Bacteria 5870
76 Ga0439438_015032 3300041405 Bacteria 2288
77 Ga0439447_000209 3300041407 Bacteria 20602
78 Ga0439466_0000423 3300041411 Bacteria 16048
79 Ga0439466_0001149 3300041411 Bacteria 10290
80 Ga0439466_0004559 3300041411 Bacteria 5323
81 Ga0439432_000134 3300042006 Bacteria 24792
82 Ga0439432_000178 3300042006 Bacteria 22518
83 Ga0439432_008477 3300042006 Bacteria 3608
84 Ga0439432_013123 3300042006 Bacteria 2820
85 Ga0439451_000248 3300042009 Bacteria 10384
86 Ga0439451_002364 3300042009 Bacteria 3819
87 Ga0439452_000602 3300042010 Bacteria 18503
88 Ga0439452_001021 3300042010 Bacteria 12401
89 Ga0439456_000929 3300042013 Bacteria 5853
90 Ga0439456_019912 3300042013 Bacteria 1413
91 Ga0439463_000392 3300042016 Bacteria 12086
92 Ga0439463_001553 3300042016 Bacteria 6057
93 Ga0439463_002335 3300042016 Bacteria 4840
94 Ga0450920_000041 3300042122 Bacteria 15759
95 Ga0450922_000005 3300042124 Bacteria 19334
96 Ga0450923_000599 3300042125 Bacteria 4131
97 Ga0450903_000564 3300042138 Bacteria 7625
98 Ga0450906_000092 3300042145 Bacteria 14957
99 Ga0450906_017466 3300042145 Bacteria 1294
100 Ga0450907_000218 3300042146 Bacteria 20314
101 Ga0450910_000026 3300042147 Bacteria 19055
102 Ga0450908_001662 3300042184 Bacteria 4324
103 Ga0439464_0032573 3300042439 Bacteria 1465
104 Ga0439460_0000024 3300042461 Bacteria 21720
105 Ga0439460_0000071 3300042461 Bacteria 15336
106 Ga0495617_000200 3300046452 Bacteria 37820
107 Ga0495627_022770 3300046453 Bacteria 2058
108 Ga0495627_052506 3300046453 Bacteria 1222
109 Ga0495590_0026303 3300046457 Bacteria 2043
110 Ga0495591_000128 3300046458 Bacteria 82830
111 Ga0495591_000210 3300046458 Bacteria 59177
112 Ga0495591_006769 3300046458 Bacteria 4991
113 Ga0495638_0000602 3300046460 Bacteria 40434
114 Ga0495638_0000726 3300046460 Bacteria 35496
115 Ga0495638_0006834 3300046460 Bacteria 8237
116 Ga0495638_0012983 3300046460 Bacteria 5688
117 Ga0495638_0017778 3300046460 Bacteria 4734
118 Ga0495638_0033515 3300046460 Bacteria 3285
119 Ga0495650_0001217 3300046471 Bacteria 26985
120 Ga0495605_0000593 3300046474 Bacteria 28835
121 Ga0495605_0000672 3300046474 Bacteria 25764
122 Ga0495605_0012903 3300046474 Bacteria 4624
123 Ga0495584_0000373 3300046491 Bacteria 30942
124 Ga0495596_0001869 3300046500 Bacteria 11678
125 Ga0495607_0000513 3300046501 Bacteria 38283
126 Ga0495607_0000639 3300046501 Bacteria 34018
127 Ga0495607_0003343 3300046501 Bacteria 12302
128 Ga0495583_0000460 3300046506 Bacteria 60178
129 Ga0495583_0000994 3300046506 Bacteria 32419
130 Ga0495606_0002669 3300046507 Bacteria 20257
131 Ga0495610_0000774 3300046512 Bacteria 30147
132 Ga0495610_0000828 3300046512 Bacteria 28914
133 Ga0495610_0001566 3300046512 Bacteria 20155
134 Ga0495610_0002459 3300046512 Bacteria 15575
135 Ga0495610_0003092 3300046512 Bacteria 13284
136 Ga0495620_0000457 3300046515 Bacteria 26955
