F385151
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 282 | 170 | 564 | 320 |
Family's Representative Sequence
| Representative Sequence | 3300046524|Ga0495648_0015665|Ga0495648_0015665_2606_3685 |
| Length | 359 |
| Sequence | VFSGAFEVVGSLDLEPELESLMNHLLWLALVVAALAFLLTLFLRRYALSRSLIDIPNARSSHLVPTPRGGGVAIVLSFLVALPILLMSGATSQSVTWALMVGGAAVAVLGFLDDHGHIAARWRLLGHFSAAIWALVCIGGLPPISLPGGTVDLGWLGHILAVFYLVWVLNLYNFMDGIDGLASVEAICVCLGACLVYGLGGYPMLIWAPLLLSMAVLGFLYWNVPAARIFMGDAGSGFLGFVLGGLSLAAAWQNANLLWVWLILLGVFITDATFTLIRRLMRGDKVYEAHRSHAYQFAARKVGRHLPVTLSVLSINLLWLTPIAIGVGVLGLNGLFGLVVAYVPLVVLAVKFKAGAIET |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 4 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 5 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 7 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 12 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 13 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 14 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 15 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 16 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 17 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 18 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 19 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 20 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 21 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 22 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 23 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 24 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 25 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 26 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 27 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 28 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 29 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 30 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 31 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 32 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 33 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 34 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 42 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 43 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 45 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 46 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 47 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 48 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 49 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 50 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 51 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 52 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 53 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 54 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 55 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 56 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 57 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 58 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 59 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 60 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 61 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 62 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 63 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 64 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 65 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 66 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 67 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 68 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 69 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 70 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 71 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 72 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 73 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 74 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 75 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 76 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 77 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 104 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 105 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 106 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 107 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 108 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 