F383677

General Info

Members Datasets Scaffolds Average Seq Length
280 159 560 74

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_11925448|Ga0157374_119254482
Length 81
Sequence MDAKSMDEKTGTAGNHAHAHAGGCFFCDTAMPALENLVSESTRDHFRNSRVEFLKGLRSLLDERIAHMSRAETKGTKVTVE

Samples

Sample ID Description Type Environment
1 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
61 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
63 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
64 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
92 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
93 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
94 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
95 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
96 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
97 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
98 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
99 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
100 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
101 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
102 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
103 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
106 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
107 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
108 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
109 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
110 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
111 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
112 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
113 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
114 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
115 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
116 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
117 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
118 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
119 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
120 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
121 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
122 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
123 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
124 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
125 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
126 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
127 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
128 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
129 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
130 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
131 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
132 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
133 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
134 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
135 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
136 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
137 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
138 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
139 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
140 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
141 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
142 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
143 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
144 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
145 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
146 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
147 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
148 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
149 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
153 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
154 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95
Metatranscriptomes 5
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.43
Rhizosphere 95
Stem 0
Stem Tuber 0
Unclassified 58.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157374_11925448 3300013296 Unclassified 617
2 Ga0058862_11303296 3300004803 Unclassified 580
3 Ga0058862_12314977 3300004803 Bacteria 718
4 Ga0070683_100717974 3300005329 Bacteria 957
5 Ga0070690_100521187 3300005330 Bacteria 892
6 Ga0070690_101508857 3300005330 Unclassified 543
7 Ga0070670_100466872 3300005331 Bacteria 1120
8 Ga0068869_100286333 3300005334 Bacteria 1326
9 Ga0068869_100490722 3300005334 Bacteria 1024
10 Ga0070680_100760356 3300005336 Unclassified 834
11 Ga0070682_100200916 3300005337 Bacteria 1406
12 Ga0070682_101670350 3300005337 Unclassified 552
13 Ga0070689_100210793 3300005340 Unclassified 1590
14 Ga0070671_101564835 3300005355 Bacteria 584
15 Ga0070667_101181616 3300005367 Bacteria 716
16 Ga0070709_11058063 3300005434 Unclassified 647
17 Ga0070709_11530307 3300005434 Unclassified 542
18 Ga0070714_100330917 3300005435 Unclassified 1426
19 Ga0070713_100357847 3300005436 Unclassified 1355
20 Ga0070713_100849885 3300005436 Unclassified 876
21 Ga0070710_11284983 3300005437 Unclassified 544
22 Ga0070711_100516959 3300005439 Bacteria 986
23 Ga0070678_102039130 3300005456 Unclassified 543
24 Ga0070681_10201015 3300005458 Unclassified 1911
25 Ga0070685_10403701 3300005466 Bacteria 947
26 Ga0070685_10499694 3300005466 Unclassified 860
27 Ga0070679_100087887 3300005530 Unclassified 3096
28 Ga0070684_100261045 3300005535 Bacteria 1584
29 Ga0070684_100355852 3300005535 Bacteria 1347
30 Ga0070684_100962206 3300005535 Unclassified 801
31 Ga0068853_100855832 3300005539 Unclassified 872
32 Ga0068853_102276068 3300005539 Bacteria 525
33 Ga0070686_101427627 3300005544 Unclassified 581
34 Ga0070665_100351401 3300005548 Bacteria 1480
35 Ga0070665_100470731 3300005548 Unclassified 1267
36 Ga0068855_100686024 3300005563 Bacteria 1097
37 Ga0068855_101605186 3300005563 Unclassified 665
38 Ga0068857_101380383 3300005577 Bacteria 685
39 Ga0068856_100939953 3300005614 Unclassified 883
40 Ga0068852_102028070 3300005616 Unclassified 597
41 Ga0068859_102862273 3300005617 Bacteria 529
42 Ga0068864_100346894 3300005618 Bacteria 1400
43 Ga0068864_101172904 3300005618 Bacteria 766
44 Ga0068864_101764710 3300005618 Bacteria 624
45 Ga0068863_100251565 3300005841 Bacteria 1707
46 Ga0068863_100276563 3300005841 Bacteria 1626
47 Ga0068858_101976915 3300005842 Unclassified 576
48 Ga0068860_101289816 3300005843 Unclassified 751
49 Ga0070717_10058551 3300006028 Bacteria 3186
50 Ga0070717_10157548 3300006028 Bacteria 1968
51 Ga0070712_101678005 3300006175 Unclassified 556
52 Ga0097621_100290994 3300006237 Unclassified 1440
53 Ga0097621_100461893 3300006237 Bacteria 1145
54 Ga0097621_100922653 3300006237 Unclassified 814
55 Ga0097621_101110066 3300006237 Unclassified 743
56 Ga0097621_101807081 3300006237 Unclassified 583
57 Ga0068871_100829578 3300006358 Unclassified 854
58 Ga0068871_101919059 3300006358 Unclassified 563
59 Ga0075430_100691926 3300006846 Unclassified 840
60 Ga0097620_102861607 3300006931 Bacteria 529
61 Ga0111539_10070211 3300009094 Bacteria 4135
62 Ga0105245_12258265 3300009098 Unclassified 598
63 Ga0114129_11218093 3300009147 Unclassified 937