137 Ga0495620_0001230 3300046515 Bacteria 15626
138 Ga0495631_0001820 3300046518 Bacteria 12598
139 Ga0495632_0000744 3300046519 Bacteria 29345
140 Ga0495632_0120406 3300046519 Bacteria 1227
141 Ga0495637_0000435 3300046520 Bacteria 30470
142 Ga0495637_0001629 3300046520 Bacteria 13023
143 Ga0495637_0015820 3300046520 Bacteria 3533
144 Ga0495643_0000654 3300046522 Bacteria 40993
145 Ga0495643_0001100 3300046522 Bacteria 26910
146 Ga0495643_0009054 3300046522 Bacteria 6243
147 Ga0495643_0032789 3300046522 Bacteria 2880
148 Ga0495648_0000533 3300046524 Bacteria 40990
149 Ga0495648_0000600 3300046524 Bacteria 38533
150 Ga0495648_0000644 3300046524 Bacteria 37213
151 Ga0495648_0135694 3300046524 Bacteria 1302
152 Ga0495654_0000267 3300046530 Bacteria 47487
153 Ga0495654_0000411 3300046530 Bacteria 36517
154 Ga0495654_0001758 3300046530 Bacteria 14517
155 Ga0495654_0001845 3300046530 Bacteria 14121
156 Ga0495654_0002608 3300046530 Bacteria 11491
157 Ga0495654_0023280 3300046530 Bacteria 3208
158 Ga0495609_0000446 3300046538 Bacteria 33826
159 Ga0495609_0000689 3300046538 Bacteria 26028
160 Ga0495597_0000059 3300046542 Bacteria 92644
161 Ga0495597_0011694 3300046542 Bacteria 4250
162 Ga0495597_0150094 3300046542 Bacteria 956
163 Ga0495622_0002188 3300046557 Bacteria 9538
164 Ga0495633_0005500 3300046558 Bacteria 7712
165 Ga0495611_0002136 3300046648 Bacteria 9239
166 Ga0495625_0012596 3300046660 Bacteria 6844
167 Ga0495625_0025320 3300046660 Bacteria 4501
168 Ga0495661_0031397 3300046665 Bacteria 3372
169 Ga0495588_0032783 3300046674 Bacteria 2620
170 Ga0495670_0011315 3300046691 Bacteria 4387
171 Ga0495671_0000501 3300046692 Bacteria 30161
172 Ga0495671_0003687 3300046692 Bacteria 9326
173 Ga0495671_0012182 3300046692 Bacteria 4700
174 Ga0495671_0043454 3300046692 Bacteria 2255
175 Ga0495649_0003317 3300046694 Bacteria 10929
176 Ga0495649_0005635 3300046694 Bacteria 7912
177 Ga0495589_0000360 3300046794 Bacteria 35369
178 Ga0495589_0000578 3300046794 Bacteria 25244
179 Ga0495636_0000132 3300047318 Bacteria 29973
180 Ga0495672_0000378 3300047320 Bacteria 55187
181 Ga0495672_0000695 3300047320 Bacteria 37258
182 Ga0495672_0000795 3300047320 Bacteria 34131
183 Ga0495672_0001265 3300047320 Bacteria 25341
184 Ga0495672_0013411 3300047320 Bacteria 5656
185 Ga0495672_0181035 3300047320 Bacteria 1067
186 Ga0495683_0000367 3300047323 Bacteria 37129
187 Ga0495683_0000825 3300047323 Bacteria 22072
188 Ga0495673_0024346 3300047469 Bacteria 2927
189 Ga0495681_0002623 3300047470 Bacteria 12776
190 Ga0495686_0002714 3300047472 Bacteria 16201
191 Ga0495626_0000524 3300048091 Bacteria 38319
192 Ga0495626_0000561 3300048091 Bacteria 36868
193 Ga0496102_0068015 3300048905 Bacteria 3268
194 Ga0496112_0097116 3300048915 Bacteria 2917
195 Ga0496114_0006291 3300048917 Bacteria 9347
196 Ga0496116_0000532 3300048919 Bacteria 51124