109 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 110 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 111 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 112 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 113 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 114 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 115 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 118 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 119 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 120 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 121 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 122 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 123 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 124 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 125 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 126 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 127 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 128 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 129 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 130 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 131 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 132 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 133 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 134 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 135 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 136 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 137 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 138 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 139 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 140 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 141 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 142 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 143 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 144 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 145 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 146 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 147 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 148 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 149 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 150 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 151 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 152 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 153 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 154 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 155 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 156 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 157 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 158 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 159 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 160 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 161 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 162 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 163 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 164 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 165 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 166 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 167 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 168 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 169 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 170 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81.21 |
| Metatranscriptomes | 0 |
| Isolates | 18.79 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.9 |
| Nodule | 2.48 |
| Rhizoplane | 7.45 |
| Rhizosphere | 70.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495648_0015665 | 3300046524 | Bacteria | 5492 |
| 2 | MRS2a_Contig_949 | 2124908027 | Bacteria | 2192 |
| 3 | JGI25162J39368_1000330 | 3300002737 | Bacteria | 41675 |
| 4 | JGI25163J39215_1000287 | 3300002771 | Bacteria | 17355 |
| 5 | JGI25164J39214_1000251 | 3300002772 | Bacteria | 40327 |
| 6 | JGI25165J46597_1000362 | 3300003214 | Bacteria | 50814 |
| 7 | Ga0065714_10002270 | 3300005288 | Bacteria | 29515 |
| 8 | Ga0065714_10065403 | 3300005288 | Bacteria | 10293 |
| 9 | Ga0070670_100001543 | 3300005331 | Bacteria | 18565 |
| 10 | Ga0070661_100000132 | 3300005344 | Bacteria | 62286 |
| 11 | Ga0070664_100000361 | 3300005564 | Bacteria | 33502 |