64 Ga0105241_11947368 3300009174 Archaea 577
65 Ga0105241_12468137 3300009174 Unclassified 520
66 Ga0105242_10963605 3300009176 Unclassified 858
67 Ga0105242_11557535 3300009176 Unclassified 693
68 Ga0105242_12521649 3300009176 Bacteria 563
69 Ga0105248_10044361 3300009177 Bacteria 4987
70 Ga0105248_10058853 3300009177 Bacteria 4315
71 Ga0105248_10227323 3300009177 Bacteria 2100
72 Ga0105248_10440079 3300009177 Bacteria 1468
73 Ga0105248_11326255 3300009177 Unclassified 814
74 Ga0105248_12610583 3300009177 Unclassified 576
75 Ga0105248_12865512 3300009177 Bacteria 550
76 Ga0105237_10185462 3300009545 Bacteria 2080
77 Ga0105237_11615802 3300009545 Unclassified 655
78 Ga0105238_10551702 3300009551 Bacteria 1157
79 Ga0105239_10324064 3300010375 Archaea 1738
80 Ga0105239_10343496 3300010375 Bacteria 1685
81 Ga0105239_11367505 3300010375 Unclassified 817
82 Ga0105239_12964711 3300010375 Unclassified 553
83 Ga0105239_13247719 3300010375 Unclassified 529
84 Ga0105246_10209041 3300011119 Bacteria 1522
85 Ga0105246_10809028 3300011119 Bacteria 832
86 Ga0157369_10152130 3300013105 Unclassified 2446
87 Ga0157374_10575355 3300013296 Unclassified 1135
88 Ga0163162_10523375 3300013306 Unclassified 1315
89 Ga0163162_12424781 3300013306 Bacteria 603
90 Ga0157372_10169893 3300013307 Unclassified 2522
91 Ga0157372_13259342 3300013307 Unclassified 517
92 Ga0157372_13439539 3300013307 Archaea 503
93 Ga0157375_10606129 3300013308 Bacteria 1254
94 Ga0157375_10906460 3300013308 Unclassified 1025
95 Ga0157375_11064269 3300013308 Unclassified 946
96 Ga0157375_11257549 3300013308 Bacteria 869
97 Ga0163163_10085818 3300014325 Bacteria 3156
98 Ga0163163_10096539 3300014325 Bacteria 2976
99 Ga0163163_10123472 3300014325 Unclassified 2625
100 Ga0163163_12655360 3300014325 Unclassified 558
101 Ga0163163_12690152 3300014325 Unclassified 555
102 Ga0157380_13190322 3300014326 Unclassified 523
103 Ga0157377_11393765 3300014745 Unclassified 552
104 Ga0157376_10145657 3300014969 Bacteria 2130
105 Ga0157376_10192242 3300014969 Bacteria 1872
106 Ga0157376_10251844 3300014969 Unclassified 1650
107 Ga0157376_10720978 3300014969 Unclassified 1004
108 Ga0157376_11094933 3300014969 Bacteria 822
109 Ga0157376_11730903 3300014969 Bacteria 661
110 Ga0157376_12074478 3300014969 Bacteria 607
111 Ga0163161_10259015 3300017792 Unclassified 1358
112 Ga0197907_10863319 3300020069 Bacteria 788
113 Ga0206355_1234753 3300020076 Unclassified 525
114 Ga0206355_1646576 3300020076 Bacteria 1322
115 Ga0206350_10060133 3300020080 Unclassified 509
116 Ga0206350_10947001 3300020080 Bacteria 729
117 Ga0213876_10097298 3300021384 Bacteria 1560
118 Ga0213875_10014153 3300021388 Bacteria 3899
119 Ga0213875_10078335 3300021388 Unclassified 1542
120 Ga0224712_10246076 3300022467 Unclassified 825
121 Ga0207682_10262987 3300025893 Unclassified 805
122 Ga0207680_11004170 3300025903 Unclassified 597
123 Ga0207671_10248316 3300025914 Bacteria 1399
124 Ga0207693_11104439 3300025915 Unclassified 602
125 Ga0207663_10633911 3300025916 Unclassified 842
126 Ga0207660_10208844 3300025917 Bacteria 1528
127 Ga0207660_10677664 3300025917 Unclassified 841
128 Ga0207652_10210432 3300025921 Bacteria 1751
129 Ga0207694_10709259 3300025924 Bacteria 848
130 Ga0207687_10989022 3300025927 Unclassified 721
131 Ga0207700_11084155 3300025928 Unclassified 716
132 Ga0207700_11230588 3300025928 Unclassified 668
133 Ga0207644_10792102 3300025931 Unclassified 793
134 Ga0207686_11108158 3300025934 Unclassified 646
135 Ga0207686_11595603 3300025934 Bacteria 539
136 Ga0207670_10210907 3300025936 Unclassified 1481
137 Ga0207711_10149459 3300025941 Bacteria 2107