197 Ga0496116_0001782 3300048919 Bacteria 23403
198 Ga0496117_0000861 3300048920 Bacteria 47030
199 Ga0496117_0001050 3300048920 Bacteria 42088
200 Ga0496117_0001815 3300048920 Bacteria 29016
201 Ga0496117_0002469 3300048920 Bacteria 23223
202 Ga0496117_0019924 3300048920 Bacteria 5489
203 Ga0496118_0002174 3300048921 Bacteria 27294
204 Ga0496118_0002659 3300048921 Bacteria 23639
205 Ga0496118_0004948 3300048921 Bacteria 15439
206 Ga0496118_0024896 3300048921 Bacteria 5151
207 Ga0496118_0032223 3300048921 Bacteria 4324
208 Ga0496118_0036901 3300048921 Bacteria 3943
209 Ga0496121_0001218 3300048924 Bacteria 44832
210 Ga0496121_0002497 3300048924 Bacteria 27960
211 Ga0496121_0072098 3300048924 Bacteria 2774
212 Ga0496122_0001752 3300048925 Bacteria 33405
213 Ga0496122_0004377 3300048925 Bacteria 17599
214 Ga0496122_0009231 3300048925 Bacteria 10437
215 Ga0496122_0145010 3300048925 Bacteria 1477
216 Ga0496123_0001351 3300048926 Bacteria 34576
217 Ga0496123_0002412 3300048926 Bacteria 23311
218 Ga0496123_0003215 3300048926 Bacteria 18608
219 Ga0496123_0005985 3300048926 Bacteria 11964
220 Ga0496124_0004905 3300048927 Bacteria 15378
221 Ga0496124_0006745 3300048927 Bacteria 12415
222 Ga0496124_0006938 3300048927 Bacteria 12171
223 Ga0496125_0002952 3300048928 Bacteria 21374
224 Ga0496125_0022710 3300048928 Bacteria 5816
225 Ga0496125_0033071 3300048928 Bacteria 4583
226 Ga0496126_0002379 3300048929 Bacteria 25600
227 Ga0495678_062380 3300049459 Bacteria 1395
228 Ga0495682_0010387 3300049460 Bacteria 3607
229 nmdc:mga06r32_781_c1 3300050510 Bacteria 26964
230 2511273025 2511231007 Bacteria 6306603
231 2511345890 2511231019 Bacteria 6520662
232 2511359390 2511231021 Bacteria 7302637
233 2555671316 2554235341 Bacteria 6867980
234 2599354524 2599185160 Bacteria 6844013
235 2599359762 2599185161 Bacteria 6960462
236 2599366084 2599185162 Bacteria 6957254
237 2599372874 2599185163 Bacteria 6995158
238 2599379632 2599185164 Bacteria 6841688
239 2599385390 2599185165 Bacteria 6843250
240 2599391733 2599185166 Bacteria 6959206
241 2599403499 2599185168 Bacteria 6997636
242 2599461358 2599185181 Bacteria 6844519
243 2599469902 2599185182 Bacteria 6883168
244 2599490378 2599185186 Bacteria 6831633
245 2599964836 2599185306 Bacteria 6637356
246 2599976051 2599185308 Bacteria 6621546
247 2600010068 2599185314 Bacteria 6621749
248 2600213975 2599185356 Bacteria 6843884
249 2601774141 2600255313 Bacteria 6842543
250 2643956538 2643221589 Bacteria 6250934
251 2644025420 2643221602 Bacteria 6249926
252 2644281669 2643221650 Bacteria 7029547
253 2671097105 2667528171 Bacteria 6900659
254 2715751253 2713897148 Bacteria 5883533
255 2765585385 2765235841 Bacteria 6137024
256 2808941465 2808606379 Bacteria 5022697
257 2808975814 2808606385 Bacteria 6711065
258 2808990548 2808606388 Bacteria 6706662
259 2819702200 2818991464 Bacteria 6907494
260 2842836545 2842832357 Bacteria 5959113