| 12 | Ga0075432_10010488 | 3300006058 | Bacteria | 3145 |
| 13 | Ga0075432_10035150 | 3300006058 | Bacteria | 1741 |
| 14 | Ga0075432_10048108 | 3300006058 | Bacteria | 1500 |
| 15 | Ga0075362_10078966 | 3300006177 | Bacteria | 1514 |
| 16 | Ga0075369_10087488 | 3300006186 | Bacteria | 1388 |
| 17 | Ga0075431_100001319 | 3300006847 | Bacteria | 22677 |
| 18 | Ga0099823_1046345 | 3300006944 | Bacteria | 2859 |
| 19 | Ga0079104_1000115 | 3300006946 | Bacteria | 115517 |
| 20 | Ga0105251_10001056 | 3300009011 | Bacteria | 24130 |
| 21 | Ga0105251_10003620 | 3300009011 | Bacteria | 11111 |
| 22 | Ga0105251_10007086 | 3300009011 | Bacteria | 6987 |
| 23 | Ga0105244_10000300 | 3300009036 | Bacteria | 48059 |
| 24 | Ga0105244_10000547 | 3300009036 | Bacteria | 33532 |
| 25 | Ga0105244_10001592 | 3300009036 | Bacteria | 18035 |
| 26 | Ga0105244_10001595 | 3300009036 | Bacteria | 18015 |
| 27 | Ga0105244_10002020 | 3300009036 | Bacteria | 15645 |
| 28 | Ga0105250_10000415 | 3300009092 | Bacteria | 31253 |
| 29 | Ga0105250_10006640 | 3300009092 | Bacteria | 5036 |
| 30 | Ga0105250_10011930 | 3300009092 | Bacteria | 3599 |
| 31 | Ga0105243_10004552 | 3300009148 | Bacteria | 10950 |
| 32 | Ga0105249_10023937 | 3300009553 | Bacteria | 5485 |
| 33 | Ga0157373_10000684 | 3300013100 | Bacteria | 26574 |
| 34 | Ga0157371_10033740 | 3300013102 | Bacteria | 3675 |
| 35 | Ga0157370_10030847 | 3300013104 | Bacteria | 5251 |
| 36 | Ga0157369_10003354 | 3300013105 | Bacteria | 19017 |
| 37 | Ga0157369_10003414 | 3300013105 | Bacteria | 18837 |
| 38 | Ga0182008_10000912 | 3300014497 | Bacteria | 20556 |
| 39 | Ga0182008_10001622 | 3300014497 | Bacteria | 14896 |
| 40 | Ga0182008_10022174 | 3300014497 | Bacteria | 3253 |
| 41 | Ga0182007_10000772 | 3300015262 | Bacteria | 17934 |
| 42 | Ga0182007_10041369 | 3300015262 | Bacteria | 1536 |
| 43 | Ga0163161_10000482 | 3300017792 | Bacteria | 32775 |
| 44 | Ga0163161_10004889 | 3300017792 | Bacteria | 9336 |
| 45 | Ga0209760_100043 | 3300025207 | Bacteria | 113964 |
| 46 | Ga0207427_100082 | 3300025231 | Bacteria | 142809 |
| 47 | Ga0209437_100006 | 3300025233 | Bacteria | 1042724 |
| 48 | Ga0209233_1000105 | 3300025261 | Bacteria | 272035 |
| 49 | Ga0209676_1000309 | 3300025292 | Bacteria | 95678 |
| 50 | Ga0207696_1000097 | 3300025711 | Bacteria | 175696 |
| 51 | Ga0207696_1000373 | 3300025711 | Bacteria | 44298 |
| 52 | Ga0207655_1000421 | 3300025728 | Bacteria | 57722 |
| 53 | Ga0207655_1000485 | 3300025728 | Bacteria | 51276 |
| 54 | Ga0207655_1000706 | 3300025728 | Bacteria | 38597 |
| 55 | Ga0207655_1000744 | 3300025728 | Bacteria | 36545 |
| 56 | Ga0207655_1001457 | 3300025728 | Bacteria | 21890 |
| 57 | Ga0207655_1044128 | 3300025728 | Bacteria | 1876 |
| 58 | Ga0207713_1001078 | 3300025735 | Bacteria | 23498 |
| 59 | Ga0207713_1006661 | 3300025735 | Bacteria | 6991 |
| 60 | Ga0207713_1023253 | 3300025735 | Bacteria | 2921 |
| 61 | Ga0207649_10000002 | 3300025920 | Bacteria | 498633 |
| 62 | Ga0207650_10001130 | 3300025925 | Bacteria | 19629 |
| 63 | Ga0207709_10001759 | 3300025935 | Bacteria | 14567 |
| 64 | Ga0207679_10000006 | 3300025945 | Bacteria | 498868 |
| 65 | Ga0209281_1000077 | 3300027111 | Bacteria | 262887 |
| 66 | Ga0209389_1055960 | 3300027296 | Bacteria | 2578 |
| 67 | Ga0209371_1000338 | 3300027312 | Bacteria | 51239 |
| 68 | Ga0207428_10022515 | 3300027907 | Bacteria | 5316 |
| 69 | Ga0207428_10056856 | 3300027907 | Bacteria | 3108 |
| 70 | Ga0207428_10064658 | 3300027907 | Bacteria | 2887 |
| 71 | Ga0268256_1000289 | 3300030500 | Bacteria | 51239 |
| 72 | Ga0307412_10000311 | 3300031911 | Bacteria | 30815 |
| 73 | Ga0439438_000275 | 3300041405 | Bacteria | 23167 |
| 74 | Ga0439438_000402 | 3300041405 | Bacteria | 19401 |
| 75 | Ga0439438_003901 | 3300041405 | Bacteria | 5870 |
| 76 | Ga0439438_015032 | 3300041405 | Bacteria | 2288 |
| 77 | Ga0439447_000209 | 3300041407 | Bacteria | 20602 |
| 78 | Ga0439466_0000423 | 3300041411 | Bacteria | 16048 |
| 79 | Ga0439466_0001149 | 3300041411 | Bacteria | 10290 |
| 80 | Ga0439466_0004559 | 3300041411 | Bacteria | 5323 |
| 81 | Ga0439432_000134 | 3300042006 | Bacteria | 24792 |
| 82 | Ga0439432_000178 | 3300042006 | Bacteria | 22518 |
| 83 | Ga0439432_008477 | 3300042006 | Bacteria | 3608 |
| 84 | Ga0439432_013123 | 3300042006 | Bacteria | 2820 |
| 85 | Ga0439451_000248 | 3300042009 | Bacteria | 10384 |
| 86 | Ga0439451_002364 | 3300042009 | Bacteria | 3819 |