138 Ga0207711_10171011 3300025941 Bacteria 1971
139 Ga0207711_10186681 3300025941 Unclassified 1888
140 Ga0207661_10599461 3300025944 Bacteria 1011
141 Ga0207661_11503348 3300025944 Unclassified 617
142 Ga0207679_11393314 3300025945 Bacteria 643
143 Ga0207667_10883126 3300025949 Bacteria 887
144 Ga0207667_11805029 3300025949 Bacteria 576
145 Ga0207658_11327030 3300025986 Bacteria 658
146 Ga0207658_11371238 3300025986 Bacteria 647
147 Ga0207703_11012674 3300026035 Unclassified 797
148 Ga0207703_11253266 3300026035 Unclassified 713
149 Ga0207641_10277378 3300026088 Bacteria 1575
150 Ga0207641_11453636 3300026088 Bacteria 687
151 Ga0207648_11409937 3300026089 Bacteria 655
152 Ga0207676_10415173 3300026095 Unclassified 1261
153 Ga0207683_10293898 3300026121 Unclassified 1486
154 Ga0207428_10196789 3300027907 Bacteria 1517
155 Ga0268266_11628602 3300028379 Unclassified 621
156 Ga0268264_10791637 3300028381 Unclassified 947
157 Ga0265340_10416797 3300031247 Unclassified 592
158 Ga0265316_10007570 3300031344 Bacteria 10215
159 Ga0265316_10037420 3300031344 Bacteria 3916
160 Ga0265316_10361846 3300031344 Unclassified 1049
161 Ga0265316_10850652 3300031344 Bacteria 638
162 Ga0373934_0120556 3300035086 Unclassified 1067
163 Ga0373945_0056508 3300035116 Unclassified 1456
164 Ga0373954_0154768 3300035118 Bacteria 1121
165 Ga0373957_0365990 3300035120 Unclassified 617
166 Ga0373943_0372574 3300035170 Unclassified 821
167 Ga0373943_0458953 3300035170 Unclassified 741
168 Ga0373955_0195120 3300035172 Unclassified 1205
169 Ga0373931_0424209 3300035691 Unclassified 846
170 Ga0373935_0195054 3300035692 Unclassified 1397
171 Ga0373927_0113147 3300035695 Bacteria 1769
172 Ga0373927_0400338 3300035695 Unclassified 906
173 Ga0373927_0603880 3300035695 Unclassified 725
174 Ga0373927_0684007 3300035695 Unclassified 678
175 Ga0373927_1073108 3300035695 Unclassified 531
176 Ga0373947_1064105 3300035725 Unclassified 552
177 Ga0373937_0287976 3300036401 Bacteria 1552
178 Ga0373937_1017789 3300036401 Unclassified 777
179 Ga0373925_0072922 3300037068 Bacteria 2598
180 Ga0373925_0282860 3300037068 Unclassified 1336
181 Ga0373925_0538388 3300037068 Unclassified 960
182 Ga0436364_0004507 3300037853 Unclassified 1067
183 Ga0436364_0203936 3300037853 Unclassified 3493
184 Ga0436364_0732889 3300037853 Unclassified 4004
185 Ga0436364_1262834 3300037853 Bacteria 5173
186 Ga0436365_0435879 3300039437 Bacteria 4733
187 Ga0436365_0557137 3300039437 Unclassified 668
188 Ga0436365_1585768 3300039437 Unclassified 730
189 Ga0451577_0664134 3300042876 Bacteria 945
190 Ga0451577_0994734 3300042876 Unclassified 753
191 Ga0466963_0164777 3300044694 Unclassified 1544
192 Ga0466959_0028449 3300045049 Bacteria 4145
193 Ga0451576_0223708 3300045051 Unclassified 1965
194 Ga0451576_0374942 3300045051 Bacteria 1491
195 Ga0495592_0248932 3300046454 Unclassified 1175
196 Ga0495603_0671241 3300046455 Unclassified 593
197 Ga0495629_0697805 3300046459 Unclassified 674
198 Ga0495651_0362674 3300046462 Unclassified 954
199 Ga0495580_0000327 3300046472 Bacteria 39015
200 Ga0495580_0371070 3300046472 Unclassified 967
201 Ga0495580_0400045 3300046472 Unclassified 926
202 Ga0495580_0412132 3300046472 Bacteria 910
203 Ga0495582_0130057 3300046473 Unclassified 1422
204 Ga0495639_0294215 3300046475 Unclassified 809
205 Ga0495664_0018386 3300046477 Bacteria 4003
206 Ga0495594_0277870 3300046499 Bacteria 954
207 Ga0495594_0675989 3300046499 Unclassified 584
208 Ga0495618_0045938 3300046514 Bacteria 2756
209 Ga0495618_0773210 3300046514 Unclassified 561
210 Ga0495628_0386290 3300046516 Bacteria 1024