261 2842844658 2842843487 Bacteria 6004777
262 2844671842 2844665904 Bacteria 6817974
263 2852614893 2852612431 Bacteria 6885235
264 2852669861 2852667396 Bacteria 6885555
265 2904555075 2904550169 Bacteria 6221258
266 2908448512 2908446538 Bacteria 6829095
267 2917075180 2917070673 Bacteria 6868303
268 2919157458 2919155634 Bacteria 4860545
269 2919489791 2919487758 Bacteria 5929766
270 2935356168 2935353572 Unclassified 6955622
271 2939637584 2939636861 Bacteria 6297853
272 2974289916 2974289157 Bacteria 6080362
273 3007513109 3007511990 Bacteria 6481491
274 3007807424 3007803356 Bacteria 5931491
275 3007865445 3007861166 Bacteria 6045338
276 637321643 637000220 Bacteria 7074893
277 8019773108 8019769354 Bacteria 6924660
278 8054505172 8054503363 Bacteria 6101651
279 8056127535 8056125926 Bacteria 6228218
280 8056133496 8056131705 Bacteria 6107031
281 8056149773 8056148874 Bacteria 6479865
282 8056179436 8056177738 Bacteria 6748268
283 Ga0495648_0015665
284 MRS2a_Contig_949
285 JGI25162J39368_1000330
286 JGI25163J39215_1000287
287 JGI25164J39214_1000251
288 JGI25165J46597_1000362
289 Ga0065714_10002270
290 Ga0065714_10065403
291 Ga0070670_100001543
292 Ga0070661_100000132
293 Ga0070664_100000361
294 Ga0075432_10010488
295 Ga0075432_10035150
296 Ga0075432_10048108
297 Ga0075362_10078966
298 Ga0075369_10087488
299 Ga0075431_100001319
300 Ga0099823_1046345
301 Ga0079104_1000115
302 Ga0105251_10001056
303 Ga0105251_10003620
304 Ga0105251_10007086
305 Ga0105244_10000300
306 Ga0105244_10000547
307 Ga0105244_10001592
308 Ga0105244_10001595
309 Ga0105244_10002020
310 Ga0105250_10000415
311 Ga0105250_10006640
312 Ga0105250_10011930
313 Ga0105243_10004552
314 Ga0105249_10023937
315 Ga0157373_10000684
316 Ga0157371_10033740
317 Ga0157370_10030847
318 Ga0157369_10003354
319 Ga0157369_10003414
320 Ga0182008_10000912
321 Ga0182008_10001622
322 Ga0182008_10022174
323 Ga0182007_10000772
324 Ga0182007_10041369
325 Ga0163161_10000482
326 Ga0163161_10004889
327 Ga0209760_100043
328 Ga0207427_100082
329 Ga0209437_100006
330 Ga0209233_1000105
331 Ga0209676_1000309
332 Ga0207696_1000097
333 Ga0207696_1000373
334 Ga0207655_1000421
335 Ga0207655_1000485
336 Ga0207655_1000706
337 Ga0207655_1000744
338 Ga0207655_1001457
339 Ga0207655_1044128
340 Ga0207713_1001078
341 Ga0207713_1006661
342 Ga0207713_1023253
343 Ga0207649_10000002
344 Ga0207650_10001130
345 Ga0207709_10001759
346 Ga0207679_10000006
347 Ga0209281_1000077
348 Ga0209389_1055960
349 Ga0209371_1000338
350 Ga0207428_10022515
351 Ga0207428_10056856
352 Ga0207428_10064658
353 Ga0268256_1000289
354 Ga0307412_10000311
355 Ga0439438_000275
356 Ga0439438_000402
357 Ga0439438_003901
358 Ga0439438_015032
359 Ga0439447_000209
360 Ga0439466_0000423
361 Ga0439466_0001149
362 Ga0439466_0004559
363 Ga0439432_000134
364 Ga0439432_000178
365 Ga0439432_008477
366 Ga0439432_013123