| 87 | Ga0439452_000602 | 3300042010 | Bacteria | 18503 |
| 88 | Ga0439452_001021 | 3300042010 | Bacteria | 12401 |
| 89 | Ga0439456_000929 | 3300042013 | Bacteria | 5853 |
| 90 | Ga0439456_019912 | 3300042013 | Bacteria | 1413 |
| 91 | Ga0439463_000392 | 3300042016 | Bacteria | 12086 |
| 92 | Ga0439463_001553 | 3300042016 | Bacteria | 6057 |
| 93 | Ga0439463_002335 | 3300042016 | Bacteria | 4840 |
| 94 | Ga0450920_000041 | 3300042122 | Bacteria | 15759 |
| 95 | Ga0450922_000005 | 3300042124 | Bacteria | 19334 |
| 96 | Ga0450923_000599 | 3300042125 | Bacteria | 4131 |
| 97 | Ga0450903_000564 | 3300042138 | Bacteria | 7625 |
| 98 | Ga0450906_000092 | 3300042145 | Bacteria | 14957 |
| 99 | Ga0450906_017466 | 3300042145 | Bacteria | 1294 |
| 100 | Ga0450907_000218 | 3300042146 | Bacteria | 20314 |
| 101 | Ga0450910_000026 | 3300042147 | Bacteria | 19055 |
| 102 | Ga0450908_001662 | 3300042184 | Bacteria | 4324 |
| 103 | Ga0439464_0032573 | 3300042439 | Bacteria | 1465 |
| 104 | Ga0439460_0000024 | 3300042461 | Bacteria | 21720 |
| 105 | Ga0439460_0000071 | 3300042461 | Bacteria | 15336 |
| 106 | Ga0495617_000200 | 3300046452 | Bacteria | 37820 |
| 107 | Ga0495627_022770 | 3300046453 | Bacteria | 2058 |
| 108 | Ga0495627_052506 | 3300046453 | Bacteria | 1222 |
| 109 | Ga0495590_0026303 | 3300046457 | Bacteria | 2043 |
| 110 | Ga0495591_000128 | 3300046458 | Bacteria | 82830 |
| 111 | Ga0495591_000210 | 3300046458 | Bacteria | 59177 |
| 112 | Ga0495591_006769 | 3300046458 | Bacteria | 4991 |
| 113 | Ga0495638_0000602 | 3300046460 | Bacteria | 40434 |
| 114 | Ga0495638_0000726 | 3300046460 | Bacteria | 35496 |
| 115 | Ga0495638_0006834 | 3300046460 | Bacteria | 8237 |
| 116 | Ga0495638_0012983 | 3300046460 | Bacteria | 5688 |
| 117 | Ga0495638_0017778 | 3300046460 | Bacteria | 4734 |
| 118 | Ga0495638_0033515 | 3300046460 | Bacteria | 3285 |
| 119 | Ga0495650_0001217 | 3300046471 | Bacteria | 26985 |
| 120 | Ga0495605_0000593 | 3300046474 | Bacteria | 28835 |
| 121 | Ga0495605_0000672 | 3300046474 | Bacteria | 25764 |
| 122 | Ga0495605_0012903 | 3300046474 | Bacteria | 4624 |
| 123 | Ga0495584_0000373 | 3300046491 | Bacteria | 30942 |
| 124 | Ga0495596_0001869 | 3300046500 | Bacteria | 11678 |
| 125 | Ga0495607_0000513 | 3300046501 | Bacteria | 38283 |
| 126 | Ga0495607_0000639 | 3300046501 | Bacteria | 34018 |
| 127 | Ga0495607_0003343 | 3300046501 | Bacteria | 12302 |
| 128 | Ga0495583_0000460 | 3300046506 | Bacteria | 60178 |
| 129 | Ga0495583_0000994 | 3300046506 | Bacteria | 32419 |
| 130 | Ga0495606_0002669 | 3300046507 | Bacteria | 20257 |
| 131 | Ga0495610_0000774 | 3300046512 | Bacteria | 30147 |
| 132 | Ga0495610_0000828 | 3300046512 | Bacteria | 28914 |
| 133 | Ga0495610_0001566 | 3300046512 | Bacteria | 20155 |
| 134 | Ga0495610_0002459 | 3300046512 | Bacteria | 15575 |
| 135 | Ga0495610_0003092 | 3300046512 | Bacteria | 13284 |
| 136 | Ga0495620_0000457 | 3300046515 | Bacteria | 26955 |
| 137 | Ga0495620_0001230 | 3300046515 | Bacteria | 15626 |
| 138 | Ga0495631_0001820 | 3300046518 | Bacteria | 12598 |
| 139 | Ga0495632_0000744 | 3300046519 | Bacteria | 29345 |
| 140 | Ga0495632_0120406 | 3300046519 | Bacteria | 1227 |
| 141 | Ga0495637_0000435 | 3300046520 | Bacteria | 30470 |
| 142 | Ga0495637_0001629 | 3300046520 | Bacteria | 13023 |
| 143 | Ga0495637_0015820 | 3300046520 | Bacteria | 3533 |
| 144 | Ga0495643_0000654 | 3300046522 | Bacteria | 40993 |
| 145 | Ga0495643_0001100 | 3300046522 | Bacteria | 26910 |
| 146 | Ga0495643_0009054 | 3300046522 | Bacteria | 6243 |
| 147 | Ga0495643_0032789 | 3300046522 | Bacteria | 2880 |
| 148 | Ga0495648_0000533 | 3300046524 | Bacteria | 40990 |
| 149 | Ga0495648_0000600 | 3300046524 | Bacteria | 38533 |
| 150 | Ga0495648_0000644 | 3300046524 | Bacteria | 37213 |
| 151 | Ga0495648_0135694 | 3300046524 | Bacteria | 1302 |
| 152 | Ga0495654_0000267 | 3300046530 | Bacteria | 47487 |
| 153 | Ga0495654_0000411 | 3300046530 | Bacteria | 36517 |
| 154 | Ga0495654_0001758 | 3300046530 | Bacteria | 14517 |
| 155 | Ga0495654_0001845 | 3300046530 | Bacteria | 14121 |
| 156 | Ga0495654_0002608 | 3300046530 | Bacteria | 11491 |
| 157 | Ga0495654_0023280 | 3300046530 | Bacteria | 3208 |
| 158 | Ga0495609_0000446 | 3300046538 | Bacteria | 33826 |
| 159 | Ga0495609_0000689 | 3300046538 | Bacteria | 26028 |
| 160 | Ga0495597_0000059 | 3300046542 | Bacteria | 92644 |