211 Ga0495628_1041223 3300046516 Unclassified 561
212 Ga0495630_0470705 3300046517 Unclassified 963
213 Ga0495666_0316875 3300046526 Unclassified 704
214 Ga0495652_0301423 3300046529 Bacteria 1165
215 Ga0495652_0467962 3300046529 Unclassified 879
216 Ga0495652_0561061 3300046529 Bacteria 784
217 Ga0495665_0090593 3300046531 Bacteria 1607
218 Ga0495640_0114201 3300046533 Bacteria 1761
219 Ga0495640_0144134 3300046533 Unclassified 1533
220 Ga0495586_0248824 3300046535 Unclassified 1014
221 Ga0495587_0008341 3300046536 Bacteria 6670
222 Ga0495587_0350766 3300046536 Unclassified 822
223 Ga0495587_0679336 3300046536 Unclassified 565
224 Ga0495645_0236257 3300046543 Bacteria 1222
225 Ga0495645_0308145 3300046543 Bacteria 1032
226 Ga0495645_0474563 3300046543 Unclassified 786
227 Ga0495645_0519970 3300046543 Unclassified 741
228 Ga0495667_0056061 3300046559 Bacteria 2592
229 Ga0495667_0069093 3300046559 Unclassified 2306
230 Ga0495667_0421839 3300046559 Unclassified 840
231 Ga0495634_0176077 3300046642 Unclassified 1342
232 Ga0495634_0903088 3300046642 Unclassified 500
233 Ga0495635_0375495 3300046663 Unclassified 946
234 Ga0495599_0028527 3300046678 Bacteria 3499
235 Ga0495599_0252992 3300046678 Unclassified 1072
236 Ga0495623_0029801 3300046679 Bacteria 3511
237 Ga0495623_0169165 3300046679 Unclassified 1278
238 Ga0495623_0274573 3300046679 Bacteria 940
239 Ga0495623_0442721 3300046679 Unclassified 693
240 Ga0495646_0415444 3300046680 Unclassified 698
241 Ga0495646_0682827 3300046680 Unclassified 517
242 Ga0495669_0194415 3300046684 Unclassified 969
243 Ga0495613_0037900 3300046689 Bacteria 3573
244 Ga0495613_0329734 3300046689 Bacteria 1052
245 Ga0495613_0341965 3300046689 Unclassified 1029
246 Ga0495613_0364720 3300046689 Unclassified 990
247 Ga0495600_0498966 3300046809 Unclassified 748
248 Ga0495600_0708786 3300046809 Unclassified 605
249 Ga0495581_0573306 3300047315 Unclassified 654
250 Ga0495604_0325227 3300047317 Unclassified 1027
251 Ga0495604_0531238 3300047317 Unclassified 760
252 Ga0495604_0608479 3300047317 Unclassified 700
253 Ga0495636_0694793 3300047318 Bacteria 502
254 Ga0495674_0005296 3300047319 Bacteria 12370
255 Ga0495674_0218596 3300047319 Bacteria 1576
256 Ga0495674_0487484 3300047319 Unclassified 987
257 Ga0495676_0185337 3300047321 Unclassified 1456
258 Ga0495680_0159762 3300047322 Unclassified 1637
259 Ga0495680_0705458 3300047322 Unclassified 666
260 Ga0495680_0774989 3300047322 Unclassified 628
261 Ga0495675_0179262 3300047444 Bacteria 1298
262 Ga0495675_0496559 3300047444 Unclassified 701
263 Ga0495675_0571158 3300047444 Bacteria 643
264 Ga0495684_0010018 3300047471 Bacteria 7328
265 Ga0495684_0020747 3300047471 Bacteria 5062
266 Ga0495684_0111352 3300047471 Unclassified 2065
267 Ga0495602_0017463 3300048088 Bacteria 7194
268 Ga0495602_0287234 3300048088 Bacteria 1209
269 Ga0496101_1398982 3300048904 Unclassified 546
270 Ga0496104_0525266 3300048907 Unclassified 1095
271 Ga0496114_0424613 3300048917 Unclassified 1178
272 Ga0496115_0463814 3300048918 Bacteria 1022
273 nmdc:mga05p37_827166_c1 3300050507 Unclassified 616
274 nmdc:mga08y16_568911_c1 3300050511 Unclassified 1145
275 Ga0587073_0059450 3300059492 Unclassified 892
276 Ga0587085_047483 3300059506 Unclassified 771
277 Ga0587128_006175 3300059630 Unclassified 1464
278 Ga0587130_028888 3300059631 Unclassified 632
279 Ga0587079_241740 3300059647 Unclassified 510
280 Ga0587111_0229259 3300060346 Unclassified 540
281 Ga0157374_11925448
282 Ga0058862_11303296
283 Ga0058862_12314977
284 Ga0070683_100717974
285 Ga0070690_100521187
286 Ga0070690_101508857