367 Ga0439451_000248
368 Ga0439451_002364
369 Ga0439452_000602
370 Ga0439452_001021
371 Ga0439456_000929
372 Ga0439456_019912
373 Ga0439463_000392
374 Ga0439463_001553
375 Ga0439463_002335
376 Ga0450920_000041
377 Ga0450922_000005
378 Ga0450923_000599
379 Ga0450903_000564
380 Ga0450906_000092
381 Ga0450906_017466
382 Ga0450907_000218
383 Ga0450910_000026
384 Ga0450908_001662
385 Ga0439464_0032573
386 Ga0439460_0000024
387 Ga0439460_0000071
388 Ga0495617_000200
389 Ga0495627_022770
390 Ga0495627_052506
391 Ga0495590_0026303
392 Ga0495591_000128
393 Ga0495591_000210
394 Ga0495591_006769
395 Ga0495638_0000602
396 Ga0495638_0000726
397 Ga0495638_0006834
398 Ga0495638_0012983
399 Ga0495638_0017778
400 Ga0495638_0033515
401 Ga0495650_0001217
402 Ga0495605_0000593
403 Ga0495605_0000672
404 Ga0495605_0012903
405 Ga0495584_0000373
406 Ga0495596_0001869
407 Ga0495607_0000513
408 Ga0495607_0000639
409 Ga0495607_0003343
410 Ga0495583_0000460
411 Ga0495583_0000994
412 Ga0495606_0002669
413 Ga0495610_0000774
414 Ga0495610_0000828
415 Ga0495610_0001566
416 Ga0495610_0002459
417 Ga0495610_0003092
418 Ga0495620_0000457
419 Ga0495620_0001230
420 Ga0495631_0001820
421 Ga0495632_0000744
422 Ga0495632_0120406
423 Ga0495637_0000435
424 Ga0495637_0001629
425 Ga0495637_0015820
426 Ga0495643_0000654
427 Ga0495643_0001100
428 Ga0495643_0009054
429 Ga0495643_0032789
430 Ga0495648_0000533
431 Ga0495648_0000600
432 Ga0495648_0000644
433 Ga0495648_0135694
434 Ga0495654_0000267
435 Ga0495654_0000411
436 Ga0495654_0001758
437 Ga0495654_0001845
438 Ga0495654_0002608
439 Ga0495654_0023280
440 Ga0495609_0000446
441 Ga0495609_0000689
442 Ga0495597_0000059
443 Ga0495597_0011694
444 Ga0495597_0150094
445 Ga0495622_0002188
446 Ga0495633_0005500
447 Ga0495611_0002136
448 Ga0495625_0012596
449 Ga0495625_0025320
450 Ga0495661_0031397
451 Ga0495588_0032783
452 Ga0495670_0011315
453 Ga0495671_0000501
454 Ga0495671_0003687
455 Ga0495671_0012182
456 Ga0495671_0043454
457 Ga0495649_0003317
458 Ga0495649_0005635
459 Ga0495589_0000360
460 Ga0495589_0000578
461 Ga0495636_0000132
462 Ga0495672_0000378
463 Ga0495672_0000695
464 Ga0495672_0000795
465 Ga0495672_0001265
466 Ga0495672_0013411
467 Ga0495672_0181035
468 Ga0495683_0000367
469 Ga0495683_0000825
470 Ga0495673_0024346
471 Ga0495681_0002623
472 Ga0495686_0002714
473 Ga0495626_0000524
474 Ga0495626_0000561
475 Ga0496102_0068015
476 Ga0496112_0097116
477 Ga0496114_0006291
478 Ga0496116_0000532
479 Ga0496116_0001782
480 Ga0496117_0000861
481 Ga0496117_0001050
482 Ga0496117_0001815
483 Ga0496117_0002469
484 Ga0496117_0019924
485 Ga0496118_0002174
486 Ga0496118_0002659
487 Ga0496118_0004948
488 Ga0496118_0024896
489 Ga0496118_0032223
490 Ga0496118_0036901
491 Ga0496121_0001218
492 Ga0496121_0002497
493 Ga0496121_0072098
494 Ga0496122_0001752
495 Ga0496122_0004377
496 Ga0496122_0009231
497 Ga0496122_0145010
498 Ga0496123_0001351