| 161 | Ga0495597_0011694 | 3300046542 | Bacteria | 4250 |
| 162 | Ga0495597_0150094 | 3300046542 | Bacteria | 956 |
| 163 | Ga0495622_0002188 | 3300046557 | Bacteria | 9538 |
| 164 | Ga0495633_0005500 | 3300046558 | Bacteria | 7712 |
| 165 | Ga0495611_0002136 | 3300046648 | Bacteria | 9239 |
| 166 | Ga0495625_0012596 | 3300046660 | Bacteria | 6844 |
| 167 | Ga0495625_0025320 | 3300046660 | Bacteria | 4501 |
| 168 | Ga0495661_0031397 | 3300046665 | Bacteria | 3372 |
| 169 | Ga0495588_0032783 | 3300046674 | Bacteria | 2620 |
| 170 | Ga0495670_0011315 | 3300046691 | Bacteria | 4387 |
| 171 | Ga0495671_0000501 | 3300046692 | Bacteria | 30161 |
| 172 | Ga0495671_0003687 | 3300046692 | Bacteria | 9326 |
| 173 | Ga0495671_0012182 | 3300046692 | Bacteria | 4700 |
| 174 | Ga0495671_0043454 | 3300046692 | Bacteria | 2255 |
| 175 | Ga0495649_0003317 | 3300046694 | Bacteria | 10929 |
| 176 | Ga0495649_0005635 | 3300046694 | Bacteria | 7912 |
| 177 | Ga0495589_0000360 | 3300046794 | Bacteria | 35369 |
| 178 | Ga0495589_0000578 | 3300046794 | Bacteria | 25244 |
| 179 | Ga0495636_0000132 | 3300047318 | Bacteria | 29973 |
| 180 | Ga0495672_0000378 | 3300047320 | Bacteria | 55187 |
| 181 | Ga0495672_0000695 | 3300047320 | Bacteria | 37258 |
| 182 | Ga0495672_0000795 | 3300047320 | Bacteria | 34131 |
| 183 | Ga0495672_0001265 | 3300047320 | Bacteria | 25341 |
| 184 | Ga0495672_0013411 | 3300047320 | Bacteria | 5656 |
| 185 | Ga0495672_0181035 | 3300047320 | Bacteria | 1067 |
| 186 | Ga0495683_0000367 | 3300047323 | Bacteria | 37129 |
| 187 | Ga0495683_0000825 | 3300047323 | Bacteria | 22072 |
| 188 | Ga0495673_0024346 | 3300047469 | Bacteria | 2927 |
| 189 | Ga0495681_0002623 | 3300047470 | Bacteria | 12776 |
| 190 | Ga0495686_0002714 | 3300047472 | Bacteria | 16201 |
| 191 | Ga0495626_0000524 | 3300048091 | Bacteria | 38319 |
| 192 | Ga0495626_0000561 | 3300048091 | Bacteria | 36868 |
| 193 | Ga0496102_0068015 | 3300048905 | Bacteria | 3268 |
| 194 | Ga0496112_0097116 | 3300048915 | Bacteria | 2917 |
| 195 | Ga0496114_0006291 | 3300048917 | Bacteria | 9347 |
| 196 | Ga0496116_0000532 | 3300048919 | Bacteria | 51124 |
| 197 | Ga0496116_0001782 | 3300048919 | Bacteria | 23403 |
| 198 | Ga0496117_0000861 | 3300048920 | Bacteria | 47030 |
| 199 | Ga0496117_0001050 | 3300048920 | Bacteria | 42088 |
| 200 | Ga0496117_0001815 | 3300048920 | Bacteria | 29016 |
| 201 | Ga0496117_0002469 | 3300048920 | Bacteria | 23223 |
| 202 | Ga0496117_0019924 | 3300048920 | Bacteria | 5489 |
| 203 | Ga0496118_0002174 | 3300048921 | Bacteria | 27294 |
| 204 | Ga0496118_0002659 | 3300048921 | Bacteria | 23639 |
| 205 | Ga0496118_0004948 | 3300048921 | Bacteria | 15439 |
| 206 | Ga0496118_0024896 | 3300048921 | Bacteria | 5151 |
| 207 | Ga0496118_0032223 | 3300048921 | Bacteria | 4324 |
| 208 | Ga0496118_0036901 | 3300048921 | Bacteria | 3943 |
| 209 | Ga0496121_0001218 | 3300048924 | Bacteria | 44832 |
| 210 | Ga0496121_0002497 | 3300048924 | Bacteria | 27960 |
| 211 | Ga0496121_0072098 | 3300048924 | Bacteria | 2774 |
| 212 | Ga0496122_0001752 | 3300048925 | Bacteria | 33405 |
| 213 | Ga0496122_0004377 | 3300048925 | Bacteria | 17599 |
| 214 | Ga0496122_0009231 | 3300048925 | Bacteria | 10437 |
| 215 | Ga0496122_0145010 | 3300048925 | Bacteria | 1477 |
| 216 | Ga0496123_0001351 | 3300048926 | Bacteria | 34576 |
| 217 | Ga0496123_0002412 | 3300048926 | Bacteria | 23311 |
| 218 | Ga0496123_0003215 | 3300048926 | Bacteria | 18608 |
| 219 | Ga0496123_0005985 | 3300048926 | Bacteria | 11964 |
| 220 | Ga0496124_0004905 | 3300048927 | Bacteria | 15378 |
| 221 | Ga0496124_0006745 | 3300048927 | Bacteria | 12415 |
| 222 | Ga0496124_0006938 | 3300048927 | Bacteria | 12171 |
| 223 | Ga0496125_0002952 | 3300048928 | Bacteria | 21374 |
| 224 | Ga0496125_0022710 | 3300048928 | Bacteria | 5816 |
| 225 | Ga0496125_0033071 | 3300048928 | Bacteria | 4583 |
| 226 | Ga0496126_0002379 | 3300048929 | Bacteria | 25600 |
| 227 | Ga0495678_062380 | 3300049459 | Bacteria | 1395 |
| 228 | Ga0495682_0010387 | 3300049460 | Bacteria | 3607 |
| 229 | nmdc:mga06r32_781_c1 | 3300050510 | Bacteria | 26964 |
| 230 | 2511273025 | 2511231007 | Bacteria | 6306603 |
| 231 | 2511345890 | 2511231019 | Bacteria | 6520662 |
| 232 | 2511359390 | 2511231021 | Bacteria | 7302637 |
| 233 | 2555671316 | 2554235341 | Bacteria | 6867980 |
| 234 | 2599354524 | 2599185160 | Bacteria | 6844013 |