287 Ga0070670_100466872
288 Ga0068869_100286333
289 Ga0068869_100490722
290 Ga0070680_100760356
291 Ga0070682_100200916
292 Ga0070682_101670350
293 Ga0070689_100210793
294 Ga0070671_101564835
295 Ga0070667_101181616
296 Ga0070709_11058063
297 Ga0070709_11530307
298 Ga0070714_100330917
299 Ga0070713_100357847
300 Ga0070713_100849885
301 Ga0070710_11284983
302 Ga0070711_100516959
303 Ga0070678_102039130
304 Ga0070681_10201015
305 Ga0070685_10403701
306 Ga0070685_10499694
307 Ga0070679_100087887
308 Ga0070684_100261045
309 Ga0070684_100355852
310 Ga0070684_100962206
311 Ga0068853_100855832
312 Ga0068853_102276068
313 Ga0070686_101427627
314 Ga0070665_100351401
315 Ga0070665_100470731
316 Ga0068855_100686024
317 Ga0068855_101605186
318 Ga0068857_101380383
319 Ga0068856_100939953
320 Ga0068852_102028070
321 Ga0068859_102862273
322 Ga0068864_100346894
323 Ga0068864_101172904
324 Ga0068864_101764710
325 Ga0068863_100251565
326 Ga0068863_100276563
327 Ga0068858_101976915
328 Ga0068860_101289816
329 Ga0070717_10058551
330 Ga0070717_10157548
331 Ga0070712_101678005
332 Ga0097621_100290994
333 Ga0097621_100461893
334 Ga0097621_100922653
335 Ga0097621_101110066
336 Ga0097621_101807081
337 Ga0068871_100829578
338 Ga0068871_101919059
339 Ga0075430_100691926
340 Ga0097620_102861607
341 Ga0111539_10070211
342 Ga0105245_12258265
343 Ga0114129_11218093
344 Ga0105241_11947368
345 Ga0105241_12468137
346 Ga0105242_10963605
347 Ga0105242_11557535
348 Ga0105242_12521649
349 Ga0105248_10044361
350 Ga0105248_10058853
351 Ga0105248_10227323
352 Ga0105248_10440079
353 Ga0105248_11326255
354 Ga0105248_12610583
355 Ga0105248_12865512
356 Ga0105237_10185462
357 Ga0105237_11615802
358 Ga0105238_10551702
359 Ga0105239_10324064
360 Ga0105239_10343496
361 Ga0105239_11367505
362 Ga0105239_12964711
363 Ga0105239_13247719
364 Ga0105246_10209041
365 Ga0105246_10809028
366 Ga0157369_10152130
367 Ga0157374_10575355
368 Ga0163162_10523375
369 Ga0163162_12424781
370 Ga0157372_10169893
371 Ga0157372_13259342
372 Ga0157372_13439539
373 Ga0157375_10606129
374 Ga0157375_10906460
375 Ga0157375_11064269
376 Ga0157375_11257549
377 Ga0163163_10085818
378 Ga0163163_10096539
379 Ga0163163_10123472
380 Ga0163163_12655360
381 Ga0163163_12690152
382 Ga0157380_13190322
383 Ga0157377_11393765
384 Ga0157376_10145657
385 Ga0157376_10192242
386 Ga0157376_10251844
387 Ga0157376_10720978
388 Ga0157376_11094933
389 Ga0157376_11730903
390 Ga0157376_12074478
391 Ga0163161_10259015
392 Ga0197907_10863319
393 Ga0206355_1234753
394 Ga0206355_1646576
395 Ga0206350_10060133
396 Ga0206350_10947001
397 Ga0213876_10097298
398 Ga0213875_10014153
399 Ga0213875_10078335
400 Ga0224712_10246076
401 Ga0207682_10262987
402 Ga0207680_11004170
403 Ga0207671_10248316
404 Ga0207693_11104439
405 Ga0207663_10633911
406 Ga0207660_10208844
407 Ga0207660_10677664
408 Ga0207652_10210432
409 Ga0207694_10709259
410 Ga0207687_10989022
411 Ga0207700_11084155
412 Ga0207700_11230588
413 Ga0207644_10792102
414 Ga0207686_11108158
415 Ga0207686_11595603
416 Ga0207670_10210907
417 Ga0207711_10149459
418 Ga0207711_10171011
419 Ga0207711_10186681
420 Ga0207661_10599461
421 Ga0207661_11503348
422 Ga0207679_11393314
423 Ga0207667_10883126
424 Ga0207667_11805029
425 Ga0207658_11327030
426 Ga0207658_11371238
427 Ga0207703_11012674
428 Ga0207703_11253266
429 Ga0207641_10277378
430 Ga0207641_11453636
431 Ga0207648_11409937
432 Ga0207676_10415173
433 Ga0207683_10293898
434 Ga0207428_10196789
435 Ga0268266_11628602
436 Ga0268264_10791637
437 Ga0265340_10416797
438 Ga0265316_10007570
439 Ga0265316_10037420
440 Ga0265316_10361846
441 Ga0265316_10850652