499 Ga0496123_0002412
500 Ga0496123_0003215
501 Ga0496123_0005985
502 Ga0496124_0004905
503 Ga0496124_0006745
504 Ga0496124_0006938
505 Ga0496125_0002952
506 Ga0496125_0022710
507 Ga0496125_0033071
508 Ga0496126_0002379
509 Ga0495678_062380
510 Ga0495682_0010387
511 nmdc:mga06r32_781_c1
512 2511273025
513 2511345890
514 2511359390
515 2555671316
516 2599354524
517 2599359762
518 2599366084
519 2599372874
520 2599379632
521 2599385390
522 2599391733
523 2599403499
524 2599461358
525 2599469902
526 2599490378
527 2599964836
528 2599976051
529 2600010068
530 2600213975
531 2601774141
532 2643956538
533 2644025420
534 2644281669
535 2671097105
536 2715751253
537 2765585385
538 2808941465
539 2808975814
540 2808990548
541 2819702200
542 2842836545
543 2842844658
544 2844671842
545 2852614893
546 2852669861
547 2904555075
548 2908448512
549 2917075180
550 2919157458
551 2919489791
552 2935356168
553 2939637584
554 2974289916
555 3007513109
556 3007807424
557 3007865445
558 637321643
559 8019773108
560 8054505172
561 8056127535
562 8056133496
563 8056149773
564 8056179436

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00953

Glycos_transf_4

Glycosyl transferase family 4

96

251

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6oyz-assembly3.cif.gz_B crystal structure of mray bound to capuramycin 0.7872 20 238
8cxr-assembly1.cif.gz_A crystal structure of mray bound to a sphaerimicin analogue 0.781 2 238
6oz6-assembly3.cif.gz_C error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7527 2 238
6bw5-assembly2.cif.gz_C human gpt (dpagt1) in complex with tunicamycin 0.7423 17 189
6oz6-assembly4.cif.gz_D error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.731 2 238
ID Description Score Start End Superfamily
af_P9WPG3_21_202_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.3375 82 262 1.20.120.1760
af_P9WPG3_21_202_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.3259 82 262 1.20.120.1760
af_P25960_74_220_1.20.120.1220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.3232 16 193 1.20.120.1220
af_Q54YE2_26_310_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.3035 149 261 1.10.600.10
af_F1QW05_54_223_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.2888 95 262 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A836ZIM0-F1-model_v4 deleted 0.9816 1 87
AF-A0A832N3D0-F1-model_v4 Glycosyl transferase 0.9617 1 86 GO:0005886
GO:0009103
GO:0016780
GO:0044038
GO:0071555
AF-A0A3D1BBK3-F1-model_v4 Glycosyl transferase 0.9589 167 267 GO:0016020
GO:0016740
AF-A0A5E7RUI2-F1-model_v4 Undecaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase (EC 2.7.8.33) 0.9456 2 268 GO:0005886
GO:0009103
GO:0036380
GO:0044038
GO:0046872
GO:0071555
AF-A0A7Y9VY14-F1-model_v4 Fuc2NAc and GlcNAc transferase (EC 2.4.1.-) 0.944 13 267 GO:0005886
GO:0009103
GO:0016757
GO:0016780
GO:0044038
GO:0046872
GO:0071555

Map