| 235 | 2599359762 | 2599185161 | Bacteria | 6960462 |
| 236 | 2599366084 | 2599185162 | Bacteria | 6957254 |
| 237 | 2599372874 | 2599185163 | Bacteria | 6995158 |
| 238 | 2599379632 | 2599185164 | Bacteria | 6841688 |
| 239 | 2599385390 | 2599185165 | Bacteria | 6843250 |
| 240 | 2599391733 | 2599185166 | Bacteria | 6959206 |
| 241 | 2599403499 | 2599185168 | Bacteria | 6997636 |
| 242 | 2599461358 | 2599185181 | Bacteria | 6844519 |
| 243 | 2599469902 | 2599185182 | Bacteria | 6883168 |
| 244 | 2599490378 | 2599185186 | Bacteria | 6831633 |
| 245 | 2599964836 | 2599185306 | Bacteria | 6637356 |
| 246 | 2599976051 | 2599185308 | Bacteria | 6621546 |
| 247 | 2600010068 | 2599185314 | Bacteria | 6621749 |
| 248 | 2600213975 | 2599185356 | Bacteria | 6843884 |
| 249 | 2601774141 | 2600255313 | Bacteria | 6842543 |
| 250 | 2643956538 | 2643221589 | Bacteria | 6250934 |
| 251 | 2644025420 | 2643221602 | Bacteria | 6249926 |
| 252 | 2644281669 | 2643221650 | Bacteria | 7029547 |
| 253 | 2671097105 | 2667528171 | Bacteria | 6900659 |
| 254 | 2715751253 | 2713897148 | Bacteria | 5883533 |
| 255 | 2765585385 | 2765235841 | Bacteria | 6137024 |
| 256 | 2808941465 | 2808606379 | Bacteria | 5022697 |
| 257 | 2808975814 | 2808606385 | Bacteria | 6711065 |
| 258 | 2808990548 | 2808606388 | Bacteria | 6706662 |
| 259 | 2819702200 | 2818991464 | Bacteria | 6907494 |
| 260 | 2842836545 | 2842832357 | Bacteria | 5959113 |
| 261 | 2842844658 | 2842843487 | Bacteria | 6004777 |
| 262 | 2844671842 | 2844665904 | Bacteria | 6817974 |
| 263 | 2852614893 | 2852612431 | Bacteria | 6885235 |
| 264 | 2852669861 | 2852667396 | Bacteria | 6885555 |
| 265 | 2904555075 | 2904550169 | Bacteria | 6221258 |
| 266 | 2908448512 | 2908446538 | Bacteria | 6829095 |
| 267 | 2917075180 | 2917070673 | Bacteria | 6868303 |
| 268 | 2919157458 | 2919155634 | Bacteria | 4860545 |
| 269 | 2919489791 | 2919487758 | Bacteria | 5929766 |
| 270 | 2935356168 | 2935353572 | Unclassified | 6955622 |
| 271 | 2939637584 | 2939636861 | Bacteria | 6297853 |
| 272 | 2974289916 | 2974289157 | Bacteria | 6080362 |
| 273 | 3007513109 | 3007511990 | Bacteria | 6481491 |
| 274 | 3007807424 | 3007803356 | Bacteria | 5931491 |
| 275 | 3007865445 | 3007861166 | Bacteria | 6045338 |
| 276 | 637321643 | 637000220 | Bacteria | 7074893 |
| 277 | 8019773108 | 8019769354 | Bacteria | 6924660 |
| 278 | 8054505172 | 8054503363 | Bacteria | 6101651 |
| 279 | 8056127535 | 8056125926 | Bacteria | 6228218 |
| 280 | 8056133496 | 8056131705 | Bacteria | 6107031 |
| 281 | 8056149773 | 8056148874 | Bacteria | 6479865 |
| 282 | 8056179436 | 8056177738 | Bacteria | 6748268 |
| 283 | Ga0495648_0015665 | |||
| 284 | MRS2a_Contig_949 | |||
| 285 | JGI25162J39368_1000330 | |||
| 286 | JGI25163J39215_1000287 | |||
| 287 | JGI25164J39214_1000251 | |||
| 288 | JGI25165J46597_1000362 | |||
| 289 | Ga0065714_10002270 | |||
| 290 | Ga0065714_10065403 | |||
| 291 | Ga0070670_100001543 | |||
| 292 | Ga0070661_100000132 | |||
| 293 | Ga0070664_100000361 | |||
| 294 | Ga0075432_10010488 | |||
| 295 | Ga0075432_10035150 | |||
| 296 | Ga0075432_10048108 | |||
| 297 | Ga0075362_10078966 | |||
| 298 | Ga0075369_10087488 | |||
| 299 | Ga0075431_100001319 | |||
| 300 | Ga0099823_1046345 | |||
| 301 | Ga0079104_1000115 | |||
| 302 | Ga0105251_10001056 | |||
| 303 | Ga0105251_10003620 | |||
| 304 | Ga0105251_10007086 | |||
| 305 | Ga0105244_10000300 | |||
| 306 | Ga0105244_10000547 | |||
| 307 | Ga0105244_10001592 | |||
| 308 | Ga0105244_10001595 | |||
| 309 | Ga0105244_10002020 | |||
| 310 | Ga0105250_10000415 | |||
| 311 | Ga0105250_10006640 | |||
| 312 | Ga0105250_10011930 | |||
| 313 | Ga0105243_10004552 | |||
| 314 | Ga0105249_10023937 | |||
| 315 | Ga0157373_10000684 | |||
| 316 | Ga0157371_10033740 | |||
| 317 | Ga0157370_10030847 | |||
| 318 | Ga0157369_10003354 | |||
| 319 | Ga0157369_10003414 | |||
| 320 | Ga0182008_10000912 | |||
| 321 | Ga0182008_10001622 | |||
| 322 | Ga0182008_10022174 | |||
| 323 | Ga0182007_10000772 | |||
| 324 | Ga0182007_10041369 | |||
| 325 | Ga0163161_10000482 | |||
| 326 | Ga0163161_10004889 | |||
| 327 | Ga0209760_100043 | |||
| 328 | Ga0207427_100082 | |||
| 329 | Ga0209437_100006 | |||
| 330 | Ga0209233_1000105 | |||
| 331 | Ga0209676_1000309 | |||
| 332 | Ga0207696_1000097 | |||
| 333 | Ga0207696_1000373 | |||
| 334 | Ga0207655_1000421 | |||
| 335 | Ga0207655_1000485 | |||