442 Ga0373934_0120556
443 Ga0373945_0056508
444 Ga0373954_0154768
445 Ga0373957_0365990
446 Ga0373943_0372574
447 Ga0373943_0458953
448 Ga0373955_0195120
449 Ga0373931_0424209
450 Ga0373935_0195054
451 Ga0373927_0113147
452 Ga0373927_0400338
453 Ga0373927_0603880
454 Ga0373927_0684007
455 Ga0373927_1073108
456 Ga0373947_1064105
457 Ga0373937_0287976
458 Ga0373937_1017789
459 Ga0373925_0072922
460 Ga0373925_0282860
461 Ga0373925_0538388
462 Ga0436364_0004507
463 Ga0436364_0203936
464 Ga0436364_0732889
465 Ga0436364_1262834
466 Ga0436365_0435879
467 Ga0436365_0557137
468 Ga0436365_1585768
469 Ga0451577_0664134
470 Ga0451577_0994734
471 Ga0466963_0164777
472 Ga0466959_0028449
473 Ga0451576_0223708
474 Ga0451576_0374942
475 Ga0495592_0248932
476 Ga0495603_0671241
477 Ga0495629_0697805
478 Ga0495651_0362674
479 Ga0495580_0000327
480 Ga0495580_0371070
481 Ga0495580_0400045
482 Ga0495580_0412132
483 Ga0495582_0130057
484 Ga0495639_0294215
485 Ga0495664_0018386
486 Ga0495594_0277870
487 Ga0495594_0675989
488 Ga0495618_0045938
489 Ga0495618_0773210
490 Ga0495628_0386290
491 Ga0495628_1041223
492 Ga0495630_0470705
493 Ga0495666_0316875
494 Ga0495652_0301423
495 Ga0495652_0467962
496 Ga0495652_0561061
497 Ga0495665_0090593
498 Ga0495640_0114201
499 Ga0495640_0144134
500 Ga0495586_0248824
501 Ga0495587_0008341
502 Ga0495587_0350766
503 Ga0495587_0679336
504 Ga0495645_0236257
505 Ga0495645_0308145
506 Ga0495645_0474563
507 Ga0495645_0519970
508 Ga0495667_0056061
509 Ga0495667_0069093
510 Ga0495667_0421839
511 Ga0495634_0176077
512 Ga0495634_0903088
513 Ga0495635_0375495
514 Ga0495599_0028527
515 Ga0495599_0252992
516 Ga0495623_0029801
517 Ga0495623_0169165
518 Ga0495623_0274573
519 Ga0495623_0442721
520 Ga0495646_0415444
521 Ga0495646_0682827
522 Ga0495669_0194415
523 Ga0495613_0037900
524 Ga0495613_0329734
525 Ga0495613_0341965
526 Ga0495613_0364720
527 Ga0495600_0498966
528 Ga0495600_0708786
529 Ga0495581_0573306
530 Ga0495604_0325227
531 Ga0495604_0531238
532 Ga0495604_0608479
533 Ga0495636_0694793
534 Ga0495674_0005296
535 Ga0495674_0218596
536 Ga0495674_0487484
537 Ga0495676_0185337
538 Ga0495680_0159762
539 Ga0495680_0705458
540 Ga0495680_0774989
541 Ga0495675_0179262
542 Ga0495675_0496559
543 Ga0495675_0571158
544 Ga0495684_0010018
545 Ga0495684_0020747
546 Ga0495684_0111352
547 Ga0495602_0017463
548 Ga0495602_0287234
549 Ga0496101_1398982
550 Ga0496104_0525266
551 Ga0496114_0424613
552 Ga0496115_0463814
553 nmdc:mga05p37_827166_c1
554 nmdc:mga08y16_568911_c1
555 Ga0587073_0059450
556 Ga0587085_047483
557 Ga0587128_006175
558 Ga0587130_028888
559 Ga0587079_241740
560 Ga0587111_0229259

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6azr-assembly1.cif.gz_C crystal structure of the t264a hk853cp-bef3-rr468 complex 0.696 20 71
5dqw-assembly1.cif.gz_A the crystal structure of bacillus subtilis ypgq in complex with adp 0.5754 15 53
6azr-assembly1.cif.gz_C crystal structure of the t264a hk853cp-bef3-rr468 complex 0.5192 20 71
5dqw-assembly1.cif.gz_A the crystal structure of bacillus subtilis ypgq in complex with adp 0.3418 15 53
ID Description Score Start End Superfamily
6azrC01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Signal transduction histidine kinase, dimerisation/phosphotransfer (DHp) domain 0.7399 20 67 1.10.287.130
6azrC01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Signal transduction histidine kinase, dimerisation/phosphotransfer (DHp) domain 0.5177 20 67 1.10.287.130
ID Description Score Start End GO Terms
AF-A0A183WHF6-F1-model_v4 deleted 0.3661 1 66
AF-A0A183WHF6-F1-model_v4 deleted 0.3383 1 66

Map