| 336 | Ga0207655_1000706 | |||
| 337 | Ga0207655_1000744 | |||
| 338 | Ga0207655_1001457 | |||
| 339 | Ga0207655_1044128 | |||
| 340 | Ga0207713_1001078 | |||
| 341 | Ga0207713_1006661 | |||
| 342 | Ga0207713_1023253 | |||
| 343 | Ga0207649_10000002 | |||
| 344 | Ga0207650_10001130 | |||
| 345 | Ga0207709_10001759 | |||
| 346 | Ga0207679_10000006 | |||
| 347 | Ga0209281_1000077 | |||
| 348 | Ga0209389_1055960 | |||
| 349 | Ga0209371_1000338 | |||
| 350 | Ga0207428_10022515 | |||
| 351 | Ga0207428_10056856 | |||
| 352 | Ga0207428_10064658 | |||
| 353 | Ga0268256_1000289 | |||
| 354 | Ga0307412_10000311 | |||
| 355 | Ga0439438_000275 | |||
| 356 | Ga0439438_000402 | |||
| 357 | Ga0439438_003901 | |||
| 358 | Ga0439438_015032 | |||
| 359 | Ga0439447_000209 | |||
| 360 | Ga0439466_0000423 | |||
| 361 | Ga0439466_0001149 | |||
| 362 | Ga0439466_0004559 | |||
| 363 | Ga0439432_000134 | |||
| 364 | Ga0439432_000178 | |||
| 365 | Ga0439432_008477 | |||
| 366 | Ga0439432_013123 | |||
| 367 | Ga0439451_000248 | |||
| 368 | Ga0439451_002364 | |||
| 369 | Ga0439452_000602 | |||
| 370 | Ga0439452_001021 | |||
| 371 | Ga0439456_000929 | |||
| 372 | Ga0439456_019912 | |||
| 373 | Ga0439463_000392 | |||
| 374 | Ga0439463_001553 | |||
| 375 | Ga0439463_002335 | |||
| 376 | Ga0450920_000041 | |||
| 377 | Ga0450922_000005 | |||
| 378 | Ga0450923_000599 | |||
| 379 | Ga0450903_000564 | |||
| 380 | Ga0450906_000092 | |||
| 381 | Ga0450906_017466 | |||
| 382 | Ga0450907_000218 | |||
| 383 | Ga0450910_000026 | |||
| 384 | Ga0450908_001662 | |||
| 385 | Ga0439464_0032573 | |||
| 386 | Ga0439460_0000024 | |||
| 387 | Ga0439460_0000071 | |||
| 388 | Ga0495617_000200 | |||
| 389 | Ga0495627_022770 | |||
| 390 | Ga0495627_052506 | |||
| 391 | Ga0495590_0026303 | |||
| 392 | Ga0495591_000128 | |||
| 393 | Ga0495591_000210 | |||
| 394 | Ga0495591_006769 | |||
| 395 | Ga0495638_0000602 | |||
| 396 | Ga0495638_0000726 | |||
| 397 | Ga0495638_0006834 | |||
| 398 | Ga0495638_0012983 | |||
| 399 | Ga0495638_0017778 | |||
| 400 | Ga0495638_0033515 | |||
| 401 | Ga0495650_0001217 | |||
| 402 | Ga0495605_0000593 | |||
| 403 | Ga0495605_0000672 | |||
| 404 | Ga0495605_0012903 | |||
| 405 | Ga0495584_0000373 | |||
| 406 | Ga0495596_0001869 | |||
| 407 | Ga0495607_0000513 | |||
| 408 | Ga0495607_0000639 | |||
| 409 | Ga0495607_0003343 | |||
| 410 | Ga0495583_0000460 | |||
| 411 | Ga0495583_0000994 | |||
| 412 | Ga0495606_0002669 | |||
| 413 | Ga0495610_0000774 | |||
| 414 | Ga0495610_0000828 | |||
| 415 | Ga0495610_0001566 | |||
| 416 | Ga0495610_0002459 | |||
| 417 | Ga0495610_0003092 | |||
| 418 | Ga0495620_0000457 | |||
| 419 | Ga0495620_0001230 | |||
| 420 | Ga0495631_0001820 | |||
| 421 | Ga0495632_0000744 | |||
| 422 | Ga0495632_0120406 | |||
| 423 | Ga0495637_0000435 | |||
| 424 | Ga0495637_0001629 | |||
| 425 | Ga0495637_0015820 | |||
| 426 | Ga0495643_0000654 | |||
| 427 | Ga0495643_0001100 | |||
| 428 | Ga0495643_0009054 | |||
| 429 | Ga0495643_0032789 | |||
| 430 | Ga0495648_0000533 | |||
| 431 | Ga0495648_0000600 | |||
| 432 | Ga0495648_0000644 | |||
| 433 | Ga0495648_0135694 | |||
| 434 | Ga0495654_0000267 | |||
| 435 | Ga0495654_0000411 | |||
| 436 | Ga0495654_0001758 | |||
| 437 | Ga0495654_0001845 | |||
| 438 | Ga0495654_0002608 | |||
| 439 | Ga0495654_0023280 | |||
| 440 | Ga0495609_0000446 | |||
| 441 | Ga0495609_0000689 | |||
| 442 | Ga0495597_0000059 | |||
| 443 | Ga0495597_0011694 | |||
| 444 | Ga0495597_0150094 | |||
| 445 | Ga0495622_0002188 | |||
| 446 | Ga0495633_0005500 | |||
| 447 | Ga0495611_0002136 | |||
| 448 | Ga0495625_0012596 | |||
| 449 | Ga0495625_0025320 | |||
| 450 | Ga0495661_0031397 | |||
| 451 | Ga0495588_0032783 | |||
| 452 | Ga0495670_0011315 | |||
| 453 | Ga0495671_0000501 | |||
| 454 | Ga0495671_0003687 | |||
| 455 | Ga0495671_0012182 | |||
| 456 | Ga0495671_0043454 | |||
| 457 | Ga0495649_0003317 | |||
| 458 | Ga0495649_0005635 | |||
| 459 | Ga0495589_0000360 | |||
| 460 | Ga0495589_0000578 | |||
| 461 | Ga0495636_0000132 | |||
| 462 | Ga0495672_0000378 | |||
| 463 | Ga0495672_0000695 | |||
| 464 | Ga0495672_0000795 | |||
| 465 | Ga0495672_0001265 | |||
| 466 | Ga0495672_0013411 | |||
| 467 | Ga0495672_0181035 | |||
| 468 | Ga0495683_0000367 | |||
| 469 | Ga0495683_0000825 | |||
| 470 | Ga0495673_0024346 | |||
| 471 | Ga0495681_0002623 | |||
| 472 | Ga0495686_0002714 | |||
| 473 | Ga0495626_0000524 | |||
| 474 | Ga0495626_0000561 | |||
| 475 | Ga0496102_0068015 | |||
| 476 | Ga0496112_0097116 | |||
| 477 | Ga0496114_0006291 | |||
| 478 | Ga0496116_0000532 | |||
| 479 | Ga0496116_0001782 | |||
| 480 | Ga0496117_0000861 | |||
| 481 | Ga0496117_0001050 | |||
| 482 | Ga0496117_0001815 | |||
| 483 | Ga0496117_0002469 | |||
| 484 | Ga0496117_0019924 | |||
| 485 | Ga0496118_0002174 | |||
| 486 | Ga0496118_0002659 | |||
| 487 | Ga0496118_0004948 | |||
| 488 | Ga0496118_0024896 | |||
| 489 | Ga0496118_0032223 | |||
| 490 | Ga0496118_0036901 | |||
| 491 | Ga0496121_0001218 | |||
| 492 | Ga0496121_0002497 | |||
| 493 | Ga0496121_0072098 | |||
| 494 | Ga0496122_0001752 | |||
| 495 | Ga0496122_0004377 | |||
| 496 | Ga0496122_0009231 | |||
| 497 | Ga0496122_0145010 | |||
| 498 | Ga0496123_0001351 | |||
| 499 | Ga0496123_0002412 | |||
| 500 | Ga0496123_0003215 | |||
| 501 | Ga0496123_0005985 | |||
| 502 | Ga0496124_0004905 | |||
| 503 | Ga0496124_0006745 | |||
| 504 | Ga0496124_0006938 | |||
| 505 | Ga0496125_0002952 | |||
| 506 | Ga0496125_0022710 | |||
| 507 | Ga0496125_0033071 | |||
| 508 | Ga0496126_0002379 | |||
| 509 | Ga0495678_062380 | |||
| 510 | Ga0495682_0010387 | |||
| 511 | nmdc:mga06r32_781_c1 | |||
| 512 | 2511273025 | |||
| 513 | 2511345890 | |||
| 514 | 2511359390 | |||
| 515 | 2555671316 | |||
| 516 | 2599354524 | |||
| 517 | 2599359762 | |||
| 518 | 2599366084 | |||
| 519 | 2599372874 | |||
| 520 | 2599379632 | |||
| 521 | 2599385390 | |||
| 522 | 2599391733 | |||
| 523 | 2599403499 | |||
| 524 | 2599461358 | |||
| 525 | 2599469902 | |||
| 526 | 2599490378 | |||
| 527 | 2599964836 | |||
| 528 | 2599976051 | |||
| 529 | 2600010068 | |||
| 530 | 2600213975 | |||
| 531 | 2601774141 | |||
| 532 | 2643956538 | |||
| 533 | 2644025420 | |||
| 534 | 2644281669 | |||
| 535 | 2671097105 | |||
| 536 | 2715751253 | |||
| 537 | 2765585385 | |||
| 538 | 2808941465 | |||
| 539 | 2808975814 | |||
| 540 | 2808990548 | |||
| 541 | 2819702200 | |||
| 542 | 2842836545 | |||
| 543 | 2842844658 | |||
| 544 | 2844671842 | |||
| 545 | 2852614893 | |||
| 546 | 2852669861 | |||
| 547 | 2904555075 | |||
| 548 | 2908448512 | |||
| 549 | 2917075180 | |||
| 550 | 2919157458 | |||
| 551 | 2919489791 | |||
| 552 | 2935356168 | |||
| 553 | 2939637584 | |||
| 554 | 2974289916 | |||
| 555 | 3007513109 | |||
| 556 | 3007807424 | |||
| 557 | 3007865445 | |||
| 558 | 637321643 | |||
| 559 | 8019773108 | |||
| 560 | 8054505172 | |||
| 561 | 8056127535 | |||
| 562 | 8056133496 | |||
| 563 | 8056149773 | |||
| 564 | 8056179436 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6oyz-assembly3.cif.gz_B | crystal structure of mray bound to capuramycin | 0.7872 | 20 | 238 |
| 8cxr-assembly1.cif.gz_A | crystal structure of mray bound to a sphaerimicin analogue | 0.781 | 2 | 238 |
| 6oz6-assembly3.cif.gz_C | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.7527 | 2 | 238 |
| 6bw5-assembly2.cif.gz_C | human gpt (dpagt1) in complex with tunicamycin | 0.7423 | 17 | 189 |
| 6oz6-assembly4.cif.gz_D | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.731 | 2 | 238 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WPG3_21_202_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.3375 | 82 | 262 | 1.20.120.1760 |
| af_P9WPG3_21_202_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.3259 | 82 | 262 | 1.20.120.1760 |
| af_P25960_74_220_1.20.120.1220 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.3232 | 16 | 193 | 1.20.120.1220 |
| af_Q54YE2_26_310_1.10.600.10 | Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase | 0.3035 | 149 | 261 | 1.10.600.10 |
| af_F1QW05_54_223_1.20.1260.10 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.2888 | 95 | 262 | 1.20.1260.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A836ZIM0-F1-model_v4 | deleted | 0.9816 | 1 | 87 |
|
| AF-A0A832N3D0-F1-model_v4 | Glycosyl transferase | 0.9617 | 1 | 86 |
GO:0005886
GO:0009103 GO:0016780 GO:0044038 GO:0071555 |
| AF-A0A3D1BBK3-F1-model_v4 | Glycosyl transferase | 0.9589 | 167 | 267 |
GO:0016020
GO:0016740 |
| AF-A0A5E7RUI2-F1-model_v4 | Undecaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase (EC 2.7.8.33) | 0.9456 | 2 | 268 |
GO:0005886
GO:0009103 GO:0036380 GO:0044038 GO:0046872 GO:0071555 |
| AF-A0A7Y9VY14-F1-model_v4 | Fuc2NAc and GlcNAc transferase (EC 2.4.1.-) | 0.944 | 13 | 267 |
GO:0005886
GO:0009103 GO:0016757 GO:0016780 GO:0044038 GO:0046872 GO:0071555 |